histone-lysine N-methyltransferase SETD1B-A

Overview
Namehistone-lysine N-methyltransferase SETD1B-A
Smed IDSMED30025052
Length (bp)2671
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of histone-lysine N-methyltransferase SETD1B-A (SMED30025052) t-SNE clustered cells

Violin plots show distribution of expression levels for histone-lysine N-methyltransferase SETD1B-A (SMED30025052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of histone-lysine N-methyltransferase SETD1B-A (SMED30025052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for histone-lysine N-methyltransferase SETD1B-A (SMED30025052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025052SMESG000062286.1 dd_Smed_v4_11834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025052SMESG000062286.1 dd_Smed_v4_11834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025052SMESG000062286.1 dd_Smed_v4_11834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025052SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025052SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025052SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025052SMESG000062286.1 SMESG000027213.1 dd_Smed_v4_627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025052SMESG000062286.1 Contig44653newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025052SMESG000062286.1 Contig44653uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30025052SMESG000062286.1 dd_Smed_v4_11834_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025052SMESG000062286.1 dd_Smed_v4_11834_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. TrEMBL
Match: A0A2T7P701 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11802 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 9.161e-76
Identity = 239/869 (27.50%), Postives = 414/869 (47.64%), Query Frame = 1
Query:  205 RFSELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSXXXXXXXXXXXXXNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDG----IKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDL--------------------------FTKE-----LEDNKSXXXXXXXXXXXXXXXXXXXXXXXTVDVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNN--LYRSIKI-ILLTNDKSEKKIAHATIDWDEIKDL-------------------------DLKIFKEYNFRGDMVTPPPLSDEKPFSNLEP--------MMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDESLSPRSETP--KPATVLKSEFDAISNKFEEKLNSIREYYENKISEI-------SENNVKLSEKEP-----VRPPTVYHKDCAVS--------PIFPYRHVPGNRRLEKRETREVDNVNENRFSSKSRETLSTSGPDNQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNN---QLSVLNLFEM 2523
            +F  LC  V+N + +V NS  ++ + K  LL   + P VL++L++ + +LFRSISD+   ++EL+RLVR++S PWE+KS AL+KLH DYE K  QL++A++ L   +   KR+ +++ + NWE LFT+    + HGRRWK+ +   K KA+ G+ ++  Y Q L +  +     + +K+     E  +  S+   ++ +S  T+ E+                            T E     L+D  S      +    E+            + +V T +  + ++L +++Y P+G++  + LR  +   D I+ T  LD       +D+  E E        AV      G+   R + +V                  ++  +K +E  I +P +V  G  Q N  +     I + + + + E+  A A+I++ +IK+                          DL  F   +   +++ P   SD K  + L+         + FPLY  +    S++     G +P+  F+ ++ER  ++ R T T  +N LV ELTG++L   +K +L +E +D S S    TP  +  TV K E+D +  + +E+L  I+E YE ++ E+        E N+ LS+++      +RP +    +  +S        P+  +  +P  + +  R +     ++      + +  L + G  +++E    A    +         +  +LP+ F ER+  F E+S  +K++L+ R   E+  ++E KLA  +KL+    EE V  AL D+ LPA+FMP    TG I+NPRAHQYFHP G  + RL+Q PS+F+LPP+ +N   +L V+NLFE+
Sbjct:   54 KFDGLCDGVLNAIALVHNSFKEMLDLKDKLLNHALPPPVLIQLAMTSSRLFRSISDLNMTVNELVRLVRLFSTPWEEKSAALKKLHEDYESKQRQLNIAIKRLQLVDAHSKRIAREKRIMNWEKLFTKVTSSKGHGRRWKFLIETIKQKARMGLEHVQAYTQALEESSESEDEDVADKAPIARAESGLKGSKDTDEQEDSDDTDNEEADEESGFEGSEIKLNGFEATHIPIVIHVTAEDEEENLDDTFSRVGSPKKVRFNEETVVTQAVKPPVAESAVWTGEPEYDRSLFVRVYCPDGLQQTQ-LRCTLTCNDQIFKTGILDPA-----DDEESEVEQPAKRPKAAVH-----GMSTTRPSPEVSLTNYG-----------GVKKHKKFKEFEILVPEEVPKGALQLNKQVAEPANIQVAVHHGQYEELFAMASINFQDIKESNLQTVYLQPVYGNDTSLQLELGSSSDLADFDSVSDSVELMLPDDNSDNKMHTVLQEDQARDINILPFPLYP-LHAGRSDALHKPCGTVPLMLFWGKRERPRMYTRQTGTLGLNDLVFELTGIDLSTTTKEDLHKEAMDRSTSAVIFTPDVQEETVTKLEYDQLVYRHQEELQYIQEEYERRLQELMQSLEAMQEENLALSQQQQQQQQILRPLSTSSHNSRISRGSASSPGPVH-FIPMPPKKTMTPRSSSAEKTMSRLTTPVEVKSMLESGGTKSRSEPPRTAKSQRKVKVGHALPKWGESLPQDFFERLRLFQEESKIHKQELSERTLKELKDSLEKKLAGQHKLSKQ--EELVYDALKDVSLPALFMPL--KTGNIFNPRAHQYFHPTGTTDVRLTQPPSVFQLPPLPSNNRQKLPVVNLFEL 894          
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. TrEMBL
Match: A0A1W2W622 (uncharacterized protein LOC100180644 OS=Ciona intestinalis OX=7719 GN=LOC100180644 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.128e-62
Identity = 235/853 (27.55%), Postives = 396/853 (46.42%), Query Frame = 1
Query:  205 RFSELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSXXXXXXXXXXXXXNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDE-------------DDGIKEK-----SIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSXXXXXXXXXXXXXXXXX----------------XXXXXXTVDVSVGTSDLNFSQTLVMKIYNPNGIEHFE--NLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSE------------KKIAHATIDWDEIKDLDLKI----------FKEYNFRGDMVTPPPLSDEKP-------FSNLEPMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDE--------SLSPRSETPKPATVLKSEFDAISNKFEEKLNSIREYYENKISEISENNVKLSEKEPVRPPTVYHKDCAVSPIFPYRHVPGNRRLEKRETREVDNVNENRFSSKSRETLSTSGPDNQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKN-FRLSQAPSIFKLPPI-KNNQLSVLNLFEMGNHMQ 2538
            +F  LC  V NC+ +V +S S+L + K  LL+  + PS+LV ++L+ GK+FRSI+D++ P+ EL RLV +YS PWE++SEAL+KLH DYE K  QL++A+R L   +   +R+  ++ + NWE  F +    + HGRRWK+ +  FK K ++G+ NLH+    L D+             DDG+ EK     S+  A  P   D    T +  S   +  D    E+ D+    ++   +  + K                     +    + D SV T +  F Q LV++I+ P  ++  E  +L   + +G +   T  L  +       + +E+ +      V ++S+ KLG  G+   ++     K+           ++         ++ + ++    +N N   +  +++    DK++            K IA ATI WDEI++   +I           KE     +  T    SDE+         +N E  M PL      I   S    LGQLP+ C++   E+         T+ I  LV+++TGV+++ I+K+EL +    E             S + K   +   E + I  + + +L +I++ YE K+ ++      L E E ++         + + +F    + G  R E ++  +VD+ ++ +     R       P + + +  A               +  NLP++   R+   +E+    ++ L  RI++ I+  IE KLA  YKL    +E++    L D+ LPA+FMP  +  G +YNPRAHQYFHP G     RL+Q PSIF+LPP+ +  +LSV+NLFE+  + Q
Sbjct:   43 KFDCLCDGVNNCLSMVDSSFSELLDLKDELLQHELPPSLLVAITLVTGKMFRSITDLHTPIQELTRLVNIYSIPWEQRSEALKKLHTDYESKQRQLNIAIRRLQLIDAHTRRLDMEKRIMNWEKAFAKVTSSKTHGRRWKFLIEAFKKKLKDGV-NLHELEVELSDDESELDQDEPEHIVDDGVSEKQRFMLSVITASPPADDDG---TPQAGSDIESEADGIPSEISDSTGNVDDGSPDVKQRKRGVSFGPESDEPEIREVIREVVVKPPSEDKSVWTHEPEFDQHLVVRIFRPVELKDDEGLDLSCNVSFGGINKKTPTLASSSAHHTP-QTMEQVVQAEEAEVELKSQGKLG--GKSGRRKSIGFAKTPSSPAVPSSPSKVAAKPSSILKKVKVDDEPSDALNINR-SKYQEVMFDVGDKTDALRISVHQGEQAKMIAMATITWDEIQEKKFRIKMDEDNSSSQHKEKTTNNE--TGKTESDERDELTFEDRLANDELSMLPLQGIKLGIGGHSHGV-LGQLPVLCYWVMNEKMRYSDVQVNTDGIRELVQDVTGVDMNEITKDELVKMLSKEYNDVCTSAMSFVSSSSHKSGFIPVEEIEVIREQHDLELKNIQDEYEVKVQQL------LVEVERLQ--------TSQTQMFVQPAIDGESRYETKD--KVDHKHQ-KLPGIPRPPSPEGRPHSPSSHWRAP-------KIPQLPDWGANLPKNVWVRMRLLTEEMIIKRQQLDARIRSRIASNIEKKLASQYKLQR--SEKNFHGPLQDVSLPALFMP--SKGGNVYNPRAHQYFHPTGTSGELRLTQPPSIFQLPPLPEKAKLSVVNLFELSKNFQ 856          
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. TrEMBL
Match: A0A3M7QIP5 (Outer dense fiber 3 (Fragment) OS=Brachionus plicatilis OX=10195 GN=BpHYR1_018577 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.477e-50
Identity = 224/861 (26.02%), Postives = 406/861 (47.15%), Query Frame = 1
Query:  214 ELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSXXXXXXXXXXXXXNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKE------KSIFVAREPQMYDSRSKTQRNESSRTNY----------EDLFTKELEDN--------------KSXXXXXXXXXXXXXXXXXXXXXXXTVDVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLR-YLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLS-------------------DEKPFSNLE------PMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKV-----DESLSPRSETPK-------PATVLKSEFDAISNKFEEKLNSIREYYENKISEISENNVKLSEKEPVRPPTVYHKDCAVSPIFPYRHVPGNRRLEKRETREVDNVN-ENRFSSKSRETLSTSGPDNQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNN-QLSVLNLFEMGNHMQIKHYENDFNNHMNKKA 2586
            E C    + M I   +  D+ + K  LL   + P +L KL++I GK+FRS SD+  P++E++RLV++YS  WEK S  L+K+H  YE K   L+LA++ LA  ++  K   +++ + NWE LF R    + HGRRW++++  F+ K       L  +  +L + +D ++E      K +  A E Q  D   K    +  ++N           ED   K  E+N              +S+E+ + ++  ++ V+       E  D S+ T + ++S+ L+++++ P  + + + ++ +I  G++  ++ + +  K++ I D +          T    +KSK   I   KNK+    E+ +D  + E    +++ Y EK E +   I +             SI I L   D++E+   ++ +  D++  LDL I     F  D +    L                     E+ FS+ E      P  F +Y+      +  S   +  LP+  F+ RK   +  +++T T+ I  L+E+LTG +++  SK E+Q+        D + SP    P+       P++  +S    I N   +KL+ I E Y+ K+ E+     KL          +Y  +  +S I     +     +EK + +    +N +N    K+    S    +  ++NL     +++K ++   S++   L E F ER+  F++KSY +++++  +  ++ +  +E ++A L++L+ +   E     L D CLPA+FMP   S   +YNPRA QYFH  G  + R++Q PSIF+LPP+ +   LSV+NL+++G   +    +   N ++N  A
Sbjct:   44 ETCQTSFSEMQI---AIQDMLKLKDELLMHFLPPPLLFKLTVIFGKIFRSFSDLNTPVNEMLRLVKIYSTSWEKNSIVLKKIHDLYENKKQLLNLAIKRLAMVDKKTKLFAREKRVLNWEKLFVRLSESKGHGRRWRFQIDNFRKKTSLNYEELVKW--VLRESNDQLEENLKRDIKELSKANEKQFVDPDKKISNEKFEKSNLCIEMDKSNFSEDPIKKMNEENYINEVDSVQDFFSEESSEDGKKEKETKQVVDINIQTEPEMFDKSIWTGEPSYSRFLIIRLFKPTEL-YNKKIKFKITLGNISQYSKSFEIIKKVVIVDNK----------TQFRNNKSKNSRIEIEKNKEES--ERKIDLNKYEDFVFQVKDYSEKKEILCTSIDD-------------SIGIELAGADENEELFGYSLLQLDDVHTLDLPILYHKEFLQDEIADHVLETKEDLKNYDASKFLDSNELTEESFSSYEILSKRSPFTFEMYK----TKTVKSGDNICMLPLMFFWVRKPNTLNCNKNTNTKSIKDLIEDLTGFDIEKQSKEEIQELSRPKNLHDIACSPIQIEPEYSSIKKTPSSPTESRISFIKN---DKLDEIHEEYQMKMDEL-----KL---------VIYRLENEISKIKSLNELKPVEMIEKSKKK----MNPQNPAQKKNNLQKSNEKKEISSDNL-----IYKKNDTKKQSLWSEKLQEGFYERLRQFNQKSYLHQKEMIEKYVSQEAAILEQQMAVLHRLDRNNYNEK---QLDDFCLPAVFMPI-KSNNNVYNPRARQYFHATGT-DVRITQPPSIFQLPPLPSRPTLSVINLYDLGKRYESGEPDFYINEYINSTA 838          
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. TrEMBL
Match: A0A210PMG8 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07872 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.580e-40
Identity = 172/672 (25.60%), Postives = 292/672 (43.45%), Query Frame = 1
Query:  205 RFSELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSXXXXXXXXXXXXXNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLD------------------EDDG--------IKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSXXXXXXXXXXXXXXXXXXXXXXXTVDVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGI-------NQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLK--IFKEYNFRGDMVTPP-------------PLSD--------------EKPFSN-----LEPMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDESLSP-----------------------------------------------RSETPKPATVLKSEFDAISNKFEEKLNSIREYYENKISEISEN 1878
            +F  LC  V+N M +V  S  +L + K  +LK  + P++L+KL+ I GK+FRSISD+  P++EL+RLV VYS PWE+KS AL+KLH DYE K  QL++A++ L   +   KR+ +++ + NWE LF +   ++ HGRRWK+ +   K KAQ G+ ++ +Y + L +                  +DDG        ++E+        +  +     +  E S  N E+   +E ED  S      +    ++ + E      T +VS  T +  +   L M+++ P G++  ++++  I YG   + T  LD  +                            GLIG  K K ++      D++ K++  +      + EE+   IP +V  G+          N+  S+ +        E+  A ATID ++IK LDLK     E +   D+ T P              LSD              ++P +N     +E + FPL   V     +S     G LP+  +  ++ +   F+R   T  +N LV +L G++LD   K +L +E  D++ S                                                 +  PK   +LK +FD + +K    L++I+E YE ++ +++++
Sbjct:   49 KFDNLCDGVLNSMALVHGSIRELLDMKDEMLKHALPPTLLIKLATITGKVFRSISDLNMPVNELVRLVHVYSTPWEEKSTALKKLHEDYESKQRQLNIAIKRLQLVDAHSKRIAREKRIMNWEKLFAKIMSNKGHGRRWKFLIETIKQKAQLGLEHVQEYSKALEESSEEEGEDDDEIPIKLNRQDDGGDSDKLSDLEEEENEEGGVEEESEKADTEEGGEESAENQEEDGKEETEDPSSRVGTPKKVRFADEKKVEP-----TKEVSTWTHEPQYDNFLYMRVFTPTGLDQ-KDIKCMIKYGAKTHKTGRLDPEE---------------QEPPPEEPKPKAKGLIGS-KGKALQ------DKLEKKKKAEEKATKSRFEEMSFDIPEEVPDGVWTKPTKEEPQNIQVSVHV-----GPQEEIFAMATIDMEDIKALDLKEVYLPEPHGDDDVPTTPRGRGGRSDVGDFDSLSDDVEISLPGEDVKKQQEPVANELVKDIEAVPFPLLS-VNPAKGDSMHASCGTLPLVMYIGKRLKPQEFNRQCGTMTLNSLVFDLAGIDLDTWRKEDLNKELRDQASSALRLTPEPPKEPTPPPPPPKEPTPPPPPPKELTPPPPKEPTPPPPSKELTPEPKEEMILKRDFDEMMDKHNNDLHNIQEEYEKRLQQLTDS 686          

HSP 2 Score: 123.635 bits (309), Expect = 6.776e-25
Identity = 59/123 (47.97%), Postives = 91/123 (73.98%), Query Frame = 1
Query: 2158 NLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKN-NQLSVLNLFEM 2523
             +PE FL+R+++F E+S K+KE++ ++I  +I + IE KLA  +KL+    EE++  AL ++ LPA+FMP+    GT++NPRAHQYFHP G  + RL+Q PS+ +LPP+ N +++SVLNLFE+
Sbjct:  814 GIPEDFLDRLAWFEEESNKHKEEMVSKISKQIQEDIERKLAGQHKLSK--KEEEIYDALKEVSLPALFMPYKR--GTVFNPRAHQYFHPNGSSDLRLTQPPSMIQLPPLPNKSKMSVLNLFEL 932          
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. TrEMBL
Match: A0A0B7A583 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF98547 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.284e-39
Identity = 162/620 (26.13%), Postives = 281/620 (45.32%), Query Frame = 1
Query:  922 DVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRR---KNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGI---NQNNLYRSIKIILLTN-DKSEKKIAHATIDWDEIKDLDLKIFK------------------EYNFRGDMVT-----PPPLSD-----------EKPFSNLEPMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDESLSPRSETPK--PATVLKSEFDAISNKFEEKLNSIREYYENKISEISENNVKLSEKEPVRP-PTVYHKDCAVSPIFPYRHVPGNRRLEKRETREVDNV----NENRFSSKSRETLSTSGPDNQNENLYAAFDLHEKTNSANTSVFKI-------------------------------NLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFEMGNHMQIK 2544
            D    T +  F + L ++I++P G++  E L+  + Y   ++ T  L+   +   +D         N+  +      +  L  R+   K++ +  L+      RK++            E +I +P+++  G+   N+  L    ++    +  K E+ IA  +I + +IK + L+                      ++F GD +      P  + D           E    N EP  F LY  +++  S++     G LP+  ++ +  R + F+R   T  I+ LV ++TG++L   S+ +L +E VDE+LS  S TP+     V KSE D +  + ++++  ++E YE ++ E+++ N+++++ +  +  P   H+   VS    +    G      R ++ +D V     EN F  +      TS P N +  L         TNS  T V                                  NLP+ F ER+  + E+S ++K++L  R   EI   +E KLA  +KL+    EE +  AL D+ LPA+FMP+   TG +YNPRAH YF P G  N RL+Q PS+F+LPP+ + +LSV+NLFE+  +  I+
Sbjct:    7 DAQSWTQEPEFDRVLFVRIFSPEGLKQSE-LKCSLSYNGNMFKTPILESQNDENSDD---------NIPGIMTSRPKERPLAARKILDKSQGITNLKPGSSSGRKKRF----------YEFQIKLPDEIKDGVSLLNEKPLPEPQELRFAVHMGKFEEIIAVTSIAFHDIKKMSLETISLPPPHGDNDAPGRSSRPGSFSFDGDSLGDSLDIPIIMDDHFDHLTSSSPHEDLIKNKEPHNFSLYS-LQSGKSDAVRAPCGNLPVLMYWGKCVRPLYFNRQCGTRGISDLVFDMTGIDLTTASQEKLHKEMVDEALSVVSFTPRIEQDMVSKSELDKLVEQHQQEMVDLQEVYEKRLQELTD-NLQVTQSDYTKSLPLENHRSRPVSTTSEFNRT-GTLSPGIRLSKSLDPVLMENGENVFPKE------TSLPLNLDRTL---------TNSVRTPVLSASLSTKQRSLPPRTHKPSKNYRVGQRLPRWGENLPQDFFERLRLWEEESKQHKQELNERTLKEIKDNLERKLAGQHKLSKH--EEQMYDALKDVSLPALFMPY--KTGHVYNPRAHNYFQPTGATNVRLTQPPSVFQLPPLPDTKLSVVNLFELSKNFHIQ 584          
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Planmine SMEST
Match: SMESG000062286.1 (SMESG000062286.1)

HSP 1 Score: 1559.27 bits (4036), Expect = 0.000e+0
Identity = 823/835 (98.56%), Postives = 828/835 (99.16%), Query Frame = 1
Query:  124 MSVKFSGQDXXXXXXXXXXXXXXXXXXRFSELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSXXXXXXXXXXXXXNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSXXXXXXXXXXXXXXXXXXXXXXXTVDVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLSDEKPFSNLEPMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDESLSPRSETPKPATVLKSEFDAISNKFEEKLNSIREYYENKISEISENNVKLSEKEPVRPPTVYHKDCAVSPIFPYRHVPGNRRLEKRETREVDNVNENRFSSKSRETLSTSGPDNQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFEMGNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN 2628
            MSVKFSGQDENIVFEEEINEISKEEENRFSELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSAQLDLAL+ALARQNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSTENEEYQESVEEKVETESIEPIETVDVSVGTSDLNFSQTLVM+IYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIE ELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLSDE PFSNLEPM FPLYEYVENINSE SPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLD ISKNELQQEKVDESLSPRSETPKPATVLKSEFDAISNKFEEKLN+IREYYENKISEISENNVKLSEKEPVRP TVYHKDCAVSPIFPYRHVPGN RLEKRETREVDNVNENRFSSKSRETLSTSGPD+QNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFE+GNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN
Sbjct:    1 MSVKFSGQDENIVFEEEINEISKEEENRFSELCSNVINCMVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSAQLDLALKALARQNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSTENEEYQESVEEKVETESIEPIETVDVSVGTSDLNFSQTLVMRIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIENELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLSDENPFSNLEPMTFPLYEYVENINSECSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDTISKNELQQEKVDESLSPRSETPKPATVLKSEFDAISNKFEEKLNAIREYYENKISEISENNVKLSEKEPVRPQTVYHKDCAVSPIFPYRHVPGNTRLEKRETREVDNVNENRFSSKSRETLSTSGPDDQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFEIGNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN 835          
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Planmine SMEST
Match: SMESG000062286.1 (SMESG000062286.1)

HSP 1 Score: 1519.6 bits (3933), Expect = 0.000e+0
Identity = 784/796 (98.49%), Postives = 789/796 (99.12%), Query Frame = 1
Query:  241 MVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSXXXXXXXXXXXXXNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSXXXXXXXXXXXXXXXXXXXXXXXTVDVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLSDEKPFSNLEPMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDESLSPRSETPKPATVLKSEFDAISNKFEEKLNSIREYYENKISEISENNVKLSEKEPVRPPTVYHKDCAVSPIFPYRHVPGNRRLEKRETREVDNVNENRFSSKSRETLSTSGPDNQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFEMGNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN 2628
            MVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSAQLDLAL+ALARQNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSTENEEYQESVEEKVETESIEPIETVDVSVGTSDLNFSQTLVM+IYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIE ELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLSDE PFSNLEPM FPLYEYVENINSE SPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLD ISKNELQQEKVDESLSPRSETPKPATVLKSEFDAISNKFEEKLN+IREYYENKISEISENNVKLSEKEPVRP TVYHKDCAVSPIFPYRHVPGN RLEKRETREVDNVNENRFSSKSRETLSTSGPD+QNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFE+GNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN
Sbjct:    1 MVIVQNSQSDLSEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSEPWEKKSEALRKLHVDYEKKSAQLDLALKALARQNEDMKRVTKKETLQNWEFLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKEKSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSTENEEYQESVEEKVETESIEPIETVDVSVGTSDLNFSQTLVMRIYNPNGIEHFENLRARIIYGDMIYHTNNLDKTKELEIEDKRIENELSGNLTTVAVESKSKLGLIGRRKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNNLYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPPPLSDENPFSNLEPMTFPLYEYVENINSECSPTQLGQLPISCFYSRKERQILFHRSTETEPINRLVEELTGVNLDTISKNELQQEKVDESLSPRSETPKPATVLKSEFDAISNKFEEKLNAIREYYENKISEISENNVKLSEKEPVRPQTVYHKDCAVSPIFPYRHVPGNTRLEKRETREVDNVNENRFSSKSRETLSTSGPDDQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKEDLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFTNSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFEIGNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN 796          
The following BLAST results are available for this feature:
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7P7019.161e-7627.50Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1W2W6221.128e-6227.55uncharacterized protein LOC100180644 OS=Ciona inte... [more]
A0A3M7QIP53.477e-5026.02Outer dense fiber 3 (Fragment) OS=Brachionus plica... [more]
A0A210PMG81.580e-4025.60Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A0B7A5833.284e-3926.13Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone-lysine N-methyltransferase SETD1B-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000062286.10.000e+098.56SMESG000062286.1[more]
SMESG000062286.10.000e+098.49SMESG000062286.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025052 ID=SMED30025052|Name=histone-lysine N-methyltransferase SETD1B-A|organism=Schmidtea mediterranea sexual|type=transcript|length=2671bp
GTTATAATGAAATTTTGAAAATTTATTTCCTAATATATTTACATATTTAT
AGATATTTATTTACCAAAAATAAAAGTCATTTAATATTAAATTTTTGTAT
AGAAATCCATATTAAATTAAGTTATGTCTGTAAAATTCTCAGGTCAAGAT
GAAAATATAGTATTTGAGGAAGAGATTAATGAAATAAGCAAAGAAGAAGA
AAACAGATTTTCTGAATTGTGTTCCAATGTTATTAACTGTATGGTCATTG
TTCAAAATTCCCAATCAGATTTGTCGGAATTTAAAAGCTTATTATTAAAA
GAAAATATTGCACCAAGTGTTTTGGTAAAGTTATCATTAATTAATGGAAA
ACTATTTCGAAGCATCTCGGATATGTATAATCCACTTAGTGAACTTATTC
GATTAGTTCGTGTTTATTCTGAGCCTTGGGAAAAGAAAAGTGAGGCTCTT
AGAAAATTGCACGTAGATTATGAGAAAAAATCAGCCCAGCTCGACTTGGC
ATTAAGAGCATTAGCTCGTCAGAATGAAGATATGAAAAGAGTCACAAAAA
AGGAAACGCTTCAAAATTGGGAATTTTTATTCACCCGAGCACAAGTCCAT
CGGAATCACGGCAGGCGGTGGAAGTATAAAATGTTCGAATTCAAAATGAA
AGCACAGGAAGGAATCAATAATTTACATGATTATTTTCAAATATTACTCG
ATGAAGATGATGGAATTAAAGAAAAATCTATCTTCGTTGCAAGGGAGCCG
CAGATGTATGATTCCCGAAGCAAAACACAAAGAAATGAATCCTCTAGAAC
TAATTATGAAGACTTATTTACAAAAGAGTTGGAAGATAACAAATCCACAG
AAAATGAAGAATATCAAGAGTCGGTGGAAGAAAAGGTGGAAACGGAAAGT
ATTGAACCGATTGAAACTGTAGATGTTTCAGTAGGCACTTCTGATTTAAA
TTTTTCTCAAACTTTAGTTATGAAAATATACAATCCTAATGGTATCGAAC
ATTTCGAAAATTTAAGAGCCAGAATTATTTATGGCGATATGATATATCAT
ACCAATAATTTAGATAAGACTAAAGAATTGGAAATTGAAGATAAAAGAAT
CGAGAAAGAATTATCTGGTAATTTGACCACTGTAGCAGTCGAATCTAAAT
CTAAACTTGGTTTAATTGGTCGACGTAAAAATAAGCAAGTGAAACCGTTG
GAAAAATCAGTTGATCAAATTCGGAAAGAACAGTTGGATAAAAGATTAAG
ATACCTAGAAAAACACGAGGAAATCAGAATCCCAATTCCAAATGATGTTG
TATCAGGAATAAATCAAAATAATCTGTATCGATCAATTAAAATAATTTTA
CTCACAAATGATAAAAGCGAAAAAAAAATAGCCCACGCAACGATAGATTG
GGATGAAATTAAAGATTTAGATTTAAAAATATTTAAAGAATATAATTTTC
GAGGAGATATGGTTACCCCACCCCCATTGTCAGATGAAAAACCATTTTCA
AATCTTGAACCAATGATGTTTCCTTTGTATGAATATGTTGAAAATATTAA
TTCGGAAAGTTCTCCGACTCAATTAGGACAGTTACCAATTAGCTGCTTTT
ATTCACGAAAAGAACGTCAAATATTGTTTCATAGATCAACTGAAACAGAG
CCTATTAACCGACTGGTAGAGGAATTAACTGGGGTTAATCTCGACGCTAT
AAGCAAAAATGAATTACAACAAGAAAAAGTCGATGAATCCTTATCTCCGC
GTTCAGAAACTCCTAAGCCAGCAACAGTTTTAAAATCTGAATTCGATGCT
ATTAGTAATAAATTCGAAGAAAAGTTAAATTCGATTCGTGAATATTATGA
AAATAAAATAAGCGAAATATCAGAAAATAATGTCAAATTATCTGAAAAAG
AGCCTGTTAGACCACCAACTGTATATCATAAAGATTGTGCTGTGAGCCCT
ATCTTTCCATATAGACATGTTCCTGGTAATAGACGTTTGGAAAAACGAGA
GACTCGAGAAGTTGATAATGTTAATGAAAATCGTTTTTCATCAAAAAGTC
GTGAGACACTATCCACTAGTGGGCCAGATAATCAAAATGAAAATTTGTAT
GCAGCTTTTGATTTACACGAAAAAACTAATTCTGCAAACACATCAGTTTT
CAAAATTAATTTACCGGAAAGTTTCCTCGAACGAGTTTCATTTTTCTCTG
AAAAATCATATAAGTACAAGGAGGATTTAGCTAATAGAATTAAAACTGAA
ATCTCAAAAGCAATTGAAGATAAATTAGCTGAATTATATAAATTAAATTC
CGATTTAACCGAAGAGGATGTTTCTTTGGCTCTTTCTGATATGTGTCTGC
CAGCAATGTTTATGCCATTCACTAATTCTACCGGTACAATTTATAATCCA
AGAGCCCATCAATATTTCCATCCAATAGGATTAAAAAATTTTCGTTTGTC
TCAAGCACCTTCAATTTTTAAATTACCGCCAATAAAAAATAACCAATTAT
CTGTTCTCAATTTATTTGAAATGGGAAATCATATGCAAATAAAACATTAC
GAAAATGACTTTAATAATCACATGAATAAGAAAGCTTTAAATGCATCTGA
AAGTGCAAAAATATTTTCAGTAGATAATTGAGTTATATTTATGATTAACC
TCTCTAATAAATAAAATTGTT
back to top

protein sequence of SMED30025052-orf-1

>SMED30025052-orf-1 ID=SMED30025052-orf-1|Name=SMED30025052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=836bp
MSVKFSGQDENIVFEEEINEISKEEENRFSELCSNVINCMVIVQNSQSDL
SEFKSLLLKENIAPSVLVKLSLINGKLFRSISDMYNPLSELIRLVRVYSE
PWEKKSEALRKLHVDYEKKSAQLDLALRALARQNEDMKRVTKKETLQNWE
FLFTRAQVHRNHGRRWKYKMFEFKMKAQEGINNLHDYFQILLDEDDGIKE
KSIFVAREPQMYDSRSKTQRNESSRTNYEDLFTKELEDNKSTENEEYQES
VEEKVETESIEPIETVDVSVGTSDLNFSQTLVMKIYNPNGIEHFENLRAR
IIYGDMIYHTNNLDKTKELEIEDKRIEKELSGNLTTVAVESKSKLGLIGR
RKNKQVKPLEKSVDQIRKEQLDKRLRYLEKHEEIRIPIPNDVVSGINQNN
LYRSIKIILLTNDKSEKKIAHATIDWDEIKDLDLKIFKEYNFRGDMVTPP
PLSDEKPFSNLEPMMFPLYEYVENINSESSPTQLGQLPISCFYSRKERQI
LFHRSTETEPINRLVEELTGVNLDAISKNELQQEKVDESLSPRSETPKPA
TVLKSEFDAISNKFEEKLNSIREYYENKISEISENNVKLSEKEPVRPPTV
YHKDCAVSPIFPYRHVPGNRRLEKRETREVDNVNENRFSSKSRETLSTSG
PDNQNENLYAAFDLHEKTNSANTSVFKINLPESFLERVSFFSEKSYKYKE
DLANRIKTEISKAIEDKLAELYKLNSDLTEEDVSLALSDMCLPAMFMPFT
NSTGTIYNPRAHQYFHPIGLKNFRLSQAPSIFKLPPIKNNQLSVLNLFEM
GNHMQIKHYENDFNNHMNKKALNASESAKIFSVDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 572..592
NoneNo IPR availableCOILSCoilCoilcoord: 711..731
NoneNo IPR availableCOILSCoilCoilcoord: 233..253
NoneNo IPR availableCOILSCoilCoilcoord: 123..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 233..258
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 639..654
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 630..654