Protein phosphatase 2c

Overview
NameProtein phosphatase 2c
Smed IDSMED30025041
Length (bp)1272
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 2c (SMED30025041) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 2c (SMED30025041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase 2c (SMED30025041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase 2c (SMED30025041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025041h1SMcG0006239 dd_Smed_v4_2362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025041h1SMcG0006239 dd_Smed_v4_2362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025041h1SMcG0006239 dd_Smed_v4_2362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025041h1SMcG0006239 dd_Smed_v4_2362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025041h1SMcG0006239 dd_Smed_v4_2362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025041h1SMcG0006239 dd_Smed_v4_2362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase 2c vs. Ensembl Human
Match: ILKAP (ILK associated serine/threonine phosphatase [Source:HGNC Symbol;Acc:HGNC:15566])

HSP 1 Score: 285.419 bits (729), Expect = 2.533e-92
Identity = 139/287 (48.43%), Postives = 195/287 (67.94%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
             K +V+ RKGER+EMQDAH++++D TE  +    L     +    ++ V+DGH G +AS FAA+NLH+ L + FPKGD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   +   R+E AC++L ++AV + S DNVTV++V
Sbjct:  107 LKGYVAERKGEREEMQDAHVILNDITEECRPPSSL-----ITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVV 388          
BLAST of Protein phosphatase 2c vs. Ensembl Human
Match: ILKAP (ILK associated serine/threonine phosphatase [Source:HGNC Symbol;Acc:HGNC:15566])

HSP 1 Score: 211.846 bits (538), Expect = 2.074e-65
Identity = 105/211 (49.76%), Postives = 145/211 (68.72%), Query Frame = 2
Query:  470 GDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            GD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   +   R+E AC++L ++AV + S DNVTV++V
Sbjct:   60 GDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVV 270          
BLAST of Protein phosphatase 2c vs. Ensembl Human
Match: ILKAP (ILK associated serine/threonine phosphatase [Source:HGNC Symbol;Acc:HGNC:15566])

HSP 1 Score: 183.341 bits (464), Expect = 2.373e-55
Identity = 85/158 (53.80%), Postives = 116/158 (73.42%), Query Frame = 2
Query:  488 ELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV 958
            E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+
Sbjct:    1 EKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFI 158          
BLAST of Protein phosphatase 2c vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 120.168 bits (300), Expect = 3.813e-30
Identity = 92/290 (31.72%), Postives = 144/290 (49.66%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLA--QMFPKGDCESFEL-NVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKC-RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + +  E+L  ++   Q F KG   +  + NVK      + +IDE    ++ K+    R GSTAV VLI     Y  N GDS+ +L R  K +       T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GD+ YK        +Q V   P+V    R  + D+F+I+ACDG+W     ++  +FV     +E TD L K     C+++    + K S DN++V+++ F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------IGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDF-KGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVH-----FFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSR--LEVTDDLEK----VCNEVVDTCLYKGSRDNMSVILICF 291          
BLAST of Protein phosphatase 2c vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 120.553 bits (301), Expect = 8.582e-30
Identity = 92/290 (31.72%), Postives = 144/290 (49.66%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLA--QMFPKGDCESFEL-NVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKC-RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + +  E+L  ++   Q F KG   +  + NVK      + +IDE    ++ K+    R GSTAV VLI     Y  N GDS+ +L R  K +       T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GD+ YK        +Q V   P+V    R  + D+F+I+ACDG+W     ++  +FV     +E TD L K     C+++    + K S DN++V+++ F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------IGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDF-KGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVH-----FFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSR--LEVTDDLEK----VCNEVVDTCLYKGSRDNMSVILICF 291          
BLAST of Protein phosphatase 2c vs. Ensembl Celegans
Match: ilkp-1 (ILK associated serine/threonine Phosphatase homolog [Source:UniProtKB/TrEMBL;Acc:G5EDI3])

HSP 1 Score: 223.016 bits (567), Expect = 1.713e-69
Identity = 117/317 (36.91%), Postives = 185/317 (58.36%), Query Frame = 2
Query:  173 SKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPK-GDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEF-VGKIIGIESTD--------SLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI 1093
            SK+  E+ NL  ++    + C         RKGER +MQD HI++  F    +K+F       +    F+ ++DGH G +A+      + K + +   K  D  +   ++K+ FT+ YK +D+ FL IA + +P  +DG+TA  ++I+N  +Y+ANIGDS+AV+AR+ ++ +   + LT DH  + ++ER+R+QK G++V+DGR+NG +E+SRS GD  +K  G+I  PD+KK  L   D F IIACDGLWK+F+  +AV F V ++   + TD          A    +   KL +EAV +  GDNV+V+IV   +
Sbjct:   20 SKKPKESRNLYCTLAA--YGC---------RKGERADMQDTHIMLPKFDLGTEKSF-------LSRASFFAIFDGHAGPRAAEHCQSQMGKTVKEKLAKFSDFPTLTKSLKQTFTESYKAVDDGFLAIAKQNKPIWKDGTTATTMIILNNVIYVANIGDSRAVVARKKEDGSFAPVCLTVDHDPMSHDERMRIQKAGAVVKDGRINGVIEVSRSIGDLPFKSLGIISTPDLKKLTLTKNDLFAIIACDGLWKSFSNLEAVSFAVEQLEAAKKTDIEQEPNESREAAELRVVAEKLAAEAVRRKCGDNVSVIIVKLEL 318          
BLAST of Protein phosphatase 2c vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 109.383 bits (272), Expect = 2.052e-26
Identity = 95/303 (31.35%), Postives = 143/303 (47.19%), Query Frame = 2
Query:  215 KKNHFDCISFKSFVSSR--KGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHK-YLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSG-DNVTVVIVAF 1087
            KK    C +    V S   +G R +M+DAH  +            L L DD     F+ VYDGH G K S ++  NLHK  +AQ       E  E N+K      + ++D++ +++  + +  +  G+TAV VLI    +Y  N GDS+AV +   +     A  L+ DH      E  R+   G  V   R+NG L +SR+ GD+ +K        +Q V   PDV   +L     F+++ACDG+W   T Q+ V+FV + +  E  D  +   EL    L  +  +   G DN+TVV+V  
Sbjct:   11 KKESASCANENYLVGSSCMQGWRVDMEDAHTHL------------LSLPDDP-KCAFFAVYDGHGGSKVSQYSGINLHKKVVAQK------EFSEGNMKEAIEKGFLELDQQ-MRVDEETKDDVS-GTTAVVVLIKEGDVYCGNAGDSRAVSSVVGE-----ARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTPDHEFIVLACDGIWDVMTNQEVVDFVREKLA-EKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLVGL 286          
BLAST of Protein phosphatase 2c vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 109.383 bits (272), Expect = 2.052e-26
Identity = 95/303 (31.35%), Postives = 143/303 (47.19%), Query Frame = 2
Query:  215 KKNHFDCISFKSFVSSR--KGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHK-YLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSG-DNVTVVIVAF 1087
            KK    C +    V S   +G R +M+DAH  +            L L DD     F+ VYDGH G K S ++  NLHK  +AQ       E  E N+K      + ++D++ +++  + +  +  G+TAV VLI    +Y  N GDS+AV +   +     A  L+ DH      E  R+   G  V   R+NG L +SR+ GD+ +K        +Q V   PDV   +L     F+++ACDG+W   T Q+ V+FV + +  E  D  +   EL    L  +  +   G DN+TVV+V  
Sbjct:   11 KKESASCANENYLVGSSCMQGWRVDMEDAHTHL------------LSLPDDP-KCAFFAVYDGHGGSKVSQYSGINLHKKVVAQK------EFSEGNMKEAIEKGFLELDQQ-MRVDEETKDDVS-GTTAVVVLIKEGDVYCGNAGDSRAVSSVVGE-----ARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTPDHEFIVLACDGIWDVMTNQEVVDFVREKLA-EKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLVGL 286          
BLAST of Protein phosphatase 2c vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 109.383 bits (272), Expect = 2.052e-26
Identity = 95/303 (31.35%), Postives = 143/303 (47.19%), Query Frame = 2
Query:  215 KKNHFDCISFKSFVSSR--KGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHK-YLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSG-DNVTVVIVAF 1087
            KK    C +    V S   +G R +M+DAH  +            L L DD     F+ VYDGH G K S ++  NLHK  +AQ       E  E N+K      + ++D++ +++  + +  +  G+TAV VLI    +Y  N GDS+AV +   +     A  L+ DH      E  R+   G  V   R+NG L +SR+ GD+ +K        +Q V   PDV   +L     F+++ACDG+W   T Q+ V+FV + +  E  D  +   EL    L  +  +   G DN+TVV+V  
Sbjct:   11 KKESASCANENYLVGSSCMQGWRVDMEDAHTHL------------LSLPDDP-KCAFFAVYDGHGGSKVSQYSGINLHKKVVAQK------EFSEGNMKEAIEKGFLELDQQ-MRVDEETKDDVS-GTTAVVVLIKEGDVYCGNAGDSRAVSSVVGE-----ARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTPDHEFIVLACDGIWDVMTNQEVVDFVREKLA-EKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLVGL 286          
BLAST of Protein phosphatase 2c vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 108.612 bits (270), Expect = 5.134e-26
Identity = 90/297 (30.30%), Postives = 149/297 (50.17%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL--AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLK--------IASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVK-KCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R  M+D+HI      E I     +  S       F+ V+DGH G   +  A+  L ++L  ++ F +   ++ E N   + TD   K+ E+ +K        I+       + G TAV  ++  T   I N+GDS+AV+A +++      I  T+DH     +ER R++  G  V   R+NG+L +SR+FGDY+YK        +Q V   PDV  + R ++ D+F+++ACDG++   T ++  EFV   + + S           C  +  E ++K S DN+T+V+V F
Sbjct:    8 MSSMQGWRICMEDSHI-----AEAI-----MSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEF-REMTKTLEEN-NGVLTDSTLKLLEKGIKKGFLSFDEISKTSNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNE------IFGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKDDPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSD------LREVCDDVLDECLVKGSRDNMTMVVVCF 280          
BLAST of Protein phosphatase 2c vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0309241)

HSP 1 Score: 120.553 bits (301), Expect = 1.572e-30
Identity = 94/290 (32.41%), Postives = 144/290 (49.66%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL--AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLR-DGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIEST-DSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            VSS +G R EM+DA+              +  L D +    F+ V+DGH GCK S   A++L + +   + F  GD      +VK I T  + +IDE   ++    R   +  G+TAV   +  T +YIAN GDS+AVL RQ        +  T+DH  I  EE+ R+   G  V   R+NGTL +SR+ GDY +K        +Q V   P++      D+D FL++ACDG+W   + +    F+   + + S   S+A +    C       + K S DN++++I+AF
Sbjct:   26 VSSMQGWRSEMEDAYYA------------RAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGD------HVKGIRTG-FLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG-----VPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTC-------LHKGSRDNMSIIIIAF 284          
BLAST of Protein phosphatase 2c vs. Ensembl Fly
Match: Ppm1 (gene:FBgn0035143 transcript:FBtr0072553)

HSP 1 Score: 120.553 bits (301), Expect = 2.172e-30
Identity = 94/299 (31.44%), Postives = 142/299 (47.49%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKK--------QGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKII--GIESTDSLAKRFELACSKLCSEAVLK------MSGDNVTVVIVAF 1087
            S++   S  +G R +M+DAH  I            L L DD     F+ VYDGH G   + +A ++LHK++ +  P+    S E+ +K+ F D     D E L+  S        G TA+ VLI    LY AN GDS+A+       +     +L+ DH   D +E  R+   G  V   R+NG L +SR+ GD+ YKK        Q V   PDV+   + +   F+++ACDG+W   +  +  +FV K I  G+E         EL C +L +  +        + GDN+TV++V  
Sbjct:   21 SYRVGSSCMQGWRVDMEDAHTHI------------LSLPDDP-QAAFFAVYDGHGGASVAKYAGKHLHKFITKR-PEYRDNSIEVALKKAFLD----FDREMLQNGSLDEQTA--GCTAIVVLIRERRLYCANAGDSRAIACISGMVH-----ALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEP--------ELICEELMNSCLSPDGHTGNVGGDNMTVILVCL 286          
BLAST of Protein phosphatase 2c vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085442)

HSP 1 Score: 119.783 bits (299), Expect = 5.249e-30
Identity = 94/290 (32.41%), Postives = 144/290 (49.66%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL--AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLR-DGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIEST-DSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            VSS +G R EM+DA+              +  L D +    F+ V+DGH GCK S   A++L + +   + F  GD      +VK I T  + +IDE   ++    R   +  G+TAV   +  T +YIAN GDS+AVL RQ        +  T+DH  I  EE+ R+   G  V   R+NGTL +SR+ GDY +K        +Q V   P++      D+D FL++ACDG+W   + +    F+   + + S   S+A +    C       + K S DN++++I+AF
Sbjct:   26 VSSMQGWRSEMEDAYYA------------RAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGD------HVKGIRTG-FLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG-----VPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTC-------LHKGSRDNMSIIIIAF 284          
BLAST of Protein phosphatase 2c vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085445)

HSP 1 Score: 119.783 bits (299), Expect = 5.249e-30
Identity = 94/290 (32.41%), Postives = 144/290 (49.66%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL--AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLR-DGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIEST-DSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            VSS +G R EM+DA+              +  L D +    F+ V+DGH GCK S   A++L + +   + F  GD      +VK I T  + +IDE   ++    R   +  G+TAV   +  T +YIAN GDS+AVL RQ        +  T+DH  I  EE+ R+   G  V   R+NGTL +SR+ GDY +K        +Q V   P++      D+D FL++ACDG+W   + +    F+   + + S   S+A +    C       + K S DN++++I+AF
Sbjct:   26 VSSMQGWRSEMEDAYYA------------RAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGD------HVKGIRTG-FLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG-----VPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTC-------LHKGSRDNMSIIIIAF 284          
BLAST of Protein phosphatase 2c vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085446)

HSP 1 Score: 119.783 bits (299), Expect = 5.249e-30
Identity = 94/290 (32.41%), Postives = 144/290 (49.66%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL--AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLR-DGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIEST-DSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            VSS +G R EM+DA+              +  L D +    F+ V+DGH GCK S   A++L + +   + F  GD      +VK I T  + +IDE   ++    R   +  G+TAV   +  T +YIAN GDS+AVL RQ        +  T+DH  I  EE+ R+   G  V   R+NGTL +SR+ GDY +K        +Q V   P++      D+D FL++ACDG+W   + +    F+   + + S   S+A +    C       + K S DN++++I+AF
Sbjct:   26 VSSMQGWRSEMEDAYYA------------RAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGD------HVKGIRTG-FLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG-----VPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTC-------LHKGSRDNMSIIIIAF 284          
BLAST of Protein phosphatase 2c vs. Ensembl Zebrafish
Match: ilkap (integrin-linked kinase-associated serine/threonine phosphatase [Source:ZFIN;Acc:ZDB-GENE-070410-122])

HSP 1 Score: 270.011 bits (689), Expect = 3.502e-87
Identity = 147/349 (42.12%), Postives = 211/349 (60.46%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXATS---KRKSETENLTISIKKNHFDCI------SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR--QSKENN---LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTD------SLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            M LFDDLPEP+N  +   L         KR   +E   +   K     +          FVS+R+GER+EMQDAH+L+ D            L   V    ++ V+DGH G +AS FAAENLH  L   FPKGD E+ +  V++   D +++ DE+FLK AS Q+P  +DGSTA  +L ++  LY+AN+GDS+AVL R  Q+K++       ++L+K+H    YEER+R+Q+ G  VRDGR+ G LE+SRS GD QYK+ GVI  PD+++C+L   D+F+++ACDGL+K F+  +AV+FV  ++  E+ +        A  FE AC +L SEAV + S DNVTV++V+ 
Sbjct:    1 MDLFDDLPEPTNEPAPVKLQQEERGEKRKRSISSEQTEVQDDKQEEKKVCKEGFAKLTGFVSARRGEREEMQDAHVLLPDLNITC-------LPSQVSRLAYFAVFDGHGGARASQFAAENLHHTLLSKFPKGDVENLDKLVRKCLLDTFRQTDEDFLKKASSQKPAWKDGSTATCLLAVDDVLYVANLGDSRAVLCRMEQAKDSGKRKCVTLALSKEHNPTIYEERMRIQRAGGTVRDGRVLGVLEVSRSIGDGQYKRCGVISTPDLRRCQLSPNDKFVLLACDGLFKVFSADEAVQFVLGVLENETVELKEGQSEGAGLFEAACQRLASEAVRRGSADNVTVILVSI 342          
BLAST of Protein phosphatase 2c vs. Ensembl Zebrafish
Match: CR847495.1 (pep chromosome:GRCz11:CHR_ALT_CTG12_1_17:25477050:25482406:1 gene:ENSDARG00000115558.1 transcript:ENSDART00000185132.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847495.1)

HSP 1 Score: 121.709 bits (304), Expect = 1.312e-30
Identity = 91/292 (31.16%), Postives = 146/292 (50.00%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL---AQMFPKGD--CESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDV-KKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + +++L +++   ++ F  G    E  ++ ++  F     KIDE     +  +    R GSTAV VL+    LY  N GDS+AVL+R  +         T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +  R+ D D F+++ACDG+W   + ++  +FV     +E  D L K     C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSEDFRSGPDSVEGVKIGIRSGFL----KIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQ-----VRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSR--LEVWDDLEK----VCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Zebrafish
Match: ppm1bb (protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-185])

HSP 1 Score: 121.324 bits (303), Expect = 2.717e-30
Identity = 92/292 (31.51%), Postives = 147/292 (50.34%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL---AQMFPKGD--CESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDV-KKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + +++L +++   ++ F  G    E  ++ ++  F     KIDE     +  +    R GSTAV VL+    LY  N GDS+AVL+R  +       S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +  R+ D D F+++ACDG+W   + ++  +FV     +E  D L K     C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSEDFRSGPDSVEGVKIGIRSGFL----KIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQ----VRFS-TQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSR--LEVWDDLEK----VCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Zebrafish
Match: ppm1bb (protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-185])

HSP 1 Score: 121.324 bits (303), Expect = 2.717e-30
Identity = 92/292 (31.51%), Postives = 147/292 (50.34%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL---AQMFPKGD--CESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDV-KKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + +++L +++   ++ F  G    E  ++ ++  F     KIDE     +  +    R GSTAV VL+    LY  N GDS+AVL+R  +       S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +  R+ D D F+++ACDG+W   + ++  +FV     +E  D L K     C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSEDFRSGPDSVEGVKIGIRSGFL----KIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQ----VRFS-TQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSR--LEVWDDLEK----VCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Zebrafish
Match: ppm1ab (protein phosphatase, Mg2+/Mn2+ dependent, 1Ab [Source:ZFIN;Acc:ZDB-GENE-991102-14])

HSP 1 Score: 117.472 bits (293), Expect = 2.626e-29
Identity = 91/308 (29.55%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  224 HFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFP--KGDC---------ESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKC-RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            H +    +  +SS +G R EM+DAH      T  +   F L L        F+ VYDGH G + + +  E+L +++    P  +G C         E    +VK      + +IDE    ++ ++    R GSTAV V+I     Y  N GDS+A+L+R+ + +       T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GD+ YK        +Q V   P+V +  R    D F+++ACDG+W     ++  +FV       S   + +  E  C+++    + K S DN++VV+V F
Sbjct:   16 HGEGNGLRYGLSSMQGWRVEMEDAH------TAVMGLPFGLGLWS------FFAVYDGHAGSQVARYCCEHLLEHITSN-PDFRGGCSIGGDLVGTEPSVESVKNGIRTGFLQIDEHMRAMSERKHGADRSGSTAVGVMISPHHFYFINCGDSRALLSRKGRVH-----FFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYEIERSEAEDEFVVLACDGIWDVMANEELCDFV------RSRLEVTEDLERVCNEIVDTCLYKGSRDNMSVVLVCF 299          
BLAST of Protein phosphatase 2c vs. Ensembl Xenopus
Match: rtp3c (receptor (chemosensory) transporter protein 3 gene C [Source:Xenbase;Acc:XB-GENE-940866])

HSP 1 Score: 268.47 bits (685), Expect = 1.748e-86
Identity = 146/350 (41.71%), Postives = 224/350 (64.00%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXA-------TSKRKSETENLTISIKKNHFD---C---ISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENN-LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV---------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            M L+D+LPEP      +V  + +       ++KRK+ET + + S ++ H +   C   +S K+ V+ R+GER+E+QDAH + D     + ++ +  +  D++   ++ V+DGH G +AS FAA+NLH+   +  P+G+  S +  +KR   D +K+ DE+FLK A+ Q+P  +DG+TA+ VL+ +  LYIAN+GDS+A+L R +KEN     +SL+++H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GVI  P+VK+C L D+DRF+++ACDGL+KAF+ ++AV F+             G    DSL   +E AC +L +EAV + + DNVTV+IV
Sbjct:    1 MDLYDELPEPPRAPGPAVSPSDSGPPDNNPSTKRKAETTD-SDSSEEQHQEKKVCKGILSLKAHVAERRGEREELQDAHTICD-----LSQDCQ-PMPPDLLRLSYFAVFDGHGGTRASRFAAQNLHQNFVKKIPRGEGSSVDKAMKRCILDAFKQTDEDFLKQAASQKPAWKDGTTAICVLVADNILYIANLGDSRALLCRINKENQKHVVLSLSREHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRYGVISTPEVKRCPLTDSDRFILLACDGLFKAFSAEEAVTFILTHTQEKSSPAEDGPPDFDSL---YESACHRLANEAVRRGAADNVTVLIV 340          
BLAST of Protein phosphatase 2c vs. Ensembl Xenopus
Match: rtp3c (receptor (chemosensory) transporter protein 3 gene C [Source:Xenbase;Acc:XB-GENE-940866])

HSP 1 Score: 255.758 bits (652), Expect = 6.953e-82
Identity = 137/320 (42.81%), Postives = 211/320 (65.94%), Query Frame = 2
Query:  173 SKRKSETENLTISIKKNHFD---C---ISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENN-LTAISLTKDHTAIDYEERLRLQKH-GSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV---------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            +KRK+ET + + S ++ H +   C   +S K+ V+ R+GER+E+QDAH + D     + ++ +  +  D++   ++ V+DGH G +AS FAA+NLH+   +  P+G+  S +  +KR   D +K+ DE+FLK A+ Q+P  +DG+TA+ VL+ +  LYIAN+GDS+A+L R +KEN     +SL+++H    YEER+R+QK  G++ RDGR+ G LE+SRS GD QYK+ GVI  P+VK+C L D+DRF+++ACDGL+KAF+ ++AV F+             G    DSL   +E AC +L +EAV + + DNVTV+IV
Sbjct:    4 TKRKAETTD-SDSSEEQHQEKKVCKGILSLKAHVAERRGEREELQDAHTICD-----LSQDCQ-PMPPDLLRLSYFAVFDGHGGTRASRFAAQNLHQNFVKKIPRGEGSSVDKAMKRCILDAFKQTDEDFLKQAASQKPAWKDGTTAICVLVADNILYIANLGDSRALLCRINKENQKHVVLSLSREHNPTQYEERMRIQKAGGNVSRDGRVLGVLEVSRSIGDGQYKRYGVISTPEVKRCPLTDSDRFILLACDGLFKAFSAEEAVTFILTHTQEKSSPAEDGPPDFDSL---YESACHRLANEAVRRGAADNVTVLIV 313          
BLAST of Protein phosphatase 2c vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 128.642 bits (322), Expect = 7.167e-33
Identity = 95/293 (32.42%), Postives = 141/293 (48.12%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL-------AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +      +         DD     F+ VYDGH G + + + + +L +++       A   P    E    NVK      + KIDE     A  +    R GSTAV VL+  + +Y  N GDS+AVL R  +         T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +    D D F+I+ACDG+W   + ++  EFV     +E TD L K     C+ +    + K S DN+++V+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAVVGIPRGL---------DDW---SFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQ-----VCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADEDEFIILACDGIWDVMSNEELCEFVK--YRLELTDDLEK----VCNSVVDTCLHKGSRDNMSIVLVCF 295          
BLAST of Protein phosphatase 2c vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 128.642 bits (322), Expect = 8.367e-33
Identity = 95/293 (32.42%), Postives = 141/293 (48.12%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL-------AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +      +         DD     F+ VYDGH G + + + + +L +++       A   P    E    NVK      + KIDE     A  +    R GSTAV VL+  + +Y  N GDS+AVL R  +         T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +    D D F+I+ACDG+W   + ++  EFV     +E TD L K     C+ +    + K S DN+++V+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAVVGIPRGL---------DDW---SFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQ-----VCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADEDEFIILACDGIWDVMSNEELCEFVK--YRLELTDDLEK----VCNSVVDTCLHKGSRDNMSIVLVCF 295          
BLAST of Protein phosphatase 2c vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 127.872 bits (320), Expect = 1.602e-32
Identity = 95/293 (32.42%), Postives = 141/293 (48.12%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL-------AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +      +      D S       F+ VYDGH G + + + + +L +++       A   P    E    NVK      + KIDE     A  +    R GSTAV VL+  + +Y  N GDS+AVL R  +         T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +    D D F+I+ACDG+W   + ++  EFV     +E TD L K     C+ +    + K S DN+++V+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAVVGIPRGLD-----DWS-------FFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQ-----VCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADEDEFIILACDGIWDVMSNEELCEFVK--YRLELTDDLEK----VCNSVVDTCLHKGSRDNMSIVLVCF 295          
BLAST of Protein phosphatase 2c vs. Ensembl Mouse
Match: Ilkap (integrin-linked kinase-associated serine/threonine phosphatase 2C [Source:MGI Symbol;Acc:MGI:1914694])

HSP 1 Score: 283.493 bits (724), Expect = 9.473e-92
Identity = 138/287 (48.08%), Postives = 195/287 (67.94%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
             K +V+ RKGER+EMQDAH++++D T+       L     +    ++ V+DGH G +AS FAA+NLH+ L + FPKGD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   ++  R+E AC++L ++AV + S DNVTV++V
Sbjct:  107 LKGYVAERKGEREEMQDAHVILNDITQECNPPSSL-----ITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDDKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVV 388          
BLAST of Protein phosphatase 2c vs. Ensembl Mouse
Match: Ilkap (integrin-linked kinase-associated serine/threonine phosphatase 2C [Source:MGI Symbol;Acc:MGI:1914694])

HSP 1 Score: 179.489 bits (454), Expect = 2.692e-54
Identity = 82/153 (53.59%), Postives = 113/153 (73.86%), Query Frame = 2
Query:  503 RIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENN-LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV 958
            R   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+
Sbjct:    1 RCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFI 153          
BLAST of Protein phosphatase 2c vs. Ensembl Mouse
Match: Ilkap (integrin-linked kinase-associated serine/threonine phosphatase 2C [Source:MGI Symbol;Acc:MGI:1914694])

HSP 1 Score: 160.614 bits (405), Expect = 3.002e-47
Identity = 72/135 (53.33%), Postives = 102/135 (75.56%), Query Frame = 2
Query:  557 SKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV 958
            S Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+
Sbjct:    2 SSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFI 136          
BLAST of Protein phosphatase 2c vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 123.635 bits (309), Expect = 4.736e-31
Identity = 91/294 (30.95%), Postives = 149/294 (50.68%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLA--QMFPKGD--CESFELNVKRIFTDV---YKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFN 1090
            +SS +G R EM+DAH  +            + +   + +  F+ VYDGH G + + + + +L +++   + F   D    + E +V+ + T +   + KIDE     +  +    R GSTAV V++  T +Y  N GDS+AVL R    N     S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +    + D F+++ACDG+W   + ++  EFV     +E +D L    E  C+ +    + K S DN++VV+V F+
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCR----NGQVCFS-TQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSR--LEVSDDL----ENVCNWVVDTCLHKGSRDNMSVVLVCFS 296          
BLAST of Protein phosphatase 2c vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 123.635 bits (309), Expect = 4.736e-31
Identity = 91/294 (30.95%), Postives = 149/294 (50.68%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLA--QMFPKGD--CESFELNVKRIFTDV---YKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFN 1090
            +SS +G R EM+DAH  +            + +   + +  F+ VYDGH G + + + + +L +++   + F   D    + E +V+ + T +   + KIDE     +  +    R GSTAV V++  T +Y  N GDS+AVL R    N     S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +    + D F+++ACDG+W   + ++  EFV     +E +D L    E  C+ +    + K S DN++VV+V F+
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCR----NGQVCFS-TQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSR--LEVSDDL----ENVCNWVVDTCLHKGSRDNMSVVLVCFS 296          
BLAST of Protein phosphatase 2c vs. UniProt/SwissProt
Match: sp|Q0IIF0|ILKAP_BOVIN (Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus OX=9913 GN=ILKAP PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.421e-92
Identity = 141/292 (48.29%), Postives = 198/292 (67.81%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI 1093
            S K +V+ RKGER+EMQDAH++++D T   +    L     V    ++ V+DGH G +AS FAA+NLH+ L + FPKGD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++ TLYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   ++  R+E AC++L ++AV + S DNVTV++V   +
Sbjct:   84 SLKGYVAERKGEREEMQDAHVILNDITAECQPPSAL-----VTRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDGISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNTLYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQRREGKPTVDARYEAACNRLANKAVQRGSADNVTVMVVRIGL 370          
BLAST of Protein phosphatase 2c vs. UniProt/SwissProt
Match: sp|Q9H0C8|ILKAP_HUMAN (Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.216e-91
Identity = 139/287 (48.43%), Postives = 195/287 (67.94%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
             K +V+ RKGER+EMQDAH++++D TE  +    L     +    ++ V+DGH G +AS FAA+NLH+ L + FPKGD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   +   R+E AC++L ++AV + S DNVTV++V
Sbjct:  107 LKGYVAERKGEREEMQDAHVILNDITEECRPPSSL-----ITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVV 388          
BLAST of Protein phosphatase 2c vs. UniProt/SwissProt
Match: sp|Q8R0F6|ILKAP_MOUSE (Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus OX=10090 GN=Ilkap PE=1 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 6.626e-91
Identity = 138/287 (48.08%), Postives = 195/287 (67.94%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
             K +V+ RKGER+EMQDAH++++D T+       L     +    ++ V+DGH G +AS FAA+NLH+ L + FPKGD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   ++  R+E AC++L ++AV + S DNVTV++V
Sbjct:  107 LKGYVAERKGEREEMQDAHVILNDITQECNPPSSL-----ITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDDKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVV 388          
BLAST of Protein phosphatase 2c vs. UniProt/SwissProt
Match: sp|Q9Z1Z6|ILKAP_RAT (Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus OX=10116 GN=Ilkap PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 7.543e-91
Identity = 138/288 (47.92%), Postives = 195/288 (67.71%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNL-TAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV------GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
              K +V+ RKGER+EMQDAH++++D T+       L     +    ++ V+DGH G +AS FAA+NLH+ L + FPKGD  S E  VKR   D +K  DEEFLK AS Q+P  +DGSTA  VL ++  LYIAN+GDS+A+L R ++E+    A+SL+K+H    YEER+R+QK G  VRDGR+ G LE+SRS GD QYK+ GV  +PD+++C+L   DRF+++ACDGL+K FTP++AV F+       KI   E   ++  R+E AC++L ++AV + S DNVTV++V
Sbjct:  106 GLKGYVAERKGEREEMQDAHVILNDITQECNPPSSL-----ITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVV 388          
BLAST of Protein phosphatase 2c vs. UniProt/SwissProt
Match: sp|Q0J2R1|P2C67_ORYSJ (Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0314400 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.634e-44
Identity = 104/297 (35.02%), Postives = 162/297 (54.55%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHK-YLAQMFPKGDCESFELNV-KRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSK----------ENNLTAISLTKDHTAIDYEERLRLQK-HGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVL-KMSGDNVTVVIVAF 1087
            S ++  +  KG R  M+DA +L+ D +     N +            + +YDGH G  A+ +A ++LH+  +A   P+   E  ++   K+   + +++ DE  L+ ++K     +DG+TAV V ++  T+ +AN GD+KAVLAR +           ++ L AI LT++H AI  +ER R+QK  GS+  +GRL G +E+SR+ GD Q+KK G+I  PDV    +   D F+I+ CDGLW  F P  AVEFV   +   S+ +LA R      +L  EAV  +   DN T V++ F
Sbjct:   89 SVEADAAEDKGCRHTMEDAWVLLPDASMESPGNLRC---------AHFAIYDGHGGRLAAEYAQKHLHQNVIAAGLPR---ELMDVKAAKKAIIEGFRRTDECLLQESTKGN--WQDGATAVCVWVLGQTVVVANAGDAKAVLARSTSADGEGAVDDAKSQLKAIVLTREHKAIFPQERARIQKAGGSVGPNGRLQGRIEVSRALGDRQFKKVGLIATPDVHSFEVTRKDHFIILGCDGLWGVFGPGDAVEFVQNQLKETSSATLAVR------RLVKEAVRERRCKDNCTAVLIVF 365          
BLAST of Protein phosphatase 2c vs. TrEMBL
Match: A0A4S2M1L2 (PPM-type phosphatase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003475 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 5.264e-100
Identity = 168/369 (45.53%), Postives = 225/369 (60.98%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXX-ATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR----------------QSKENN-----LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKII-----GIESTDSLA-------------KRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            MSLFDDLPEP   +++ V        K K ET   T +        +   S V +RKGER EMQDAH+ IDD + Y + NF L+   +V    +Y V+DGH GCKAS++A++ LH Y+    P+      E ++KR+  D +KK DE+FL+ AS QRP  RDGSTA  VLI+N T+YIAN+GDSK VL R                +S+E++     LTA+ LT+DH  +DYEER R+Q  G+ V++GR+N  LE+SRSFGDYQ+KKQGV CIPDVKKC+L   DRFL+IACDGLWK+F P +AV    +++      + S  S +             +  E  CS L +EAVL+MSGDNVT +++ F
Sbjct:    1 MSLFDDLPEPELSNTAIVENTEDQLQKDKDETSCTTATA------LLPLISCVVARKGERPEMQDAHVCIDDLSVYFR-NFALN---EVCRLSYYAVFDGHGGCKASVYASKRLHLYVCSRLPRSGLAPIEKDIKRVLYDSFKKTDEDFLREASNQRPHWRDGSTASTVLIVNNTMYIANLGDSKVVLGRMVRDLHPVSSDNGDSNKSEESHSGSYSLTAVCLTRDHNPMDYEERQRIQASGASVQNGRVNNILEVSRSFGDYQFKKQGVTCIPDVKKCQLTPNDRFLLIACDGLWKSFPPDEAVALTNRLLLKEFEALSSNGSQSDLSSNPPTCGFTQRHLESVCSHLVNEAVLRMSGDNVTCILLVF 359          
BLAST of Protein phosphatase 2c vs. TrEMBL
Match: C1L6A9 (Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Schistosoma japonicum OX=6182 GN=ILKAP PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.355e-97
Identity = 160/361 (44.32%), Postives = 227/361 (62.88%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXATSKRKSET--ENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR------QSKENN-----------LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIE-----------STDSL--AKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            MSLFDDLPEPS           +   +KSET  E+ + +  ++      F   V +RKGER EMQD+HI++D+  + + +     +S++++   ++ V+DGH G KA+ FA + LH+++A  FP+G  +  E ++KR+  D YKK DEEFL+ A +QRP  RDGSTA  +L++N TLYI N+GDSK VLAR      +S   N           L+AI LTKDH  +DYEER R+Q  G+ V++GR+N  LE+SRSFGDYQ+KKQGV CIPDV+KC+L D D+FL+IACDGLWK+F P +AV    +++  E             D +   +  +  C+ L +EAVL+MSGDNVT +++ F
Sbjct:    1 MSLFDDLPEPSVE---------SDEIQKSETLIEDSSWNEPESSVKITPFICSVVARKGERPEMQDSHIVVDNLADSMFRG----VSNEILRVCYFAVFDGHGGAKAANFACKRLHQHIAARFPRGGIQQVEKDIKRVLYDSYKKTDEEFLREACQQRPHWRDGSTAATILLVNDTLYIGNLGDSKVVLARLVESLSESSNPNVNGDNILSDSKLSAICLTKDHNPMDYEERQRIQATGASVQNGRVNSVLEVSRSFGDYQFKKQGVTCIPDVRKCQLTDNDQFLLIACDGLWKSFPPDEAVHLTHRLLMQEIKNHENEQKKSQNDQIFCQRHLDSVCAHLVNEAVLRMSGDNVTCILLVF 348          
BLAST of Protein phosphatase 2c vs. TrEMBL
Match: Q86F00 (Clone ZZD1250 mRNA sequence OS=Schistosoma japonicum OX=6182 GN=ILKAP PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.921e-97
Identity = 160/361 (44.32%), Postives = 227/361 (62.88%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXATSKRKSET--ENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR------QSKENN-----------LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIE-----------STDSL--AKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            MSLFDDLPEPS           +   +KSET  E+ + +  ++      F   V +RKGER EMQD+HI++D+  + + +     +S++++   ++ V+DGH G KA+ FA + LH+++A  FP+G  +  E ++KR+  D YKK DEEFL+ A +QRP  RDGSTA  +L++N TLYI N+GDSK VLAR      +S   N           L+AI LTKDH  +DYEER R+Q  G+ V++GR+N  LE+SRSFGDYQ+KKQGV CIPDV+KC+L D D+FL+IACDGLWK+F P +AV    +++  E             D +   +  +  C+ L +EAVL+MSGDNVT +++ F
Sbjct:    1 MSLFDDLPEPSVE---------SDEIQKSETLIEDSSWNEPESSVKITPFICSVVARKGERPEMQDSHIVVDNLADSMFRG----VSNEILRVCYFAVFDGHGGAKAANFACKRLHQHIAARFPRGGIQQVEKDIKRVLYDSYKKTDEEFLREACQQRPHWRDGSTAATILLVNDTLYIGNLGDSKVVLARLVESLSESSNPNVNGDNILSDSKLSAICLTKDHNPMDYEERQRIQATGASVQNGRVNSVLEVSRSFGDYQFKKQGVTCIPDVRKCQLTDNDQFLLIACDGLWKSFPPDEAVHLTHRLLMQEIKNHENEQKKSQNDQIFCQRHLDSVCAHLVNEAVLRMSGDNVTCILLVF 348          
BLAST of Protein phosphatase 2c vs. TrEMBL
Match: A0A5K4F0L3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.308e-96
Identity = 163/365 (44.66%), Postives = 223/365 (61.10%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR---QSKENN--------------LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIE---------------STDS----LAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            MSLFDDLPEPS  +S               + N + S+ K     I +   V +RKGER EMQD+HI++D+  E + +     +S+++    ++ ++DGH G KA+ FA + LH+++A  FP+G  +  E ++KR+  D YKK DEEFL+ A +QRP  RDGSTA  +L++N TLYIAN+GDSK VLAR      E+N              L AI LTKDH  +DYEER R+Q  G+ V++GR+N  LE+SRSFGDYQ+KKQGV CIPDVKKC+L D D+FL+IACDGLWK+F P +AV    +++  E                TD       +  +  C+ L SEAVL+MSGDNVT +++ F
Sbjct:    1 MSLFDDLPEPSVENSDLQKPEILGG---DSSWNESGSVVK----LIPYLCSVVARKGERPEMQDSHIVVDNLIELMYRG----VSNEIARVCYFAIFDGHGGAKAANFACKRLHQHIATRFPRGGMQQVEKDIKRVLYDSYKKTDEEFLREACQQRPHWRDGSTAATILLVNNTLYIANLGDSKVVLARLDESPSESNKVDVNSSNTLSNPKLNAICLTKDHNPMDYEERQRIQATGASVQNGRVNSVLEVSRSFGDYQFKKQGVTCIPDVKKCQLTDNDQFLLIACDGLWKSFPPNEAVHLTHELLMQEIKNYKNEHRESQNGQCTDYSRILCQRHLDSVCTHLVSEAVLRMSGDNVTCILLVF 354          
BLAST of Protein phosphatase 2c vs. TrEMBL
Match: A0A419PZM6 (Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Clonorchis sinensis OX=79923 GN=ILKAP PE=3 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 2.200e-96
Identity = 167/386 (43.26%), Postives = 225/386 (58.29%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXX------------XXXXXATSKRKSETENLT------ISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR----------------QSKENN-----LTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKII-----GIESTDSLA-------------KRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            MSLFDDLPEP   +++                     K K ET   T      I+        +   S V +RKGER EMQDAH+ IDD + Y + NF L+   +V    +Y V+DGH GCKAS++A++ LH Y+    P+      E ++KR+  D +KK DE+FL+ AS QRP  RDGSTA  VLI+N T+YIAN+GDSK VL R                +S+E++     L+A+ LT+DH  +DYEER R+Q  G+ V++GR+N  LE+SRSFGDYQ+KKQGV CIPDVKKC+L   DRFL+IACDGLWK+F P +AV    +++      + S  S +             +  E  CS L +EAVL+MSGDNVT +++ F
Sbjct:    1 MSLFDDLPEPELSNTAVGRFAFRFLTDLVENTEDQLQKDKDETSCTTATGITNITSSPYLAALLPLISCVVARKGERPEMQDAHVCIDDLSVYFR-NFALN---EVCRLSYYAVFDGHGGCKASVYASKRLHLYVCSRLPRSGLAPIEKDIKRVLYDSFKKTDEDFLREASNQRPHWRDGSTASAVLIVNNTMYIANLGDSKVVLGRMVRDLHPVSSDNGDSNKSEESHSGSYSLSAVCLTRDHNPMDYEERQRIQASGASVQNGRVNNILEVSRSFGDYQFKKQGVTCIPDVKKCQLTPNDRFLLIACDGLWKSFPPDEAVALTNRLLLKEFEALSSNGSQSDLSSNPPTCGFTQRHLESVCSHLVNEAVLRMSGDNVTCILLVF 382          
BLAST of Protein phosphatase 2c vs. Ensembl Cavefish
Match: ilkap (integrin-linked kinase-associated serine/threonine phosphatase [Source:ZFIN;Acc:ZDB-GENE-070410-122])

HSP 1 Score: 239.58 bits (610), Expect = 8.344e-76
Identity = 127/294 (43.20%), Postives = 192/294 (65.31%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKK-NFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLAR----QSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSL-------AKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
             K  V++R+GER+EMQDAH+L+ + +E +K    +  LS       ++ V+DGH G +AS FAAENLH  +   FPK D E+ +  VK+   D +++ DE+FLK AS  +P  +DGSTA  +L+++  LY+AN+GDS+AVL R     S + N   ++L+K+H    YEER+R+Q+ G  V DGR+ G LE+SRS GD QYK+ GVI  PD+++C+L   D F+I+ACDGL+K F+ ++++++V KI+   + D         A R+E AC +L SEAV +   DNVTV++++ 
Sbjct:   33 LKGVVAARRGEREEMQDAHVLLPNLSECMKTLPAQSRLS-------YFAVFDGHGGARASQFAAENLHHTVISKFPK-DVENLDKLVKKCLLDSFRQTDEDFLKKAS-SKPAWKDGSTATCLLVVDNVLYVANLGDSRAVLCRIEQTDSGDENCVTLALSKEHNPTIYEERMRIQRAGGSV-DGRVLGVLEVSRSIGDGQYKRCGVISTPDLRRCQLTPKD-FVILACDGLFKVFSAEESIKYVNKILQDSAVDGKAGQTLEEAGRYEEACQQLASEAVRRGCADNVTVILISI 315          
BLAST of Protein phosphatase 2c vs. Ensembl Cavefish
Match: ppm1ab (protein phosphatase 1A [Source:NCBI gene;Acc:103035785])

HSP 1 Score: 125.946 bits (315), Expect = 8.319e-32
Identity = 85/296 (28.72%), Postives = 145/296 (48.99%), Query Frame = 2
Query:  224 HFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            H +  S +  +SS +G R EM+DAH  +            + L + +    F+ VYDGH G + + +  E+L +++       D      +VK      + +IDE    I+ ++    R GSTAV +++     Y  N GDS+A+L+R  + +       T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GD+ YK        +Q V   P+V +    + D F+++ACDG+W   T ++  +FV       S   + +  E  C+++    + K S DN++VV+V F
Sbjct:   16 HGEGNSLRYGLSSMQGWRVEMEDAHTAV------------VGLPNGLSAWSFFAVYDGHAGSQVARYCCEHLLEHITS---NPDFRPSVESVKNGIRTGFLQIDEHMRAISERKHGADRSGSTAVGIMVSPQHFYFINCGDSRALLSRGGRVH-----FFTQDHKPSNPLEKERIQNAGGAVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYEIEREEDDEFVVLACDGIWDVMTNEELCDFV------RSRLEVTEDLERVCNEIVDTCLYKGSRDNMSVVLVCF 285          
BLAST of Protein phosphatase 2c vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 125.176 bits (313), Expect = 1.047e-31
Identity = 92/290 (31.72%), Postives = 146/290 (50.34%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL---AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKK-CRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + +++L +++   ++ F  G  +S E  VK      + KIDE     +  +    R GSTAV VL+    LY  N GDS+AVL+R ++         T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +  R+ D D F+++ACDG+W   + ++  EFV       S   + +  E  C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNSEDFQPGP-DSVE-GVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQ-----VRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFV------RSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 124.79 bits (312), Expect = 1.120e-31
Identity = 92/290 (31.72%), Postives = 146/290 (50.34%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL---AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKC-RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + +++L +++   ++ F  G  +S E  VK      + KIDE     +  +    R GSTAV VL+    LY  N GDS+AVL+R ++         T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +  R+ D D F+++ACDG+W   + ++  EFV       S   + +  E  C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNSEDFQPGP-DSVE-GVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQ-----VRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFV------RSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Cavefish
Match: ppm1bb (protein phosphatase 1B-like [Source:NCBI gene;Acc:103035481])

HSP 1 Score: 124.79 bits (312), Expect = 4.856e-31
Identity = 93/290 (32.07%), Postives = 147/290 (50.69%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL---AQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKK-CRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + +++L +++   ++ F  G  +S E  VK      + KIDE     +  +    R GSTAV VL+    LY  N GDS+AVL+R ++       S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK        +Q V   P+V +  R+ D D F+++ACDG+W   + ++  EFV       S   + +  E  C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITNSEDFQPGP-DSVE-GVKSGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLLSPEHLYFINCGDSRAVLSRAAQ----VRFS-TQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIPRVPDEDEFVVLACDGIWDVMSNEELCEFV------RSRLEVWEDLEKVCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003550.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 2.312e-32
Identity = 91/306 (29.74%), Postives = 147/306 (48.04%), Query Frame = 2
Query:  257 SSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFE-LNVKRIFTDVYKKIDEEFLKIASKQRP--------FLRDGS---------TAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSG---DNVTVVIVAF 1087
            +  +G R+ M+D+HI              LDL   V    F+GVYDGH G + + F  ++L   L ++       SF+  N ++   D+Y  +DE  L    K +         F R GS         TAV+ +I  T +Y+ N GDS+ VLA +        I +++DH   +  E+ R+++ G  V D R+ G L +SRS GD +YK         Q +  +P+V++ ++ +   FLI+ACDG+W   + Q+   FVG+++  +    L+   E    K+ +  V    G   DN+T V+V F
Sbjct:   27 TGMQGWRNTMEDSHIAC------------LDLGHGV---SFFGVYDGHGGNEVADFVRDHLVDELKKL------PSFQGSNYEQALKDIYIHLDEMLLTPYGKSKKNNDSGSSLFGRGGSEEIAMGTGCTAVSAIITPTDIYVGNSGDSRVVLAVK-----YHGIEMSEDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRREKITNETAFLILACDGIWDCLSSQECTNFVGELLK-KKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQF 305          
BLAST of Protein phosphatase 2c vs. Ensembl Sea Lamprey
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 125.561 bits (314), Expect = 3.165e-32
Identity = 91/289 (31.49%), Postives = 144/289 (49.83%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENL--HKYLAQMFP-KGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +      +K               F+ VYDGH G + + F +E+L  H    + F  K   E     V++     + +IDE    I+  +    R GSTAV V++    LY  N GDS+AVL R     N +    T+DH   +  E+ R+Q  GS++   R+NG+L +SR+ GD+ YK        +Q V   P+V+     D D F+++ACDG+W   + ++  +FV   + +  TD L K     C+++    + K S DN+++V+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAVVGIPRGLKTW------------SFFAVYDGHAGSRVATFCSEHLLEHIITNEHFECKAGTEPSSEAVEKGIQAGFLQIDEHMRTISDIKNGLDRSGSTAVAVMLSPKHLYFINCGDSRAVLYR-----NGSVHFCTEDHKPCNPAEKERIQNGGSVMIQ-RVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVRAIERSDGDEFVVLACDGIWDVMSNEELGQFVHSRLLL--TDDLEK----ICNQVLDTCLYKGSRDNMSIVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003549.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.150e-31
Identity = 91/307 (29.64%), Postives = 146/307 (47.56%), Query Frame = 2
Query:  257 SSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFE-LNVKRIFTDVYKKIDEEFLKIASKQRP---------FLRDGS---------TAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSG---DNVTVVIVAF 1087
            +  +G R+ M+D+HI              LDL   V    F+GVYDGH G + + F  ++L   L ++       SF+  N ++   D+Y  +DE  L    K            F R GS         TAV+ +I  T +Y+ N GDS+ VLA +        I +++DH   +  E+ R+++ G  V D R+ G L +SRS GD +YK         Q +  +P+V++ ++ +   FLI+ACDG+W   + Q+   FVG+++  +    L+   E    K+ +  V    G   DN+T V+V F
Sbjct:   27 TGMQGWRNTMEDSHIAC------------LDLGHGV---SFFGVYDGHGGNEVADFVRDHLVDELKKL------PSFQGSNYEQALKDIYIHLDEMLLTPYGKSYKKNNDSGSSLFGRGGSEEIAMGTGCTAVSAIITPTDIYVGNSGDSRVVLAVK-----YHGIEMSEDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVRREKITNETAFLILACDGIWDCLSSQECTNFVGELLK-KKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQF 306          
BLAST of Protein phosphatase 2c vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 107.071 bits (266), Expect = 3.231e-26
Identity = 79/284 (27.82%), Postives = 135/284 (47.54%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV---RDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            SF+  + + K  R +M+D H++  D         + D         ++ ++DGH G  A+I+AA +LH  LA+   +G   SF  +        + + D+ F+  A ++    R GST V  LI    L++A +GDS+ +L R+      + + L   H     +E+ R++  G  V      R+NGTL +SR+ GD ++K   V C  D     L  ++ +L++ACDG +    P +A   VG+ +     D       +   +L + A    S DN+TV++V
Sbjct:   78 SFQISLHAIKNTRRKMEDRHVIFQDLNALFTSEEEED------DQAYFAIFDGHGGVDAAIYAATHLHVSLAR---EG---SFRRDPLEALRRAFCQTDQRFVLKARQEN--WRCGSTGVVTLIRGNELHVAWLGDSQVILVRKG-----SPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHKPY-VSCDADCATFPLDGSEDYLLLACDGFYDTVQPDEAARIVGEHLRENDGDP-----AMLAHRLVASARDAGSSDNITVLVV 336          
BLAST of Protein phosphatase 2c vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 103.219 bits (256), Expect = 7.524e-26
Identity = 69/238 (28.99%), Postives = 117/238 (49.16%), Query Frame = 2
Query:  377 FYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV---RDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            ++ ++DGH G  A+I+AA +LH  LA+        SF  +        + + D+ F+  A +++   R GST V  LI    L++A +GDS+ +L R+      + + L   H     +E+ R++  G  V      R+NGTL +SR+ GD ++K   V C  D     L  ++ +L++ACDG +    P +A   VG+ +     D       +   +L + A    S DN+TV++V
Sbjct:    2 YFAIFDGHGGVDAAIYAATHLHVSLARE------GSFRRDPLEALRRAFCQTDQRFVLKARQEQKNWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKG-----SPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHKPY-VSCDADCATFPLDGSEDYLLLACDGFYDTVQPDEAARIVGEHLRENDGDP-----AMLAHRLVASARDAGSSDNITVLVV 222          
BLAST of Protein phosphatase 2c vs. Ensembl Yeast
Match: PTC2 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; inactivates the DNA damage checkpoint; PTC2 has a paralog, PTC3, that arose from the whole genome duplication [Source:SGD;Acc:S000000891])

HSP 1 Score: 112.079 bits (279), Expect = 1.763e-27
Identity = 88/310 (28.39%), Postives = 148/310 (47.74%), Query Frame = 2
Query:  215 KKNHFDCISFKSF-VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESF-ELNVKRIFTDVYKKIDEEFLKIASKQRPFLRD---GSTAVNVLIINTT--LYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRL-IDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGI---ESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            K++H    S  +F + + +G R  M+D+HIL  +      K+          H  FYG++DGH G K + +    + + L +       +SF E N+ R   D +   D + L     Q P +++   G TA ++L+  +   L   N GDS+ VLA         A +L+ DH      E+ R+      V   R+NG L +SR+ GD+++K        +Q V C+PD+ +  L  D D F+I+ACDG+W   T Q  V+ V   +G+   ++ + ++ R    C    +E    +  DN+++V+VA 
Sbjct:   12 KESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKD----------HIAFYGIFDGHGGAKVAEYCGNKIVEILQEQ------KSFHEGNLPRALIDTFINTDVKLL-----QDPVMKEDHSGCTATSILVSKSQNLLVCGNAGDSRTVLATDGN-----AKALSYDHKPTLASEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCLTSQDCVDLVH--LGLREGKTLNEISSRIIDVCCAPTTEGT-GIGCDNMSIVVVAL 292          
BLAST of Protein phosphatase 2c vs. Ensembl Yeast
Match: PTC1 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p, inactivating osmosensing MAPK cascade; involved in Fus3p activation during pheromone response; deletion affects precursor tRNA splicing, mitochondrial inheritance, and sporulation [Source:SGD;Acc:S000002164])

HSP 1 Score: 105.531 bits (262), Expect = 2.776e-26
Identity = 84/296 (28.38%), Postives = 134/296 (45.27%), Query Frame = 2
Query:  236 ISFKSFVSSRKGE--RDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEF-LKIASKQ---------RPFLRDGST--AVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            I+++  V+  K    R  M+D H  + +F        +LD        G++ V+DGH G +AS +  ++LH  + Q     +      +V+ +  D +  IDEE   K+             R  L D  +  ++++      LY AN+GDS+ VL R     N  +I LT DH A D  E  R+++ G ++   R+NG L ++RS GD ++    V+  P      +   D+FLI+ACDGLW     Q A E +  I        +  R+ L             + DNVTV++V
Sbjct:   17 ITYRVGVAENKNSKFRRTMEDVHTYVKNFAS------RLDW-------GYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETR----DVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFR-----NGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGD-KFFDSLVVGSPFTTSVEITSEDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKVLVRYALENG----------TTDNVTVMVV 279          
BLAST of Protein phosphatase 2c vs. Ensembl Yeast
Match: PTC3 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p (see also Ptc2p) to limit maximal kinase activity induced by osmotic stress; dephosphorylates T169 phosphorylated Cdc28p (see also Ptc2p); role in DNA damage checkpoint inactivation; PTC3 has a paralog, PTC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000152])

HSP 1 Score: 101.679 bits (252), Expect = 5.316e-24
Identity = 93/312 (29.81%), Postives = 141/312 (45.19%), Query Frame = 2
Query:  212 IKKNHF---DCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNV-KRIFTDVYKKIDEEFLKIASKQRPFLRD---GSTAVNVLI--INTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRL-IDTDRFLIIACDGLWKAFTPQQAVEFV--GKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            I K H    DC++     +  +G R  M+DAHI        ++ N   +   D  H  FYG++DGH G   + F    +   L +       ESF+  + ++   D +   D E LK        L+D   G TA  +L+  +   L  AN GDS+ VL   S   N  A+S   DH      E+ R+      V   R+NG L +SR+ GD+++K        +Q V C+PD+    L  D D F+I+ACDG+W   T Q+ V+ V  G   G  +   ++ R    C    +E    +  DN+++ IVA 
Sbjct:   10 IDKEHHSGTDCLTAFGLCA-MQGWRMSMEDAHI--------VEPNLLAE--SDEEHLAFYGIFDGHGGSSVAEFCGSKMISILKKQ------ESFKSGMLEQCLIDTFLATDVELLKDEK-----LKDDHSGCTATVILVSQLKKLLICANSGDSRTVL---STGGNSKAMSF--DHKPTLLSEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNTKLGPHEQVVTCVPDIICHNLNYDEDEFVILACDGIWDCLTSQECVDLVHYGISQGNMTLSDISSRIVDVCCSPTTEGS-GIGCDNMSISIVAL 293          
BLAST of Protein phosphatase 2c vs. Ensembl Yeast
Match: PTC4 (Cytoplasmic type 2C protein phosphatase (PP2C); identified as a high-copy number suppressor of cnb1 mpk1 synthetic lethality; overexpression decreases high-osmolarity induced Hog1p phosphorylation and kinase activity [Source:SGD;Acc:S000000329])

HSP 1 Score: 90.1225 bits (222), Expect = 2.645e-20
Identity = 92/355 (25.92%), Postives = 145/355 (40.85%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDD--------FTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLH-------------------KYLAQMFP---------------KGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINT-TLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKK--------------------------QGVICIPDVKKCRL-IDTDRFLIIACDGLWKAFTPQQAVEFVGK--IIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFN 1090
            F + V S +G R   +DAH++ ++        F  +I K   L L+        + V+DGH G   S F +   H                   K++A  F                K    + E  V +IF D +   DEE  +  +        GSTAV   IIN  +LY+AN GDS+ +L+  SK N +  +S   DH      E +R+  +G  V  GR+ G L +SR+F D+Q+K+                            V   PDV   ++    D FL++ACDG+W  +  +Q + F+    + G +    + K  +   ++  S   +    DN+T +IV  N
Sbjct:   32 FYNCVGSMQGYRLTQEDAHLIRNENSVVYVRFFNPFIDKYETLSLN-------VFAVFDGHGGDDCSKFLSGGRHHRDGNGSSNGNGEPNAGLIKWIAYSFENHHYTSTTNNDSSKFKRSFNTLEGLVSQIFKDAFILQDEELYRHFANSSC----GSTAVVACIINEESLYVANCGDSRCILS--SKSNGIKTMSF--DHKPQHIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLMHKIDYSKDEFLVLACDGIWDIYNNKQLIHFIKYHLVSGTKLDTIITKLLDHGIAQANSNTGVGF--DNMTAIIVVLN 369          
BLAST of Protein phosphatase 2c vs. Ensembl Yeast
Match: PTC5 (Mitochondrial type 2C protein phosphatase (PP2C); involved in regulation of pyruvate dehydrogenase activity by dephosphorylating the serine 133 of the Pda1p subunit; localizes to the intermembrane space and is imported via the presequence pathway and processed by the inner membrane protease (Imp1p-Imp2p); acts in concert with kinases Pkp1p and Pkp2p and phosphatase Ptc6p [Source:SGD;Acc:S000005616])

HSP 1 Score: 68.1662 bits (165), Expect = 6.883e-13
Identity = 62/252 (24.60%), Postives = 106/252 (42.06%), Query Frame = 2
Query:  377 FYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEE----FLK-----IASKQRPFLRD--------------GSTAVNVLI--INTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKH----GSIVRDGRLNGTLEISRSFGDYQYK-----------------------------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV 958
            F+G++DGH G     F +E L K L +       + ++ N     +D  + ID      FLK     +    R   +D              GS A+  L    N+ L +A  GDS+A++     E N T  SL+ D T  + +E  R++K      +++R+GR+ G+L+ SR+FGDY+YK                                V   P +   ++ +  +F+++  DGL++  T ++    V
Sbjct:  192 FFGIFDGHGGP----FTSEKLSKDLVRYVAYQLGQVYDQNKTVFHSDPNQLIDSAISKGFLKLDNDLVIESFRKLFQDPNNTNIANTLPAISGSCALLSLYNSTNSILKVAVTGDSRALICGLDNEGNWTVKSLSTDQTGDNLDEVRRIRKEHPGEPNVIRNGRILGSLQPSRAFGDYRYKIKEVDGKPLSDLPEVAKLYFRREPRDFKTPPYVTAEPVITSAKIGENTKFMVMGSDGLFELLTNEEIASLV 439          
BLAST of Protein phosphatase 2c vs. Ensembl Nematostella
Match: EDO39603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9M4])

HSP 1 Score: 271.552 bits (693), Expect = 4.379e-89
Identity = 130/289 (44.98%), Postives = 187/289 (64.71%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIEST----------DSLAKRFELACSKLCSEAVLKMSGDNVTVVI 1078
             K F + RKGER+EMQDAH++ D++     +       DDV    +Y V+DGH G +AS+FAAE+LH+ +    PKG     +  +K+   D Y   DE+FL  ASK  P  +DGSTAV+VL+IN TLY+AN+GDSKA++ R      ++ + L+KDH+   Y+ER+R+QK G  V+DGR+ G LE+SRS GD ++K+ GVI  PD+ +C L D DRFL++ACDGLWK F+  +AV+++ KI+ +  T          D +  RF+LAC ++ S+AV   S DNVTV++
Sbjct:    4 LKGFFAERKGEREEMQDAHVIRDEYYPEPGRG------DDVQRMAYYAVFDGHAGPRASLFAAEHLHENIKSRMPKGSITGKDKEIKKCLVDAYTLTDEQFLHEASKGTPVWKDGSTAVSVLVINNTLYVANLGDSKALVCRCDSAGKISVVRLSKDHSPTGYDERMRIQKAGGYVKDGRVLGVLEVSRSIGDGRFKRCGVISTPDIMRCTLTDNDRFLLLACDGLWKGFSVDEAVKYISKILDVRYTYILTNEEPGLDPVEARFQLACDRIASDAVRNGSSDNVTVML 286          
BLAST of Protein phosphatase 2c vs. Ensembl Nematostella
Match: EDO44137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ9])

HSP 1 Score: 121.709 bits (304), Expect = 1.131e-31
Identity = 89/284 (31.34%), Postives = 145/284 (51.06%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV---RDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            ++++ V + K  R +M+D H+++  F      N    L  D  +  ++ V+DGH G  A+ FAA +LH +LAQ       E    +      + ++  D  F   A  +   LR G TAV++LI N  LY+A +GDS+A+L +  +      I L + H     +E+ R++  G  V      R+NG+L +SR+ GD ++K   +   PDV +  L     F+I+ACDGLW    P+QA++ V + I      S   R ++A   L  EA  + S DN++V++V
Sbjct:   38 TYETSVYAIKNTRRKMEDKHVIMPHF------NSLFGLPKDSPNYAYFAVFDGHGGIDAATFAATHLHCFLAQN------EHLIKDPGLALHETFQNTDCSFGARAISEG--LRSGCTAVSILITNEALYLAWLGDSQAILCKDGE-----FIELMQPHKPERQDEKDRIEGLGGCVVWFGAWRVNGSLSVSRAIGDAEHKPF-ISGEPDVAEYALDGEQEFVILACDGLWDTVKPEQAIKLVKEHIA-----SGNDRCDVA-KVLVDEAKQEGSSDNISVLVV 295          
BLAST of Protein phosphatase 2c vs. Ensembl Nematostella
Match: EDO31490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS4])

HSP 1 Score: 120.939 bits (302), Expect = 6.294e-31
Identity = 100/363 (27.55%), Postives = 160/363 (44.08%), Query Frame = 2
Query:  173 SKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLK----------------------------------------------IASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVR-DGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKII--GIESTDSLAKRFELACSKLCSEAVLKMSG-DNVTVVIVAF 1087
            SK K+E  ++T S  K  +         S+ +G R  M+DAH  + DF E        D S        + VYDGH G + + + +++L   L     +GD    E N K+   D + K+DE  +                                               +          G+TA+  L+ +  L +AN+GDS+ VL R     N  A+ ++ DH   D +E  R+ K G  V  +GR+NG L +SR+ GD+ YK        +Q +  +PD+++  L + D F++IACDG+W     Q+ V+FV + +  G E+  S+ ++   AC  L  +     +G DN+T VIV+F
Sbjct:    6 SKPKTEMNSVTESNSKMSYG-------ASAMQGWRVSMEDAHTCLLDFDE--------DTS-------LFAVYDGHGGQEVAEYVSKHLPDVL-----RGDIGYKEGNTKQALIDTFLKVDESIVSEEGVDEKGVDEEGASEEPQDGEEEEEEEEESEEEEEEEEDEDGEGVLVKSDEAGYDSGTTAIVALVKDNNLTVANVGDSRCVLCR-----NGIALDMSIDHKPEDEKELNRIHKAGGKVTCEGRVNGGLNLSRALGDHSYKGQSELGAHEQQITAMPDIRQTTLTEADEFMVIACDGIWNVKNSQEVVDFVKQEMKNGEENLSSICEKLFDAC--LAPDTSGDGAGCDNMTCVIVSF 334          
BLAST of Protein phosphatase 2c vs. Ensembl Nematostella
Match: EDO36040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS2])

HSP 1 Score: 114.39 bits (285), Expect = 2.015e-28
Identity = 87/292 (29.79%), Postives = 144/292 (49.32%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLA--QMFP---KGDCESFELN-VKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +++ +G R EM+DAH  +            + LSD +    F+ V+DGH G   S + + NLH+ L   Q F    K   +S +L+ ++    D + ++D    K+        + GSTA+ +L+       AN GDS+ +L+     +N   I  T DH   + +E+ R++  G  V   R+NG L +SR+ GD++YK        KQ V   PD+      D D F+++ACDG+W   T  +   FV   + I  TD L +   ++C +L    + K S DN++V+I++ 
Sbjct:   26 LAAMQGWRVEMEDAHTAV------------IGLSDHLKDWSFFAVFDGHAGENVSKYCSSNLHETLLKHQSFEAAIKESSDSPDLDQLRSGLRDAFLELDSTMQKLPKWSSGEDKSGSTAIALLVTPKYYIFANCGDSRGILS-----HNGEVIYNTVDHKPGNPDEKTRIENAGGSVMIQRVNGALAVSRALGDFEYKLDSSLHATKQLVSPEPDIFFQSRSDQDEFIVLACDGVWDVMTNDEVGAFVRSRLQI--TDDLQR---VSC-ELLDTCLTKGSRDNMSVIIISL 294          
BLAST of Protein phosphatase 2c vs. Ensembl Nematostella
Match: EDO40449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S778])

HSP 1 Score: 112.464 bits (280), Expect = 4.062e-28
Identity = 98/301 (32.56%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  239 SFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQM--FPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKK--------QGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELA--CSKL---CSEAVLKMSG---DNVTVVIVAF 1087
            S+K   S  +G R  M+DAH  I            L L +D  +  F GVYDGH G + + +  +NL K +A    + KG       NV       +   D + LK   +Q      G+TAV V+I N  LY AN+GDS+A+  ++          L+ DH   + EE  R+   G  V   R+NG L +SR+ GD+ +KK        Q V  +PDV    L     FL++ACDG+W   + Q+ V+F+           LA+R EL   C +L   C     +M G   DN+TV+I+ F
Sbjct:   21 SYKLASSCMQGWRINMEDAHTEI------------LSLKEDK-NTAFLGVYDGHGGARVAQYVGQNLQKKIASQPAWAKG-------NVIEALKKGFLSCDTDMLK--DEQMKDEVAGTTAVVVVIKNNKLYCANVGDSRAIACKKG-----LVEQLSFDHKPSNEEETRRIIAAGGWVEFNRVNGNLALSRALGDFCFKKNDKKPPEEQIVTAMPDVIVKDLTPDHEFLVLACDGIWDVLSNQEVVDFI--------RSRLAQRMELEQICEELLTRCLAPDCQMGGLGCDNMTVIILTF 286          
BLAST of Protein phosphatase 2c vs. Ensembl Medaka
Match: ilkap (ILK associated serine/threonine phosphatase [Source:NCBI gene;Acc:101160790])

HSP 1 Score: 266.544 bits (680), Expect = 5.163e-86
Identity = 145/348 (41.67%), Postives = 221/348 (63.51%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXA------TSKRKSETENLTISIKKNHFDCIS-FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPK-GDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSK----ENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKII---GIESTDSLAK---RFELACSKLCSEAVLKMSGDNVTVVIVAFN 1090
            M LFDDLPEP+  S      +++      T+KR+ E     + +K+   + +   K++V++R+GER+EMQDAH+L+ D   ++    +L     V    ++ V+DGH G +AS FAAE+LH  LA+ FP  GD E  +  +++   D +++ DE+FLK AS Q+P  +DGSTA  VL+++  LY+AN+GDS+AV+ R       +  L A++L+K+H    YEER+R+Q+ G  VRDGR+ G LE+SRS GD QYK+ GVI  PD+++C+L   DRF+++ACDGL+K F+  +A+ FV  ++   G+E    L +   RFE AC +L SEAV +   DNVTV++V+  
Sbjct:    1 MDLFDDLPEPTQTSGRLSAPSASDEEEERTAKRRREDGGEDVEVKRVCKEGLPELKAYVAARRGEREEMQDAHVLLPDLMGFLPSQPEL-----VSRLSYFAVFDGHGGARASRFAAEHLHHNLAKKFPPTGDAEHLDKLIRKCLLDTFRQTDEDFLKKASSQKPSWKDGSTATCVLVVDDVLYVANLGDSRAVMCRTEAAADGQQKLLALALSKEHNPTIYEERMRIQRAGGTVRDGRVLGVLEVSRSIGDGQYKRCGVISTPDLRRCQLTANDRFILLACDGLFKVFSADEALRFVLNVLQEAGVEQKAGLTEEELRFEAACQQLASEAVKRGCADNVTVILVSIG 343          
BLAST of Protein phosphatase 2c vs. Ensembl Medaka
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent 1E [Source:NCBI gene;Acc:101162311])

HSP 1 Score: 128.642 bits (322), Expect = 5.616e-32
Identity = 89/284 (31.34%), Postives = 144/284 (50.70%), Query Frame = 2
Query:  242 FKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV---RDGRLNGTLEISRSFGDYQYKKQGVICI-PDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIV 1081
            +++ + + K  R +M+D H++I DF      N   ++ D      F+ V+DGH G  A+I+AA +LH  L         ESF  +        +K  DE F+K AS+++  LR G+T V   +   TLY+A +GDS+ +L R+ +      + L K H     +E+ R++  G  V      R+NG+L +SR+ GD ++K    IC   D     L  ++ +LI+ACDG W   +P++AV  V   +   S D+      +   KL + A    S DN+TV++V
Sbjct:  138 YETSIHAIKNMRRKMEDKHVIIPDF------NTLFNIQDQE-EQAFFAVFDGHGGVDAAIYAANHLHVNLVHQ------ESFSQDPIEALCKAFKVTDERFVKKASREK--LRCGTTGVVTFLRGQTLYVAWLGDSQVILVRRGQ-----VVELMKPHKPDREDEKKRIEALGGCVIWFGTWRVNGSLSVSRAIGDSEHKP--YICGDADHSVFPLDGSEDYLILACDGFWDTVSPEEAVRVVSDHLQENSGDTT-----MVAHKLVASARDAGSSDNITVIVV 394          
BLAST of Protein phosphatase 2c vs. Ensembl Medaka
Match: ENSORLT00000039194.1 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 122.479 bits (306), Expect = 8.432e-31
Identity = 89/288 (30.90%), Postives = 138/288 (47.92%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPK-GDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK------KQGVICIPDVKKC---RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + + +L +++     + G   S    VK      +  IDE     +  ++   R GSTAV VL+  T LY  N GDS+AVL+R  K       S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK          +  P+ + C   R  + D F+++ACDG+W   + ++  EFV       S   +    E  C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQGPSSVEGVKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGK----VGFS-TQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFV------RSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Medaka
Match: ENSORLT00000012921.2 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 122.479 bits (306), Expect = 3.518e-30
Identity = 90/288 (31.25%), Postives = 140/288 (48.61%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPK-GDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK------KQGVICIPDVKKC---RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + + + +L +++     + G   S    VK      +  IDE     +  ++   R GSTAV VL+  T LY  N GDS+AVL+R  K       S T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GDY YK          +  P+ + C   R  + D F+++ACDG+W   + ++  EFV   + +   D L K     C+ +    + K S DN++VV+V F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQGPSSVEGVKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGK----VGFS-TQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLV--CDDLEK----VCNSVVDTCLHKGSRDNMSVVLVCF 290          
BLAST of Protein phosphatase 2c vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 118.627 bits (296), Expect = 2.047e-29
Identity = 90/292 (30.82%), Postives = 143/292 (48.97%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYL--AQMFPKGDCESFELNVKRIFTDV---YKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKC-RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            +SS +G R EM+DAH  +            + L   +    F+ VYDGH G + + +  E+L +++  +Q F     E  E  V ++   +   +   DE    ++ K+    R GSTAV V+I  + LY  N GDS+ +L+R    + L     T+DH   +  E+ R+Q  G  V   R+NG+L +SR+ GD+ YK        +Q V   P+V    R    D F+I+ACDG+W     ++   FV     +E TD L    E  C+++    + K S DN++VV++ F
Sbjct:   26 LSSMQGWRVEMEDAHTAV------------VSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDKVKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSR----SGLVKF-FTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRS--RLEVTDDL----ERVCNEIVDTCLYKGSRDNMSVVLICF 294          
BLAST of Protein phosphatase 2c vs. Planmine SMEST
Match: SMESG000018373.1 (SMESG000018373.1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 330/331 (99.70%), Postives = 330/331 (99.70%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXXXXXXXXXXATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI 1093
            MSLFDDLPEPSNLSSSSVLVNSATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV KIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI
Sbjct:    1 MSLFDDLPEPSNLSSSSVLVNSATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVAKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI 331          
BLAST of Protein phosphatase 2c vs. Planmine SMEST
Match: SMESG000018373.1 (SMESG000018373.1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 329/332 (99.10%), Postives = 330/332 (99.40%), Query Frame = 2
Query:  101 MSLFDDLPEPXXXX-XXXXXXXXATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI 1093
            MSLFDDLPEPSNLS +SSVLVNSATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFV KIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI
Sbjct:    1 MSLFDDLPEPSNLSCTSSVLVNSATSKRKSETENLTISIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVAKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAFNI 332          
BLAST of Protein phosphatase 2c vs. Planmine SMEST
Match: SMESG000022854.1 (SMESG000022854.1)

HSP 1 Score: 111.694 bits (278), Expect = 2.117e-27
Identity = 92/308 (29.87%), Postives = 141/308 (45.78%), Query Frame = 2
Query:  209 SIKKNHFDCISFKSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQM--FPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRD---GSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKK--------QGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKII--GIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            S + N +   S     S  +G R  M+DAH      T Y+  N   D S       ++GV+DGH G K + +A  NLHK L     + KGD       +       +  +D+  L+        +RD   GST + +L+ +  +Y  N GDS+AV +   +     A+SL+ DH      ER R+   G  V   R+NG L +SR+ GD+ +KK        Q V   PDV      D   F+I+ACDG+W   T Q+ + F+ + I  G++ T    +      +  C  + L    DN+TV+++ F
Sbjct:   11 SKETNQYGNNSLLVSSSCMQGWRIHMEDAH------TGYL--NLPSDKSAS-----YFGVFDGHGGTKVAQYAGNNLHKLLTAQAEYEKGD-------LPEAIRKSFLALDQNMLEDKE-----VRDELAGSTGIIILMKDNNIYCGNAGDSRAVASVGGR-----AVSLSHDHKPSIQAERERIISAGGWVDWNRVNGNLALSRALGDFVFKKNTKRTAEEQIVTANPDVIVKEKNDDYEFIIMACDGIWDVLTNQEVINFIRQRIANGLDPTHICEELMMRCLAPDCQNSGLGC--DNMTVLLICF 286          
BLAST of Protein phosphatase 2c vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 107.842 bits (268), Expect = 1.079e-25
Identity = 87/294 (29.59%), Postives = 139/294 (47.28%), Query Frame = 2
Query:  254 VSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFL-------RDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYK--------KQGVICIPDVKKC-RLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAKRFELACSKLCSEAVLKMSGDNVTVVIVAF 1087
            ++S +G R EM+DAH  I              LS ++    F+ V+DGH G + S   A  L K + +     + ++ +  +     ++   I E FL +  + R  +       + GSTAV VL+    ++ AN GDS+A+L R  K         T DH   +  E+ R+Q  G  V   R+NG+L +SR+ GD++YK        +Q V   P+V    R  + D  L++ACDG+W   T     +F+     I  +D L K     C++     + K S DN+++V+VAF
Sbjct:   26 LASMQGWRIEMEDAHCAI------------TQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVET---EEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGK-----VCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQH--RIRCSDDLMK----ICNETIDTCLYKGSRDNMSIVLVAF 293          
BLAST of Protein phosphatase 2c vs. Planmine SMEST
Match: SMESG000030206.1 (SMESG000030206.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.347e-25
Identity = 74/190 (38.95%), Postives = 101/190 (53.16%), Query Frame = 2
Query:  560 KQRPFLRDGSTAVNVLIINTTL--YIANIGDSKAVLARQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV-RDGRLNGTLEISRSFGDYQYKK--------QGVICIPDVKKCRL-IDTDRFLIIACDGLWKAFTPQQAVEFVGK-IIGIESTDSLAKRFELACSKLCSEAVLKMSG-DNVTVVIVAF 1087
            +  P    GSTAV  LI   TL  Y+AN+GDS+ VL R     N  A+ L+ DH   D  E  R+ K G I+  DGR+NG L +SRS GD+ YKK        Q +   PD++   L    D FL++ACDG+W  F+ QQ VEFV K    + +TD +++ F      L        +G DN+T +I+ F
Sbjct:  254 RNAPGFDSGSTAVLSLINRKTLKVYVANVGDSRCVLCR-----NGEAVDLSIDHKPEDEIESQRIAKAGGILSEDGRVNGGLNLSRSLGDHSYKKNKEIEMKDQMISAFPDIQTIDLKPHEDEFLVLACDGIWNTFSSQQLVEFVSKRTPTMSATDIISEIFSHC---LAPNTSGDGTGCDNMTCIIITF 435          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 2c vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ILKAP2.533e-9248.43ILK associated serine/threonine phosphatase [Sourc... [more]
ILKAP2.074e-6549.76ILK associated serine/threonine phosphatase [Sourc... [more]
ILKAP2.373e-5553.80ILK associated serine/threonine phosphatase [Sourc... [more]
PPM1A3.813e-3031.72protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
PPM1A8.582e-3031.72protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilkp-11.713e-6936.91ILK associated serine/threonine Phosphatase homolo... [more]
ppm-22.052e-2631.35Probable protein phosphatase 2C T23F11.1 [Source:... [more]
ppm-22.052e-2631.35Probable protein phosphatase 2C T23F11.1 [Source:... [more]
ppm-22.052e-2631.35Probable protein phosphatase 2C T23F11.1 [Source:... [more]
ppm-1.A5.134e-2630.30Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alph1.572e-3032.41gene:FBgn0086361 transcript:FBtr0309241[more]
Ppm12.172e-3031.44gene:FBgn0035143 transcript:FBtr0072553[more]
alph5.249e-3032.41gene:FBgn0086361 transcript:FBtr0085442[more]
alph5.249e-3032.41gene:FBgn0086361 transcript:FBtr0085445[more]
alph5.249e-3032.41gene:FBgn0086361 transcript:FBtr0085446[more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilkap3.502e-8742.12integrin-linked kinase-associated serine/threonine... [more]
CR847495.11.312e-3031.16pep chromosome:GRCz11:CHR_ALT_CTG12_1_17:25477050:... [more]
ppm1bb2.717e-3031.51protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Sou... [more]
ppm1bb2.717e-3031.51protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Sou... [more]
ppm1ab2.626e-2929.55protein phosphatase, Mg2+/Mn2+ dependent, 1Ab [Sou... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtp3c1.748e-8641.71receptor (chemosensory) transporter protein 3 gene... [more]
rtp3c6.953e-8242.81receptor (chemosensory) transporter protein 3 gene... [more]
ppm1b7.167e-3332.42protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b8.367e-3332.42protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b1.602e-3232.42protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ilkap9.473e-9248.08integrin-linked kinase-associated serine/threonine... [more]
Ilkap2.692e-5453.59integrin-linked kinase-associated serine/threonine... [more]
Ilkap3.002e-4753.33integrin-linked kinase-associated serine/threonine... [more]
Ppm1b4.736e-3130.95protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b4.736e-3130.95protein phosphatase 1B, magnesium dependent, beta ... [more]
back to top
BLAST of Protein phosphatase 2c vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IIF0|ILKAP_BOVIN1.421e-9248.29Integrin-linked kinase-associated serine/threonine... [more]
sp|Q9H0C8|ILKAP_HUMAN1.216e-9148.43Integrin-linked kinase-associated serine/threonine... [more]
sp|Q8R0F6|ILKAP_MOUSE6.626e-9148.08Integrin-linked kinase-associated serine/threonine... [more]
sp|Q9Z1Z6|ILKAP_RAT7.543e-9147.92Integrin-linked kinase-associated serine/threonine... [more]
sp|Q0J2R1|P2C67_ORYSJ2.634e-4435.02Probable protein phosphatase 2C 67 OS=Oryza sativa... [more]
back to top
BLAST of Protein phosphatase 2c vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M1L25.264e-10045.53PPM-type phosphatase domain-containing protein OS=... [more]
C1L6A92.355e-9744.32Integrin-linked kinase-associated serine/threonine... [more]
Q86F002.921e-9744.32Clone ZZD1250 mRNA sequence OS=Schistosoma japonic... [more]
A0A5K4F0L31.308e-9644.66Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A419PZM62.200e-9643.26Integrin-linked kinase-associated serine/threonine... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilkap8.344e-7643.20integrin-linked kinase-associated serine/threonine... [more]
ppm1ab8.319e-3228.72protein phosphatase 1A [Source:NCBI gene;Acc:10303... [more]
ppm1bb1.047e-3131.72protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1bb1.120e-3131.72protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1bb4.856e-3132.07protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003550.12.312e-3229.74pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ppm1aa3.165e-3231.49protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ENSPMAT00000003549.11.150e-3129.64pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ppm1e3.231e-2627.82protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1e7.524e-2628.99protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PTC21.763e-2728.39Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC12.776e-2628.38Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC35.316e-2429.81Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC42.645e-2025.92Cytoplasmic type 2C protein phosphatase (PP2C); id... [more]
PTC56.883e-1324.60Mitochondrial type 2C protein phosphatase (PP2C); ... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO396034.379e-8944.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441371.131e-3131.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314906.294e-3127.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360402.015e-2829.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404494.062e-2832.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 2c vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilkap5.163e-8641.67ILK associated serine/threonine phosphatase [Sourc... [more]
ppm1e5.616e-3231.34protein phosphatase, Mg2+/Mn2+ dependent 1E [Sourc... [more]
ENSORLT00000039194.18.432e-3130.90protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000012921.23.518e-3031.25protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ppm1aa2.047e-2930.82protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
back to top
BLAST of Protein phosphatase 2c vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018373.10.000e+099.70SMESG000018373.1[more]
SMESG000018373.10.000e+099.10SMESG000018373.1[more]
SMESG000022854.12.117e-2729.87SMESG000022854.1[more]
SMESG000032910.11.079e-2529.59SMESG000032910.1[more]
SMESG000030206.11.347e-2538.95SMESG000030206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025041 ID=SMED30025041|Name=Protein phosphatase 2c|organism=Schmidtea mediterranea sexual|type=transcript|length=1272bp
TTTAAATATTGAATTTTATAAATTTTAATTAAAATTTTTGAAAAGTTCAT
TAACATAAATAGAATTATTAAAAATCATTTTATTTAATTTTGAAATCTAA
ATGAGTTTATTTGATGATTTACCGGAACCGTCTAATTTGTCATCATCTTC
TGTATTAGTAAATTCTGCTACAAGTAAACGGAAATCAGAAACAGAAAATT
TAACAATTTCAATAAAGAAAAATCATTTTGATTGCATCTCATTTAAGTCT
TTTGTTTCCTCCAGAAAAGGTGAAAGGGATGAAATGCAAGATGCACATAT
CCTAATTGATGATTTCACTGAATACATCAAGAAAAACTTTAAATTAGACC
TCTCAGATGATGTTATTCACAATGGATTTTATGGAGTTTATGATGGACAC
AATGGTTGCAAAGCGTCGATTTTTGCAGCTGAAAACTTACACAAATATTT
AGCACAAATGTTTCCCAAAGGAGATTGTGAATCTTTTGAATTAAATGTCA
AACGGATATTTACGGATGTATATAAAAAAATCGACGAGGAATTTTTAAAA
ATTGCATCCAAGCAAAGGCCATTCCTTAGAGATGGGTCGACAGCAGTAAA
TGTATTGATCATTAATACCACGCTCTACATCGCTAACATCGGTGACTCTA
AAGCGGTTTTAGCAAGACAAAGCAAAGAAAACAATTTGACCGCTATTTCG
TTAACTAAAGATCACACAGCAATTGATTATGAAGAAAGGCTTCGGTTGCA
GAAACACGGCTCGATCGTAAGGGATGGTCGGTTAAATGGAACTTTGGAGA
TCTCGAGATCGTTTGGAGATTACCAGTATAAGAAACAGGGCGTCATATGC
ATTCCCGATGTTAAGAAATGCCGCCTCATTGACACGGATAGATTTCTGAT
CATCGCATGCGACGGACTCTGGAAAGCATTTACTCCTCAGCAGGCCGTTG
AGTTTGTGGGGAAAATTATCGGCATTGAATCAACCGATTCATTGGCTAAG
CGATTCGAATTGGCGTGCAGCAAACTATGCAGCGAGGCCGTCCTGAAAAT
GAGTGGCGACAATGTTACAGTGGTCATTGTTGCTTTTAATATATGAATAT
ATTTCTGTTTAAGACTTTGTTTATTTGACTTTCTCTTTCTCTGTGTGTGT
GTGTGTGTGTAGATATTATATCCCTCTGACTACCGCTCTATTCGGGAAGA
AGAATGCAAATATAATCATGTACCGTTTATCAGAGTTTGGCCGTTTGAGC
ATCAATTTTGATTACTGATTAT
back to top

protein sequence of SMED30025041-orf-1

>SMED30025041-orf-1 ID=SMED30025041-orf-1|Name=SMED30025041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MSLFDDLPEPSNLSSSSVLVNSATSKRKSETENLTISIKKNHFDCISFKS
FVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHNGFYGVYDGH
NGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLK
IASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLARQSKENNLTAIS
LTKDHTAIDYEERLRLQKHGSIVRDGRLNGTLEISRSFGDYQYKKQGVIC
IPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVGKIIGIESTDSLAK
RFELACSKLCSEAVLKMSGDNVTVVIVAFNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036457PPM-type_dom_sf
IPR015655PP2C
IPR001932PPM-type_phosphatase_dom
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004721phosphoprotein phosphatase activity
GO:0004722protein serine/threonine phosphatase activity
GO:0016301kinase activity
GO:0016787hydrolase activity
GO:0043169cation binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0007229integrin-mediated signaling pathway
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001932PPM-type phosphatase domainSMARTSM00332PP2C_4coord: 42..327
e-value: 2.6E-75
score: 266.2
IPR001932PPM-type phosphatase domainPFAMPF00481PP2Ccoord: 52..322
e-value: 1.3E-53
score: 182.3
IPR001932PPM-type phosphatase domainPROSITEPS51746PPM_2coord: 48..329
score: 44.29
IPR001932PPM-type phosphatase domainCDDcd00143PP2Cccoord: 48..329
e-value: 7.01107E-78
score: 236.839
IPR036457PPM-type phosphatase domain superfamilyGENE3DG3DSA:3.60.40.10coord: 45..331
e-value: 2.1E-76
score: 259.2
IPR036457PPM-type phosphatase domain superfamilySUPERFAMILYSSF81606PP2C-likecoord: 38..330
NoneNo IPR availablePANTHERPTHR13832:SF348INTEGRIN-LINKED KINASE-ASSOCIATED SERINE/THREONINE PHOSPHATASE 2Ccoord: 20..329
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 20..329