dachshund

Overview
Namedachshund (AFC87777.1)
Smed IDSMED30025028
Length (bp)1719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dachshund (SMED30025028) t-SNE clustered cells

Violin plots show distribution of expression levels for dachshund (SMED30025028) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dachshund (SMED30025028) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dachshund (SMED30025028) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025028

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cilated neuronSMED30025028h1SMcG0003893 dd_Smed_v4_14598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025028h1SMcG0003893 JN983825.1smed_ncbi_20240424PMID:21852957
Lapan et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dachshund vs. Ensembl Human
Match: DACH1 (dachshund family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:2663])

HSP 1 Score: 209.92 bits (533), Expect = 1.981e-60
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  170 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 292          
BLAST of dachshund vs. Ensembl Human
Match: DACH1 (dachshund family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:2663])

HSP 1 Score: 210.69 bits (535), Expect = 3.254e-60
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  170 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 292          
BLAST of dachshund vs. Ensembl Human
Match: DACH1 (dachshund family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:2663])

HSP 1 Score: 211.846 bits (538), Expect = 1.477e-59
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  170 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 292          
BLAST of dachshund vs. Ensembl Human
Match: DACH1 (dachshund family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:2663])

HSP 1 Score: 212.231 bits (539), Expect = 1.981e-59
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  170 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 292          
BLAST of dachshund vs. Ensembl Human
Match: DACH2 (dachshund family transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:16814])

HSP 1 Score: 174.866 bits (442), Expect = 4.729e-47
Identity = 76/104 (73.08%), Postives = 91/104 (87.50%), Query Frame = 2
Query:  140 LIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
            ++D    K+A+F ++G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVRILRGLGAIQPGVNRCKLI  K+F+ LF DCTN+S+RPGRP KR+
Sbjct:   70 MVDMHGMKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNASSRPGRPPKRS 173          
BLAST of dachshund vs. Ensembl Celegans
Match: dac-1 (DAChsund transcription factor homolog [Source:UniProtKB/TrEMBL;Acc:Q86GT3])

HSP 1 Score: 159.073 bits (401), Expect = 5.951e-43
Identity = 69/109 (63.30%), Postives = 88/109 (80.73%), Query Frame = 2
Query:  125 NNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
            N    LI +R   +AAF + G+++ICLPQ +E+FLK++VGGLHTVYTKLKRL I P+VCNVEQVR LR LGAIQPGVNRCKL+   +F+ L++DCT++  RPGRPSKR+
Sbjct:   81 NVAAKLIKFRGHNVAAFDINGKEMICLPQVYEVFLKNMVGGLHTVYTKLKRLYIHPMVCNVEQVRALRSLGAIQPGVNRCKLLKTSDFEKLYDDCTSTCTRPGRPSKRS 189          
BLAST of dachshund vs. Ensembl Celegans
Match: dac-1 (DAChsund transcription factor homolog [Source:UniProtKB/TrEMBL;Acc:Q86GT3])

HSP 1 Score: 143.28 bits (360), Expect = 3.721e-38
Identity = 61/86 (70.93%), Postives = 75/86 (87.21%), Query Frame = 2
Query:  194 LICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
            +ICLPQ +E+FLK++VGGLHTVYTKLKRL I P+VCNVEQVR LR LGAIQPGVNRCKL+   +F+ L++DCT++  RPGRPSKR+
Sbjct:    1 MICLPQVYEVFLKNMVGGLHTVYTKLKRLYIHPMVCNVEQVRALRSLGAIQPGVNRCKLLKTSDFEKLYDDCTSTCTRPGRPSKRS 86          
BLAST of dachshund vs. Ensembl Fly
Match: dac (gene:FBgn0005677 transcript:FBtr0080877)

HSP 1 Score: 190.66 bits (483), Expect = 2.965e-51
Identity = 89/150 (59.33%), Postives = 112/150 (74.67%), Query Frame = 2
Query:   11 FIN*LQLTKMDSPMISLSPNNQTKP--VYCTPNPVP-NIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
             +N LQ+    SP+  ++  +   P   Y +P P+  + P  N+  L++YR  K+AAF +    ++CLPQAFELFLKHLVGGLHTVYTKLKRL+IVP+VCNVEQVRILRGLGAIQPGVNRCKL+  K+FDIL+ DCT +S+RPGRP KR 
Sbjct:  173 LLNSLQMMHHASPLELMAAAHHHVPPRSYNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKHLVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKDFDILYRDCTTASSRPGRPPKRG 322          
BLAST of dachshund vs. Ensembl Fly
Match: dac (gene:FBgn0005677 transcript:FBtr0100400)

HSP 1 Score: 185.652 bits (470), Expect = 1.338e-49
Identity = 89/150 (59.33%), Postives = 111/150 (74.00%), Query Frame = 2
Query:   11 FIN*LQLTKMDSPMISLSPNNQTKP--VYCTPNPVP-NIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
             +N LQ+    SP+  ++  +   P   Y +P P+  + P  N+  L++YR  K+AAF +    ++CLPQAFELFLKHLVGGLHTVYTKLKRL+IVP+VCNVEQVRILRGLGAIQPGVNRCKL+  K+FDIL+ DCT  +ARPGRP KR 
Sbjct:  173 LLNSLQMMHHASPLELMAAAHHHVPPRSYNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKHLVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKDFDILYRDCT--TARPGRPPKRG 320          
BLAST of dachshund vs. Ensembl Fly
Match: dac (gene:FBgn0005677 transcript:FBtr0080875)

HSP 1 Score: 183.341 bits (464), Expect = 6.883e-49
Identity = 89/157 (56.69%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   11 FIN*LQLTKMDSPMISLSPNNQTKP--VYCTPNPVP-NIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNS-------SARPGRPSKRA 451
             +N LQ+    SP+  ++  +   P   Y +P P+  + P  N+  L++YR  K+AAF +    ++CLPQAFELFLKHLVGGLHTVYTKLKRL+IVP+VCNVEQVRILRGLGAIQPGVNRCKL+  K+FDIL+ DCT +       S+RPGRP KR 
Sbjct:  173 LLNSLQMMHHASPLELMAAAHHHVPPRSYNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKHLVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKDFDILYRDCTTASNSLQFRSSRPGRPPKRG 329          
BLAST of dachshund vs. Ensembl Fly
Match: dac (gene:FBgn0005677 transcript:FBtr0080878)

HSP 1 Score: 182.57 bits (462), Expect = 1.483e-48
Identity = 89/159 (55.97%), Postives = 112/159 (70.44%), Query Frame = 2
Query:   11 FIN*LQLTKMDSPMISLSPNNQTKP--VYCTPNPVP-NIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNS---------SARPGRPSKRA 451
             +N LQ+    SP+  ++  +   P   Y +P P+  + P  N+  L++YR  K+AAF +    ++CLPQAFELFLKHLVGGLHTVYTKLKRL+IVP+VCNVEQVRILRGLGAIQPGVNRCKL+  K+FDIL+ DCT +         S+RPGRP KR 
Sbjct:  173 LLNSLQMMHHASPLELMAAAHHHVPPRSYNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKHLVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKDFDILYRDCTTARCLSIKPPESSRPGRPPKRG 331          
BLAST of dachshund vs. Ensembl Fly
Match: dac (gene:FBgn0005677 transcript:FBtr0100399)

HSP 1 Score: 180.644 bits (457), Expect = 5.506e-48
Identity = 88/157 (56.05%), Postives = 110/157 (70.06%), Query Frame = 2
Query:   11 FIN*LQLTKMDSPMISLSPNNQTKP--VYCTPNPVP-NIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSA-------RPGRPSKRA 451
             +N LQ+    SP+  ++  +   P   Y +P P+  + P  N+  L++YR  K+AAF +    ++CLPQAFELFLKHLVGGLHTVYTKLKRL+IVP+VCNVEQVRILRGLGAIQPGVNRCKL+  K+FDIL+ DCT +         RPGRP KR 
Sbjct:  173 LLNSLQMMHHASPLELMAAAHHHVPPRSYNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKHLVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKDFDILYRDCTTARCLSIKPPERPGRPPKRG 329          
BLAST of dachshund vs. Ensembl Zebrafish
Match: dachc (dachshund c [Source:ZFIN;Acc:ZDB-GENE-020402-5])

HSP 1 Score: 211.46 bits (537), Expect = 1.678e-60
Identity = 93/123 (75.61%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  +++ R AK+A+FTV G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F++L+ DCTN+S+RPGRP KR
Sbjct:   55 KPVYSTPSPVENTPQNNECKMVEVRGAKLASFTVNGNELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFEVLYNDCTNASSRPGRPPKR 177          
BLAST of dachshund vs. Ensembl Zebrafish
Match: dachc (dachshund c [Source:ZFIN;Acc:ZDB-GENE-020402-5])

HSP 1 Score: 211.075 bits (536), Expect = 2.425e-60
Identity = 93/123 (75.61%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  +++ R AK+A+FTV G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F++L+ DCTN+S+RPGRP KR
Sbjct:   70 KPVYSTPSPVENTPQNNECKMVEVRGAKLASFTVNGNELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFEVLYNDCTNASSRPGRPPKR 192          
BLAST of dachshund vs. Ensembl Zebrafish
Match: dachc (dachshund c [Source:ZFIN;Acc:ZDB-GENE-020402-5])

HSP 1 Score: 210.305 bits (534), Expect = 4.677e-60
Identity = 93/123 (75.61%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  +++ R AK+A+FTV G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F++L+ DCTN+S+RPGRP KR
Sbjct:   55 KPVYSTPSPVENTPQNNECKMVEVRGAKLASFTVNGNELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFEVLYNDCTNASSRPGRPPKR 177          
BLAST of dachshund vs. Ensembl Zebrafish
Match: dachd (dachshund d [Source:ZFIN;Acc:ZDB-GENE-070427-2])

HSP 1 Score: 211.075 bits (536), Expect = 4.714e-60
Identity = 93/123 (75.61%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  +++ R AK+A+FTV+G++LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   77 KPVYSTPSPVENTPQNNECRMVELRGAKVASFTVDGQELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 199          
BLAST of dachshund vs. Ensembl Zebrafish
Match: dachb (dachshund b [Source:ZFIN;Acc:ZDB-GENE-020402-4])

HSP 1 Score: 174.866 bits (442), Expect = 6.749e-51
Identity = 80/133 (60.15%), Postives = 104/133 (78.20%), Query Frame = 2
Query:   74 QTKPVYCTPNPVPNI-------PENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
            +T+P + +P   P I          N+  +++    K+A+F+V+G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVR+LRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR+
Sbjct:   25 RTEPFFSSPAEAPRIINSLPSGGTTNECKIVEVHGVKVASFSVDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDINPVVCTVEQVRVLRGLGAIQPGVNRCKLISRKDFEALYNDCTNASSRPGRPPKRS 157          
BLAST of dachshund vs. Ensembl Xenopus
Match: vps35 (VPS35 retromer complex component [Source:Xenbase;Acc:XB-GENE-941152])

HSP 1 Score: 214.542 bits (545), Expect = 1.062e-61
Identity = 95/123 (77.24%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV NIP+NN+  ++D R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   26 KPVYSTPSPVENIPQNNECRMVDLRGAKVASFTVDGSELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 148          
BLAST of dachshund vs. Ensembl Xenopus
Match: vps35 (VPS35 retromer complex component [Source:Xenbase;Acc:XB-GENE-941152])

HSP 1 Score: 213.772 bits (543), Expect = 8.349e-61
Identity = 95/123 (77.24%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV NIP+NN+  ++D R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  156 KPVYSTPSPVENIPQNNECRMVDLRGAKVASFTVDGSELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 278          
BLAST of dachshund vs. Ensembl Xenopus
Match: vps35 (VPS35 retromer complex component [Source:Xenbase;Acc:XB-GENE-941152])

HSP 1 Score: 214.542 bits (545), Expect = 1.250e-60
Identity = 95/123 (77.24%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV NIP+NN+  ++D R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  156 KPVYSTPSPVENIPQNNECRMVDLRGAKVASFTVDGSELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 278          
BLAST of dachshund vs. Ensembl Xenopus
Match: vps35 (VPS35 retromer complex component [Source:Xenbase;Acc:XB-GENE-941152])

HSP 1 Score: 214.542 bits (545), Expect = 1.356e-60
Identity = 95/123 (77.24%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV NIP+NN+  ++D R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  156 KPVYSTPSPVENIPQNNECRMVDLRGAKVASFTVDGSELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 278          
BLAST of dachshund vs. Ensembl Xenopus
Match: vps35 (VPS35 retromer complex component [Source:Xenbase;Acc:XB-GENE-941152])

HSP 1 Score: 215.312 bits (547), Expect = 1.488e-60
Identity = 95/123 (77.24%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV NIP+NN+  ++D R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  156 KPVYSTPSPVENIPQNNECRMVDLRGAKVASFTVDGSELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 278          
BLAST of dachshund vs. Ensembl Mouse
Match: Dach1 (dachshund family transcription factor 1 [Source:MGI Symbol;Acc:MGI:1277991])

HSP 1 Score: 211.46 bits (537), Expect = 1.265e-59
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  163 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 285          
BLAST of dachshund vs. Ensembl Mouse
Match: Dach1 (dachshund family transcription factor 1 [Source:MGI Symbol;Acc:MGI:1277991])

HSP 1 Score: 211.846 bits (538), Expect = 2.292e-59
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  163 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 285          
BLAST of dachshund vs. Ensembl Mouse
Match: Dach2 (dachshund family transcription factor 2 [Source:MGI Symbol;Acc:MGI:1890446])

HSP 1 Score: 176.792 bits (447), Expect = 1.053e-47
Identity = 77/108 (71.30%), Postives = 93/108 (86.11%), Query Frame = 2
Query:  128 NQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA 451
            N+  ++D    K+A+F ++G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVRILRGLGAIQPGVNRCKLI  K+F+ LF DCTN+S+RPGRP KR+
Sbjct:   73 NECRMVDMHGVKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNASSRPGRPPKRS 180          
BLAST of dachshund vs. Ensembl Mouse
Match: Dach2 (dachshund family transcription factor 2 [Source:MGI Symbol;Acc:MGI:1890446])

HSP 1 Score: 167.548 bits (423), Expect = 3.515e-44
Identity = 77/121 (63.64%), Postives = 93/121 (76.86%), Query Frame = 2
Query:  128 NQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNS-------------SARPGRPSKRA 451
            N+  ++D    K+A+F ++G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVRILRGLGAIQPGVNRCKLI  K+F+ LF DCTN+             S+RPGRP KR+
Sbjct:   73 NECRMVDMHGVKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNARRKRQMTRKQAVNSSRPGRPPKRS 193          
BLAST of dachshund vs. UniProt/SwissProt
Match: sp|Q9UI36|DACH1_HUMAN (Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4)

HSP 1 Score: 212.231 bits (539), Expect = 9.515e-59
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  170 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 292          
BLAST of dachshund vs. UniProt/SwissProt
Match: sp|Q9QYB2|DACH1_MOUSE (Dachshund homolog 1 OS=Mus musculus OX=10090 GN=Dach1 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.603e-58
Identity = 95/123 (77.24%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV N P+NN+  ++D R AK+A+FTVEG +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:  163 KPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 285          
BLAST of dachshund vs. UniProt/SwissProt
Match: sp|Q925Q8|DACH2_MOUSE (Dachshund homolog 2 OS=Mus musculus OX=10090 GN=Dach2 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.459e-43
Identity = 77/121 (63.64%), Postives = 93/121 (76.86%), Query Frame = 2
Query:  128 NQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNS-------------SARPGRPSKRA 451
            N+  ++D    K+A+F ++G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVRILRGLGAIQPGVNRCKLI  K+F+ LF DCTN+             S+RPGRP KR+
Sbjct:   73 NECRMVDMHGVKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNARRKRQMTRKQAVNSSRPGRPPKRS 193          
BLAST of dachshund vs. UniProt/SwissProt
Match: sp|Q96NX9|DACH2_HUMAN (Dachshund homolog 2 OS=Homo sapiens OX=9606 GN=DACH2 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 8.765e-43
Identity = 76/117 (64.96%), Postives = 91/117 (77.78%), Query Frame = 2
Query:  140 LIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNS-------------SARPGRPSKRA 451
            ++D    K+A+F ++G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVRILRGLGAIQPGVNRCKLI  K+F+ LF DCTN+             S+RPGRP KR+
Sbjct:   70 MVDMHGMKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNARRKRQMTRKQAVNSSRPGRPPKRS 186          
BLAST of dachshund vs. TrEMBL
Match: H9B8J2 (Dachshund OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 530/530 (100.00%), Postives = 530/530 (100.00%), Query Frame = 2
Query:   38 MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDPNLNNSKSYSKITTPSALTSHSKSLSDSNTNANNQFEFNSIKTNFDEKVITSKSNGNANLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANEXXXXXXXXXXXXXXPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECXXXXXXXXXXXLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSLNNSQLSHSRLKLFSPSNNLQDLSAKPIIKS 1627
            MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDPNLNNSKSYSKITTPSALTSHSKSLSDSNTNANNQFEFNSIKTNFDEKVITSKSNGNANLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANENITNITSSSTASTSPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECSNSSFSNIINSLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSLNNSQLSHSRLKLFSPSNNLQDLSAKPIIKS
Sbjct:    1 MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDPNLNNSKSYSKITTPSALTSHSKSLSDSNTNANNQFEFNSIKTNFDEKVITSKSNGNANLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANENITNITSSSTASTSPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECSNSSFSNIINSLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSLNNSQLSHSRLKLFSPSNNLQDLSAKPIIKS 530          
BLAST of dachshund vs. TrEMBL
Match: T1DBP2 (Dach OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 4.113e-158
Identity = 248/445 (55.73%), Postives = 316/445 (71.01%), Query Frame = 2
Query:   38 MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDPNLNNSKSYSKI---------------TTPSALTSHSKSLSDSNTN--ANNQ----FEFNSIKTNFDEKVITSKSNGNANLTN-KSSLETTP--NKQSKTTMFTVDNLVFEGRSESHNE-VNMNSPPANEXXXXXXXXXXXXXXPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQ 1297
            MDSPMISLSPNNQ+KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRA+L+P D+N+SE++KRAHY+ VNDCVKS +++ +S+RL YDD+KR +LRN++ Q G CPI P N GFNS+LPFGM+  ++ LFP+NQ+++KQ  NLP+ +R+  K+P++ +  ++S++                  + L S S S   SN N   NN+    F+ +    NF++   ++  +  + L N KS  +  P  N + K T+F++D+LV     E H    N +SP  ++   +I          +    ++ N    +E++ +R+ +Q+QMK  NDE+   NFY+PLREFW  N N K N 
Sbjct:    1 MDSPMISLSPNNQSKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRASLMPNDINISETMKRAHYDFVNDCVKSNDNLGTSFRLPYDDDKRFYLRNAIPQSGICPINPANFGFNSILPFGMSSYMMGLFPNNQALIKQLSNLPTISRMSNKEPSMLSKTTHSRMNNSFLNTSFIKYPNDVNQTHLFSPSTSHKSSNENIFCNNKTSEGFDNSFPMKNFEDGEFSTIFSSASTLNNIKSEQKEIPLINIKPKKTIFSIDSLV----EEIHERPTNFSSPLKDDYSASIYG--------ETIETDKCNFINNKERDIIRILMQNQMKTINDERSLHNFYEPLREFWLANSNGKSNH 433          
BLAST of dachshund vs. TrEMBL
Match: H6V055 (Dachshund (Fragment) OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 3.148e-71
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 2
Query:   56 SLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFD 391
            SLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFD
Sbjct:    1 SLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFD 112          
BLAST of dachshund vs. TrEMBL
Match: G4V5D7 (Putative dachshund homolog OS=Schistosoma mansoni OX=6183 GN=Smp_196410 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 2.490e-66
Identity = 103/121 (85.12%), Postives = 112/121 (92.56%), Query Frame = 2
Query:   86 VYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
             YCTPNPVPN+PENNQV  ++YR A +A FTV GR LICLPQAFELFLKHLVGGLHTVYTKLKRL+I+PVVCNVEQVRILRGLGAIQPGVNRCKLIAP+EFDIL+ DCTNSS+RPGRPSKR
Sbjct:   31 AYCTPNPVPNLPENNQVHFLEYRGAHLATFTVNGRDLICLPQAFELFLKHLVGGLHTVYTKLKRLDIIPVVCNVEQVRILRGLGAIQPGVNRCKLIAPQEFDILYADCTNSSSRPGRPSKR 151          
BLAST of dachshund vs. TrEMBL
Match: A0A504YJX8 (Dachshund protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_01434 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.047e-65
Identity = 110/139 (79.14%), Postives = 122/139 (87.77%), Query Frame = 2
Query:   56 SLSPNNQTKPV--------YCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            + S N+ T+PV        YCTPNPVPN+PENNQV L++YR A++AAF V+GR L+CLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAP EFD+L+ DCTNSSARPGRPSKR
Sbjct:   78 TFSNNSCTRPVSSMSKPLAYCTPNPVPNLPENNQVHLLEYRGAQLAAFKVDGRDLVCLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPHEFDVLYADCTNSSARPGRPSKR 216          
BLAST of dachshund vs. Ensembl Cavefish
Match: dachc (dachshund homolog 1-like [Source:NCBI gene;Acc:103031289])

HSP 1 Score: 216.468 bits (550), Expect = 1.452e-62
Identity = 94/123 (76.42%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KP YCTP+PV N P+NN+  +++ R AK+A+FTV GR+LICLPQAFELFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVR+LRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   52 KPAYCTPSPVENTPQNNECRMVEVRGAKLASFTVSGRELICLPQAFELFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRVLRGLGAIQPGVNRCKLISKKDFETLYNDCTNASSRPGRPPKR 174          
BLAST of dachshund vs. Ensembl Cavefish
Match: dachc (dachshund homolog 1-like [Source:NCBI gene;Acc:103031289])

HSP 1 Score: 216.083 bits (549), Expect = 2.694e-62
Identity = 94/123 (76.42%), Postives = 110/123 (89.43%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KP YCTP+PV N P+NN+  +++ R AK+A+FTV GR+LICLPQAFELFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVR+LRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   52 KPAYCTPSPVENTPQNNECRMVEVRGAKLASFTVSGRELICLPQAFELFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRVLRGLGAIQPGVNRCKLISKKDFETLYNDCTNASSRPGRPPKR 174          
BLAST of dachshund vs. Ensembl Cavefish
Match: dachd (dachshund homolog 1 [Source:NCBI gene;Acc:103025174])

HSP 1 Score: 208.764 bits (530), Expect = 8.479e-60
Identity = 93/124 (75.00%), Postives = 110/124 (88.71%), Query Frame = 2
Query:   77 TKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
             KPVY TP+PV N P+NN+  +++ R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   63 AKPVYSTPSPVENTPQNNECKMVELRGAKVASFTVDGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 186          
BLAST of dachshund vs. Ensembl Cavefish
Match: dachd (dachshund homolog 1 [Source:NCBI gene;Acc:103025174])

HSP 1 Score: 209.149 bits (531), Expect = 1.553e-59
Identity = 93/124 (75.00%), Postives = 110/124 (88.71%), Query Frame = 2
Query:   77 TKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
             KPVY TP+PV N P+NN+  +++ R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   63 AKPVYSTPSPVENTPQNNECKMVELRGAKVASFTVDGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 186          
BLAST of dachshund vs. Ensembl Cavefish
Match: dachd (dachshund homolog 1 [Source:NCBI gene;Acc:103025174])

HSP 1 Score: 207.994 bits (528), Expect = 2.050e-59
Identity = 93/124 (75.00%), Postives = 110/124 (88.71%), Query Frame = 2
Query:   77 TKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
             KPVY TP+PV N P+NN+  +++ R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   63 AKPVYSTPSPVENTPQNNECKMVELRGAKVASFTVDGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 186          
BLAST of dachshund vs. Ensembl Nematostella
Match: EDO40468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S748])

HSP 1 Score: 109.768 bits (273), Expect = 5.327e-29
Identity = 49/82 (59.76%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  164 IAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDC 409
            IAAF V+G  L+C PQ +E FLK LV G+HTVYTKLKR+ I    CNVEQVR++R +GAI   VNRCKLI+ ++F+ ++EDC
Sbjct:   10 IAAFNVDGEDLLCFPQVYEYFLKDLVSGMHTVYTKLKRMNIQGRNCNVEQVRMMRSVGAIGQVVNRCKLISKEDFNKIYEDC 91          
BLAST of dachshund vs. Ensembl Medaka
Match: dach (dachshund protein [Source:NCBI gene;Acc:100049531])

HSP 1 Score: 211.46 bits (537), Expect = 6.185e-61
Identity = 94/123 (76.42%), Postives = 111/123 (90.24%), Query Frame = 2
Query:   80 KPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            KPVY TP+PV NIP+NN+  +++ R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   15 KPVYSTPSPVENIPQNNECKMVELRGAKVASFTVDGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 137          
BLAST of dachshund vs. Ensembl Medaka
Match: dach (dachshund protein [Source:NCBI gene;Acc:100049531])

HSP 1 Score: 213.001 bits (541), Expect = 1.022e-60
Identity = 98/141 (69.50%), Postives = 118/141 (83.69%), Query Frame = 2
Query:   26 QLTKMDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
            +L    SP I  +    +KPVY TP+PV NIP+NN+  +++ R AK+A+FTV+G +LICLPQAF+LFLKHLVGGLHTVYTKLKRLEI PVVCNVEQVRILRGLGAIQPGVNRCKLI+ K+F+ L+ DCTN+S+RPGRP KR
Sbjct:   53 ELLATGSPGIPTAALPPSKPVYSTPSPVENIPQNNECKMVELRGAKVASFTVDGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKR 193          
BLAST of dachshund vs. Ensembl Medaka
Match: DACH1 (dachshund homolog 1 [Source:NCBI gene;Acc:101166329])

HSP 1 Score: 202.216 bits (513), Expect = 7.128e-57
Identity = 87/124 (70.16%), Postives = 109/124 (87.90%), Query Frame = 2
Query:   77 TKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
             KPVY T +PV + P+NN+  L++ + AK+A+FTV+ R+LICLPQAF++FLKHLVGGLHTVYTKLKRL+I PVVCNVEQVR+LRGLGAIQPGVNRCKLI+ ++F+ L+ DCTN+S+RPGRP KR
Sbjct:   81 AKPVYATASPVESTPQNNECKLVEVKGAKLASFTVKDRELICLPQAFDVFLKHLVGGLHTVYTKLKRLDITPVVCNVEQVRVLRGLGAIQPGVNRCKLISRQDFETLYNDCTNASSRPGRPPKR 204          
BLAST of dachshund vs. Ensembl Medaka
Match: ENSORLT00000044554.1 (dachshund homolog 2 [Source:NCBI gene;Acc:105356347])

HSP 1 Score: 175.252 bits (443), Expect = 4.836e-47
Identity = 74/108 (68.52%), Postives = 95/108 (87.96%), Query Frame = 2
Query:  125 NNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKR 448
             ++  L++    K+A+F+V+G++LICLPQ F+LFLKHLVGGLHTVYTKLKRL+I PVVC VEQVR+LRGLGAIQPGVNRCKLI+ K+F+ L++DCT++S+RPGRP KR
Sbjct:  103 GSECKLVEVHGVKVASFSVDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDITPVVCTVEQVRVLRGLGAIQPGVNRCKLISRKDFETLYQDCTSASSRPGRPPKR 210          
BLAST of dachshund vs. Planmine SMEST
Match: SMESG000013159.1 (SMESG000013159.1)

HSP 1 Score: 1015.37 bits (2624), Expect = 0.000e+0
Identity = 527/530 (99.43%), Postives = 527/530 (99.43%), Query Frame = 2
Query:   38 MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDPNLNNSKSYSKITTPSALTSHSKSLSDSNTNANNQFEFNSIKTNFDEKVITSKSNGNANLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANEXXXXXXXXXXXXXXPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECXXXXXXXXXXXLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSLNNSQLSHSRLKLFSPSNNLQDLSAKPIIKS 1627
            MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKD NLNNSKSYSKITTPSALTSHSKSLSDSNTNAN QFEFNSIKTNFDEKVITSKSNGN NLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANENITNITSSSTASTSPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECSNSSFSNIINSLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSLNNSQLSHSRLKLFSPSNNLQDLSAKPIIKS
Sbjct:    1 MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEGRQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLGAIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSESIKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPPNLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDSNLNNSKSYSKITTPSALTSHSKSLSDSNTNANIQFEFNSIKTNFDEKVITSKSNGNVNLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANENITNITSSSTASTSPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQNFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECSNSSFSNIINSLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSLNNSQLSHSRLKLFSPSNNLQDLSAKPIIKS 530          
The following BLAST results are available for this feature:
BLAST of dachshund vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DACH11.981e-6077.24dachshund family transcription factor 1 [Source:HG... [more]
DACH13.254e-6077.24dachshund family transcription factor 1 [Source:HG... [more]
DACH11.477e-5977.24dachshund family transcription factor 1 [Source:HG... [more]
DACH11.981e-5977.24dachshund family transcription factor 1 [Source:HG... [more]
DACH24.729e-4773.08dachshund family transcription factor 2 [Source:HG... [more]
back to top
BLAST of dachshund vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dac-15.951e-4363.30DAChsund transcription factor homolog [Source:Uni... [more]
dac-13.721e-3870.93DAChsund transcription factor homolog [Source:Uni... [more]
back to top
BLAST of dachshund vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dac2.965e-5159.33gene:FBgn0005677 transcript:FBtr0080877[more]
dac1.338e-4959.33gene:FBgn0005677 transcript:FBtr0100400[more]
dac6.883e-4956.69gene:FBgn0005677 transcript:FBtr0080875[more]
dac1.483e-4855.97gene:FBgn0005677 transcript:FBtr0080878[more]
dac5.506e-4856.05gene:FBgn0005677 transcript:FBtr0100399[more]
back to top
BLAST of dachshund vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dachc1.678e-6075.61dachshund c [Source:ZFIN;Acc:ZDB-GENE-020402-5][more]
dachc2.425e-6075.61dachshund c [Source:ZFIN;Acc:ZDB-GENE-020402-5][more]
dachc4.677e-6075.61dachshund c [Source:ZFIN;Acc:ZDB-GENE-020402-5][more]
dachd4.714e-6075.61dachshund d [Source:ZFIN;Acc:ZDB-GENE-070427-2][more]
dachb6.749e-5160.15dachshund b [Source:ZFIN;Acc:ZDB-GENE-020402-4][more]
back to top
BLAST of dachshund vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps351.062e-6177.24VPS35 retromer complex component [Source:Xenbase;A... [more]
vps358.349e-6177.24VPS35 retromer complex component [Source:Xenbase;A... [more]
vps351.250e-6077.24VPS35 retromer complex component [Source:Xenbase;A... [more]
vps351.356e-6077.24VPS35 retromer complex component [Source:Xenbase;A... [more]
vps351.488e-6077.24VPS35 retromer complex component [Source:Xenbase;A... [more]
back to top
BLAST of dachshund vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dach11.265e-5977.24dachshund family transcription factor 1 [Source:MG... [more]
Dach12.292e-5977.24dachshund family transcription factor 1 [Source:MG... [more]
Dach21.053e-4771.30dachshund family transcription factor 2 [Source:MG... [more]
Dach23.515e-4463.64dachshund family transcription factor 2 [Source:MG... [more]
back to top
BLAST of dachshund vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9UI36|DACH1_HUMAN9.515e-5977.24Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DAC... [more]
sp|Q9QYB2|DACH1_MOUSE1.603e-5877.24Dachshund homolog 1 OS=Mus musculus OX=10090 GN=Da... [more]
sp|Q925Q8|DACH2_MOUSE2.459e-4363.64Dachshund homolog 2 OS=Mus musculus OX=10090 GN=Da... [more]
sp|Q96NX9|DACH2_HUMAN8.765e-4364.96Dachshund homolog 2 OS=Homo sapiens OX=9606 GN=DAC... [more]
back to top
BLAST of dachshund vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9B8J20.000e+0100.00Dachshund OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
T1DBP24.113e-15855.73Dach OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
H6V0553.148e-71100.00Dachshund (Fragment) OS=Schmidtea polychroa OX=500... [more]
G4V5D72.490e-6685.12Putative dachshund homolog OS=Schistosoma mansoni ... [more]
A0A504YJX81.047e-6579.14Dachshund protein 1 OS=Fasciola gigantica OX=46835... [more]
back to top
BLAST of dachshund vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dachc1.452e-6276.42dachshund homolog 1-like [Source:NCBI gene;Acc:103... [more]
dachc2.694e-6276.42dachshund homolog 1-like [Source:NCBI gene;Acc:103... [more]
dachd8.479e-6075.00dachshund homolog 1 [Source:NCBI gene;Acc:10302517... [more]
dachd1.553e-5975.00dachshund homolog 1 [Source:NCBI gene;Acc:10302517... [more]
dachd2.050e-5975.00dachshund homolog 1 [Source:NCBI gene;Acc:10302517... [more]
back to top
BLAST of dachshund vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of dachshund vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of dachshund vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO404685.327e-2959.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dachshund vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dach6.185e-6176.42dachshund protein [Source:NCBI gene;Acc:100049531][more]
dach1.022e-6069.50dachshund protein [Source:NCBI gene;Acc:100049531][more]
DACH17.128e-5770.16dachshund homolog 1 [Source:NCBI gene;Acc:10116632... [more]
ENSORLT00000044554.14.836e-4768.52dachshund homolog 2 [Source:NCBI gene;Acc:10535634... [more]
back to top
BLAST of dachshund vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013159.10.000e+099.43SMESG000013159.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025028
GenBankAFC87777.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025028 ID=SMED30025028|Name=dachshund|organism=Schmidtea mediterranea sexual|type=transcript|length=1719bp
CCGAAATCAATTCATTAATTAACTTCAATTGACAAAAATGGACTCACCAA
TGATATCGTTAAGTCCGAATAATCAAACAAAACCGGTTTATTGCACTCCA
AATCCAGTTCCGAATATTCCCGAAAACAATCAGGTGTCTCTCATTGATTA
CAGATGTGCCAAAATTGCAGCGTTTACTGTTGAAGGCCGACAATTAATTT
GTCTGCCTCAAGCGTTTGAATTGTTTCTCAAACATTTAGTCGGTGGGCTT
CACACGGTTTATACAAAATTGAAGAGACTAGAAATCGTTCCAGTAGTTTG
CAATGTAGAACAAGTGAGAATTCTCCGAGGTCTTGGAGCGATTCAGCCGG
GAGTAAACCGATGCAAACTAATCGCACCGAAAGAGTTTGACATTCTGTTC
GAGGATTGTACGAATTCGAGTGCCCGACCAGGAAGACCATCAAAACGAGC
GACATTACTGCCAGGAGATCTCAATATGTCAGAATCTATTAAGCGAGCAC
ATTACGAGTTGGTTAATGACTGCGTGAAATCGGGAGAATCTATTAATTCT
TCATATAGACTTTCATATGATGACGAAAAAAGAATATTTCTGCGTAATTC
TTTGTCACAACATGGTTTCTGTCCAATTATTCCACCAAATTTGGGTTTTA
ACTCCATGTTGCCATTCGGAATGACCGGATCAATTCTTAATTTGTTTCCT
CATAACCAGTCAATAATGAAACAGTTTCCAAATTTACCATCATTCAACAG
ATTACCACAAAAAGATCCAAATTTAAACAACAGCAAATCCTATTCTAAAA
TAACAACTCCATCAGCTCTTACGAGCCACTCGAAAAGTTTATCAGATTCG
AATACAAATGCAAACAATCAATTTGAATTCAATTCAATTAAAACAAATTT
CGATGAAAAAGTTATCACTTCAAAGTCGAATGGCAATGCCAATTTGACAA
ACAAATCCTCTTTAGAAACTACACCGAATAAGCAATCCAAAACGACAATG
TTTACTGTGGACAATTTGGTATTTGAAGGTCGTTCCGAGTCACACAATGA
AGTGAATATGAATTCTCCTCCTGCAAATGAAAATATAACTAATATCACTT
CATCTTCAACAGCCAGCACAAGTCCAGATAATTTCGGAATAGAAAGGGTT
AATAAGTTTCTGACAAGAGAACAAGAGTTTCTCAGACTTTTCATTCAACA
TCAAATGAAAAATCAAAATGATGAGAAATTTAAACAAAATTTCTATGATC
CATTGCGAGAATTTTGGCGAATGAATGTAAATATGAAATTGAATCAAGGA
GATCCAGCATCAAATGGTAATCAAATAGAATCATTATCAAATGCTGGTTT
GGAATGCAGCAACAGTTCTTTCAGTAATATAATAAATTCATTGCAAGCGG
CTCATAATAACCATTCCGAATGTCCATCACAAGATTCATGCAAAAATTCA
GATTTATCCTTTTCAATCGGTAAACCAAGCCAATATATGTTATCCCAAGG
TCTGTCGTTGCTGTTCCCTTCAGATTGCGGCTCGTTGAATAATTCCCAAT
TGTCACATTCCCGATTAAAATTATTTTCTCCATCAAATAATTTACAAGAT
TTATCAGCCAAACCAATAATAAAATCGTGAGAGGAAAAAAAATGGCAATT
GAAAACTCGAGTTTAAACTCCAACATTAAATTTCTCCTGCAAAGTTTGTA
CAAAAAAAATATTCCAAAT
back to top

protein sequence of SMED30025028-orf-1

>SMED30025028-orf-1 ID=SMED30025028-orf-1|Name=SMED30025028-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=531bp
MDSPMISLSPNNQTKPVYCTPNPVPNIPENNQVSLIDYRCAKIAAFTVEG
RQLICLPQAFELFLKHLVGGLHTVYTKLKRLEIVPVVCNVEQVRILRGLG
AIQPGVNRCKLIAPKEFDILFEDCTNSSARPGRPSKRATLLPGDLNMSES
IKRAHYELVNDCVKSGESINSSYRLSYDDEKRIFLRNSLSQHGFCPIIPP
NLGFNSMLPFGMTGSILNLFPHNQSIMKQFPNLPSFNRLPQKDPNLNNSK
SYSKITTPSALTSHSKSLSDSNTNANNQFEFNSIKTNFDEKVITSKSNGN
ANLTNKSSLETTPNKQSKTTMFTVDNLVFEGRSESHNEVNMNSPPANENI
TNITSSSTASTSPDNFGIERVNKFLTREQEFLRLFIQHQMKNQNDEKFKQ
NFYDPLREFWRMNVNMKLNQGDPASNGNQIESLSNAGLECSNSSFSNIIN
SLQAAHNNHSECPSQDSCKNSDLSFSIGKPSQYMLSQGLSLLFPSDCGSL
NNSQLSHSRLKLFSPSNNLQDLSAKPIIKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037000Ski_DNA-bd_sf
IPR003380SKI/SNO/DAC
IPR009061DNA-bd_dom_put_sf
Vocabulary: biological process
TermDefinition
GO:0046545development of primary female sexual characteristics
GO:0048147negative regulation of fibroblast proliferation
GO:0051123RNA polymerase II transcriptional preinitiation complex assembly
GO:0060244negative regulation of cell proliferation involved in contact inhibition
GO:2000279negative regulation of DNA biosynthetic process
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001967suckling behavior
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007585respiratory gaseous exchange
GO:0008283cell proliferation
GO:0010944negative regulation of transcription by competitive promoter binding
GO:0030336negative regulation of cell migration
GO:0033262regulation of nuclear cell cycle DNA replication
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0001075transcription factor activity, RNA polymerase II core promoter sequence-specific binding involved in preinitiation complex assembly
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003380SKI/SNO/DAC domainPFAMPF02437Ski_Snocoord: 22..125
e-value: 1.4E-35
score: 121.3
IPR037000Ski-like, DNA-binding domain superfamilyGENE3DG3DSA:3.10.260.20coord: 28..127
e-value: 1.3E-47
score: 161.7
NoneNo IPR availablePANTHERPTHR12577DACHSHUNDcoord: 7..139
IPR009061Putative DNA-binding domain superfamilySUPERFAMILYSSF46955Putative DNA-binding domaincoord: 29..126