WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30025020
Length (bp)1428
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30025020) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30025020) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30025020) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30025020) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025020

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025020SMESG000023048.1 dd_Smed_v4_12135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025020SMESG000023048.1 dd_Smed_v4_12135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025020SMESG000023048.1 SMESG000023047.1 Contig48056newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025020SMESG000023048.1 SMESG000023047.1 Contig48056uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30025020SMESG000023048.1 dd_Smed_v6_12135_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025020SMESG000023048.1 dd_Smed_v4_12135_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A0R3W1Y2 (WD_REPEATS_REGION domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3777 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.186e-63
Identity = 148/453 (32.67%), Postives = 226/453 (49.89%), Query Frame = 1
Query:  166 ENKITTFCLKKMNCKKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPIDDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQN-ETYAFDISADGMELATCGRDRNIRIYRFA-----NAGF--------------CEETRLG----SLIPKFIPMAVDEDMRE-----------------------------MGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRN-------PTLTNI----------------PLETVPL--IGKGWNCEIGDTEYLYGVKVGDNHXXXXXXXXXXXXRVVNRANQRPIGEVYAASCVNGLDIAFGGRQIVAGCSDGRIIL 1290
            E  + + C  K +C+   ++A     + + G  PI     VE            EDD  V +++F+ DG +L+VG  N++VR+IN  +  ++L ++PS + LGMPITC+RY+P     ++ C+P G ++   +  EGFET+ITE+N +TY FDIS DGMELAT G D  IR+Y           F              C+    G    S+ P  +P++   D+++                              GH M I A+++HP     ++SA WD+ VK+WDTR +  P+  I GP VCSP+G+D++G E+ TASWR R AL+IWDLRN       P  +N+                P E + +  + KG   + G  EYLY  ++  + +I+  GSGF+ +RV +R  + P+  +   S V  +D    GR I  GC+ G I +
Sbjct:   53 EKSVCSHCGTKCSCRDDCKKAPMSNPLCHKG--PI-----VE------------EDDFGVHTLRFSADGRQLIVGSANTSVRIINVIEGQQQLLLRPSSWKLGMPITCLRYVPTNLKWVLGCTPQGDIFCLDSTYEGFETLITEKNQQTYCFDISPDGMELATAGTDTAIRLYSLCFGQQKTTSFETHSTDSGKPEKRPCKRFAGGKADQSIKPFIVPISYKGDVKQDPCSEEADTDTVGPQILGYHPTGPADNYTEGHSMRITALRYHPTQCRLLISASWDHHVKVWDTRTRNGPVHDIYGPLVCSPEGLDVEGDELLTASWRKRQALEIWDLRNLHATESSPKGSNLANGDVGNTLRKQAYMQPAECIDVADVVKGQCKDAGGGEYLYAARLLPSRAIVCGGSGFNEVRVFHRDTKMPVIRIPTDSVVQTIDSVLEGRFIAIGCASGAITI 486          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A158QET4 (WD_REPEATS_REGION domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7885 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 5.138e-58
Identity = 138/392 (35.20%), Postives = 200/392 (51.02%), Query Frame = 1
Query:  316 DDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNE-TYAFDISADGMELATCGRDRNIRIY---------------------------RFANAGF----CEETR---------LGSLIPKFIPM--AVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRN-----------------PTLTN----IPLETVPLIGKGWN--CEIGDT-EYLYGVKVGDNHXXXXXXXXXXXXRVVNRANQRPIGEVYAASCVNGLDIAFGGRQIVAGCSDGRIIL 1290
            D +  DD  + ++ F+ DG +LVVG  N++VRVI      +   I+PSK+ LGMPITC+RY+P   + ++  +P G ++     +EGFET+I E+N  TY  +IS+DG E+AT G D +IRIY                           RF         C  ++         L S +P+ +    A   D    GH M I A+K+HP     +VSA WD+ VK+WDTR +  PI +I GP VCSPDG+D+ G+ + TASWR   AL+IWDLRN                  TL       P ET+P +G      C  G++ EYLY  ++  +H++I  GSGF  +RV++R  +  +  +   S V  +D    GR +  GC DG + +
Sbjct:   72 DFSDADDFGIHTLIFSADGKQLVVGSANTSVRVIGVPDGGQLREIRPSKWKLGMPITCLRYLPNNLNWVLGSTPEGEIFCVNPNQEGFETLIREENRLTYCLNISSDGAEMATAGNDTSIRIYDIHPGQLSGSETCSIKGKSNKVPSTKLRFGERSVKPVGCSASKVIRNRQNPSLNSRMPEILGYRPAGPADNHTEGHSMRITALKYHPTQPRILVSASWDHYVKIWDTRTRNKPIDEIYGPLVCSPDGLDVDGHYVLTASWRKSQALEIWDLRNLCTKKRDHRLENNGDVLNTLNKHAYMCPAETIP-VGNSTEILCGEGESGEYLYAARLLPSHAVICGGSGFREVRVMSRETKMALIRIPVDSIVQTIDTVLEGRFVGIGCVDGSLTI 462          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A0R3THM7 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS6564 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 4.678e-50
Identity = 109/343 (31.78%), Postives = 164/343 (47.81%), Query Frame = 1
Query:  205 CKKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPID---------DAGE--------------------------DDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQN-ETYAFDISADGMELATCGRDRNIRIY-------------------------------RFANAGFC---------EETRLGSLIPKFIPM--AVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQI 999
             +  LE AI    ++   L PIF F+ +  +  + P D          +GE                          DD  + ++    DG +L+VG  N++V+VI      +   I+PSK+ LGMPITC+RY+P   + ++  +P G ++     +EGFET+I E+N +TY  DIS+DG E+AT G D +IRIY                               R+     C         +   L S +P+ +    A   D    GH M I A+K+HP +   ++SA WD+ VK+WDTR +  PI++I GP VCSPDG+D+ G+ + TASWR   AL++
Sbjct:    2 ARSQLESAILTSALVENDLTPIFRFTKIRFHNTLSPPDYRSNHIKEAKSGEGFRRSSSFEVPPQSRLWSAKDCFPDADDFSIHTLALGADGKQLIVGSANTSVKVIGVPDGGQLREIRPSKWRLGMPITCLRYIPNNINWVLGSTPEGEIFCVSPNQEGFETLIKEENRQTYCLDISSDGTEMATAGNDSSIRIYDIHPTQLRGSETCSVKGKSSTALPTILYFGDRYEKPVGCSVAKVAKGRQNPSLNSRMPQILGYRPAGPADNYTDGHSMRITALKYHPAHPSILLSASWDHYVKIWDTRTRNKPIYEIYGPLVCSPDGLDVDGHYVLTASWRKSQALEV 344          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3I933 (vegetative incompatibility protein HET-E-1 OS=Lingula unguis OX=7574 GN=LOC106161849 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.026e-43
Identity = 115/362 (31.77%), Postives = 179/362 (49.45%), Query Frame = 1
Query:  208 KKSLERAIGIGKMINYGLE-PIFMFSSVESYKNIPPIDDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQ-NETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFI---PMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTL-TNIPLETVPLIGKGWNCEIGDTEYLYGVKVGDNHXXXXXXXXXXXXRVVNRANQRPIGEVYAASCVNGLDIAFGGRQIVAGCSD 1275
            ++ LE AI  GK I  G + P    S++E   NI  +     +   ++S+QF+ DG  L VG  NS + +++    N    ++ SK+  G+PI C+R+ P +   + A    G++Y   ++      II+E+ NE    D S D    AT G+D +IRIY         +T+   L+ ++        + + + +GH   I A+KFHP+N    ++ GWDN +K+WD R+       I GPH+C  DG+D++G++I T SW   NALQI+D     L  NIP    P  G+G        +YLY  +  +N  +I  GSG    + +N      +GEV  +  V  +D   GGR    G  D
Sbjct:    3 RRRLEAAIQAGKQIEQGTQWP----SNLEKVDNIKQVSMRDIERDGIYSLQFSYDGNTLAVGYGNSGIEILDALTGNPVQELRKSKY-GGLPIGCLRFNPQQQHILFAGGADGNVYSCNSQTGECTEIISEKHNEINCLDFSMDSFSFATAGKDLDIRIY---------DTKTQELVTEYKGYHQYKPNPEEQGVGHAQRIFALKFHPENDNIFITGGWDNHLKVWDKRSSDGVKRTIGGPHICG-DGLDVRGFQILTGSWTHHNALQIFDYSTGKLQQNIPF---PDNGEG--------QYLYCAQFCENDVVIAGGSGTKSAKAINITTGECLGEVKMSKAVQAMDSTKGGRLFAIGGGD 338          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A504YYU0 (Coronin protein crn1 OS=Fasciola gigantica OX=46835 GN=FGIG_09993 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.514e-41
Identity = 90/259 (34.75%), Postives = 132/259 (50.97%), Query Frame = 1
Query:  328 EDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELATCGR--------------------DRNIRIYRFANAGFCEETRLGSLIPK----------------FIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQ 996
            +DD  + SVQF+ DG  L+ G  N++VRVI+TA  ++++  +PSK+ LGMPIT IR+MP K    +AC+  G ++      EGFET+          +  +DGM      R                    D  +R Y        ++ +    +P+                +IP +   +M E GH   I AV++HP     + SAGWDN+VK+WDTR    P+W+I GPHV SPDG+DI    + TASWRAR +++
Sbjct:  139 QDDYAIHSVQFSGDGKLLLAGSANTSVRVIHTADGSQRIIPRPSKWALGMPITAIRFMPPKLIWAVACNSHGEVFAFNPNAEGFETLFKASYRIDNSNTLSDGMNTQGAKRESSHKYTHPHYPGGRPNQIVDETVRRYVLTRCYGTKDLQDSPSVPEPASYTGHKQPVPRIMEYIPTSPGVNMTE-GHSKRIMAVRYHPSRFALLFSAGWDNLVKLWDTRLPTGPVWQIYGPHVASPDGLDIDDDYLLTASWRARASIE 396          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044062.1 (WD repeat-containing protein 5B-like [Source:NCBI gene;Acc:103035992])

HSP 1 Score: 91.6633 bits (226), Expect = 1.159e-19
Identity = 69/242 (28.51%), Postives = 107/242 (44.21%), Query Frame = 1
Query:  328 EDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKP-SKFILGMPITCIRYMPVK--YDRIIACSPSGHL-----------YMSQAKKEGFETIITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIK--GYEIFTASWRARNALQIWD 1005
            E D    + QF+ DG+ L VG  N T++V +T       T++  S  I G+P+T +R+      +  ++A   SG +           +  +  K+  E    +  E+     S  G    T G D  + +Y       C+  RL           +D      GH   I AV FHP+   + ++ GWDN V+ WDTR + + I  + GPHVC  D + I     +I + SWR  N L++WD
Sbjct:   76 ECDCVAMTCQFSTDGSLLAVGLCNGTIKVYSTDSGELTQTLRDNSSVISGLPVTGLRFTCSGNLHHLLLATYASGCVRCWYVWGGQCVWWLKESKDSEEDEDPQPRESLCLSTSLSGERAVTGGSDATVHLYDLNT---CQ--RLQVCRASASKAVMD------GHRFRIFAVSFHPERETEFITGGWDNTVQFWDTRMQ-HSIRMLYGPHVCG-DALHINPASNQILSGSWRRYNTLEVWD 304          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 49.6766 bits (117), Expect = 4.507e-6
Identity = 53/225 (23.56%), Postives = 89/225 (39.56%), Query Frame = 1
Query:  358 FNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETY-AFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAK--INPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTL 1023
            F+    +L  G  + TV V N     R    +  K +    +T + + P   D + + S    + +     +G  T+ T    T  + + S+DG  L T   D++++I+                  KFI  ++++      H   +   +F PD    + S G D  V++WDT ++  IN      GP       +D        AS  A N L+IWD+R   L
Sbjct:   39 FSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDV----VTAVHFSP-SGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQ-------------KFI-YSLNQ------HTNWVRCARFSPDGRL-VASCGDDRTVRLWDTSSRQCINTFTDYGGPATF----VDFNASGTCIASSGADNTLKIWDIRTNKL 233          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 49.6766 bits (117), Expect = 5.017e-6
Identity = 53/225 (23.56%), Postives = 89/225 (39.56%), Query Frame = 1
Query:  358 FNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETY-AFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAK--INPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTL 1023
            F+    +L  G  + TV V N     R    +  K +    +T + + P   D + + S    + +     +G  T+ T    T  + + S+DG  L T   D++++I+                  KFI  ++++      H   +   +F PD    + S G D  V++WDT ++  IN      GP       +D        AS  A N L+IWD+R   L
Sbjct:   26 FSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDV----VTAVHFSP-SGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQ-------------KFI-YSLNQ------HTNWVRCARFSPDGRL-VASCGDDRTVRLWDTSSRQCINTFTDYGGPATF----VDFNASGTCIASSGADNTLKIWDIRTNKL 220          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 48.9062 bits (115), Expect = 6.763e-6
Identity = 53/225 (23.56%), Postives = 89/225 (39.56%), Query Frame = 1
Query:  358 FNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETY-AFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAK--INPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTL 1023
            F+    +L  G  + TV V N     R    +  K +    +T + + P   D + + S    + +     +G  T+ T    T  + + S+DG  L T   D++++I+                  KFI  ++++      H   +   +F PD    + S G D  V++WDT ++  IN      GP       +D        AS  A N L+IWD+R   L
Sbjct:   26 FSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDV----VTAVHFSPSG-DLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQ-------------KFI-YSLNQ------HTNWVRCARFSPDGRL-VASCGDDRTVRLWDTSSRQCINTFTDYGGPATF----VDFNASGTCIASSGADNTLKIWDIRTNKL 220          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO48733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIL3])

HSP 1 Score: 117.087 bits (292), Expect = 3.147e-29
Identity = 96/358 (26.82%), Postives = 165/358 (46.09%), Query Frame = 1
Query:  298 KNIPPIDDAG------------EDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKK-EGFETIITEQNETYAFDISADGMELATCGRDRNIRIY---------RFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTLTNIPLETVPLIGKGWNC-EIGDTEYLYGVKVGDNHXXXXXXXXXXXXRVVNRANQRPIGEV-YAASCVNGLDIAFGGRQIVAGCSDGRIILCRM 1299
            +++PPI D               D + VFSV  +     L  G  N  V+V +     ++  +K    + G+P+T +++ P K DR+++ +  G +           +++    NE    D S DG   AT G+DR +R+Y          FA +   E  R  S+I   +P        E GHG  +  ++FHP +    ++ GWD  +K+WD R   + I  I GP++C  DGIDI   E+ T+SW  + ALQIWD  +  L    +E VP     + C E G  E+LY  +  ++  ++  GSG   ++++ R   + +  +      ++ LD++ GG+ +    +   + L  +
Sbjct:    6 RSVPPIRDLSVPKVTAIKDLDFGDIMGVFSVHLSPRDQYLAAGCGNGAVQVYSCDTGKKRRPLKHGS-LYGLPVTTVKFFPFKDDRLMSTTSDGTITCWDLDNWSHMKSVDEPHNEISTLDFSHDGKIFATAGKDRKVRVYDSDTMQIKLTFAGSEATEPARDVSMI---VP--------EGGHGKKVFGLRFHPFDDNVFLTGGWDRCLKIWDVRVD-HVIRSIHGPYICG-DGIDICQDEVMTSSWLHQKALQIWDYGSGEL----IENVP-----FPCGEHG--EFLYVGRFVNSQVVVAGGSGTKDVKILTRKPHKVVASIDDEGKPIHALDVSPGGQLLALAGTGTHVKLVSL 338          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO44597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV80])

HSP 1 Score: 86.6557 bits (213), Expect = 9.411e-19
Identity = 66/237 (27.85%), Postives = 104/237 (43.88%), Query Frame = 1
Query:  328 EDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILG-MPITCIRYMPVKYDR-----IIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETR--LGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKI-NPIWKISGPHVCSPDGIDIK--GYEIFTASWRARNALQIWD 1005
            E   +V   +FN DG+ + VG  N TV+V      N   ++   + +   +P+TC+R+     +      ++A    G +    A      +   E  +  A  I+       T G D  I +Y        E+T+  + +  P    + +D      GH   + +V+F P      +S GWD+ V+ WDTR    + I KI GPH+C  D +DI    + I T SWR  + LQIWD
Sbjct:   16 ETSSEVMCCRFNLDGSLIAVGLANGTVKVYLAENGNCVYSLHDQETLNSHLPVTCLRWKAAGANEDFGNILLATYADGCVKHWHASTSKCLSTQKEGRQVLACSINFSADRFVTSGSDTKIFLYD-------EKTKQTVSTFQPSTSHLVMD------GHMSRVFSVQFVPGEDHVFLSGGWDDTVQYWDTRVDAKHSIRKIFGPHICG-DALDIHPMNFNILTGSWRKDDTLQIWD 238          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO28937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T527])

HSP 1 Score: 77.0258 bits (188), Expect = 2.724e-15
Identity = 67/243 (27.57%), Postives = 105/243 (43.21%), Query Frame = 1
Query:  340 DVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELATCGRDRNIRIY---------RFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTL-TNIPL 1038
            ++ ++ F+ DG      G +  VRV ++     KLT   S+     P    R        +  C+    L  S       + + +     +   +  + +EL     DR +R+Y          FA +   E  R  S+I   +P        E GHG  +  ++FHP +    ++ GWD  +K+WD R   + I  I GP++C  DGIDI   E+ TASW  + ALQIWD  +  L  N+P 
Sbjct:  135 EISTLDFSHDGKIFATAGKDRKVRVYDSDTMQVKLTFAGSEAT--EPARSFRAFLSPVVILSLCASKDKLANSDLVSS--KCLKSHGGLCWRLPLRLN-IEL-----DRKVRVYDSDTMQVKLTFAGSEATEPARDVSMI---VP--------EGGHGKKVFGLRFHPFDDNVFLTGGWDRCLKIWDVRVD-HVIRSIHGPYICG-DGIDICQDEVMTASWLHQKALQIWDYGSGELIENVPF 354          

HSP 2 Score: 62.7734 bits (151), Expect = 1.037e-10
Identity = 44/159 (27.67%), Postives = 71/159 (44.65%), Query Frame = 1
Query:  208 KKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPIDDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKK-EGFETIITEQNETYAFDISADGMELATCGRDRNIRIY 681
            +K LE A+  GK I     P     SV     I  +D    D + VFSV  +     L  G  N  V+V +     ++  +K    + G+P+T +++ P K DR+++ +  G +           +++    NE    D S DG   AT G+DR +R+Y
Sbjct:    5 RKRLEDALQAGKDIESDESPPIRDLSVPKVTAIKDLDFG--DIMGVFSVHLSPRDQYLAAGCGNGAVQVYSCDTGKKRRPLKHGS-LYGLPVTTVKFFPFKDDRLMSTTSDGTITCWDLDNWSHMKSVDEPHNEISTLDFSHDGKIFATAGKDRKVRVY 160          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO45890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV3])

HSP 1 Score: 48.521 bits (114), Expect = 3.850e-6
Identity = 60/258 (23.26%), Postives = 104/258 (40.31%), Query Frame = 1
Query:  361 NQDGTELVVGGMNSTVRVINTAQPNR---KLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLY----MSQAKKEGFETIITE------------QNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIP---KFIPMAVDE------DMRE--------MGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDI---KGYEIFTASWRARNALQIWDLRNP 1017
            ++DG+++ V G N   ++++  Q N+   K+ ++  +  L   IT +++ PV+ D I+A +          +++  K+  E +  E            Q+ T     S DG     C   R   +  F+  G  E  R     P   K    A D       DMR         M H   +  + +HP++   I + G D  VK+WD + K  P+  I    + S   I     K Y+I + +      + +WD+R P
Sbjct:   16 SKDGSQVAVAGRN-VFKIVSIDQDNKFQEKINLRVGRINLNFSITDVQWHPVE-DHILATAAGNGAVVIWNLNKITKQKQELVFYEHKRTVNRIKFHPQDTTLLLSGSQDGT--MNCFDIRKQSVL-FSAHGKSESIRDIEFSPFDGKQFATACDNGNVQLWDMRRTDTYYHQFMAHNGPVFTLDWHPEDRNWIATGGRDKCVKVWDVQGKATPVNNIQT--ISSVSRIKWRPQKKYQIASCALLVDFDIHVWDIRRP 266          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000023048.1 (SMESG000023048.1)

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 367/368 (99.73%), Postives = 367/368 (99.73%), Query Frame = 1
Query:  199 MNCKKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPIDDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTLTNIPLETVPLIGKGWNCEIGDTEYLYGVKVGDNHXXXXXXXXXXXXRVVNRANQRPIGEVYAASCVNGLDIAFGGRQIVAGCSDGRIILCRMN 1302
            MNCKKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPIDDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFI MAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTLTNIPLETVPLIGKGWNCEIGDTEYLYGVKVGDNHSIITSGSGFSGIRVVNRANQRPIGEVYAASCVNGLDIAFGGRQIVAGCSDGRIILCRMN
Sbjct:    1 MNCKKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPIDDAGEDDVDVFSVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRYMPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIQMAVDEDMREMGHGMTIHAVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGYEIFTASWRARNALQIWDLRNPTLTNIPLETVPLIGKGWNCEIGDTEYLYGVKVGDNHSIITSGSGFSGIRVVNRANQRPIGEVYAASCVNGLDIAFGGRQIVAGCSDGRIILCRMN 368          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000047063.1 (SMESG000047063.1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.640e-17
Identity = 50/166 (30.12%), Postives = 73/166 (43.98%), Query Frame = 1
Query:  592 TEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQ------IVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIKGY--EIFTASW-RARNALQIWDLRNPTLTNIPLETVPLIGK 1062
            T+ N+     IS D     T G D  I++Y   +         G         A D  +    H + I A+K+HP            +SA WDN +++WD R K+  +W+  GPHVC  DGIDI  +   I + SW R +  LQ+W      L   P++   L G+
Sbjct:  195 TKLNQILCLSISGDSQRFVTGGDDCIIKVYEITSRTVARYLHKGETHTLQTGRASDAVLNADFHTLRITAIKYHPLGKTDAKYTHIFISASWDNTIQIWDDR-KLGSLWQYLGPHVCGADGIDIDPFTNTIISCSWKREKAVLQVWKFNEYVLNASPIDGRALYGQ 359          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000060483.1 (SMESG000060483.1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.061e-13
Identity = 45/150 (30.00%), Postives = 69/150 (46.00%), Query Frame = 1
Query:  586 IITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIHAVKFHPDNSCQ------IVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDI--KGYEIFTASWRA-RNALQIWDL 1008
            I+ E N+  A  +S DG    T G D  IR+Y               ++  F   + D   +  GH M I AV++HP    +       +S GWD+ +++WD R     +W+  GPHVC  D +DI  +   I  +SWR  +  L++W  
Sbjct:  160 IMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKK--------EIMKCFSTNSAD---KMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHS-RSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKF 297          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W1Y21.186e-6332.67WD_REPEATS_REGION domain-containing protein OS=Tae... [more]
A0A158QET45.138e-5835.20WD_REPEATS_REGION domain-containing protein OS=Hym... [more]
A0A0R3THM74.678e-5031.78Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A1S3I9332.026e-4331.77vegetative incompatibility protein HET-E-1 OS=Ling... [more]
A0A504YYU04.514e-4134.75Coronin protein crn1 OS=Fasciola gigantica OX=4683... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000044062.11.159e-1928.51WD repeat-containing protein 5B-like [Source:NCBI ... [more]
POC1B4.507e-623.56POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B5.017e-623.56POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B6.763e-623.56POC1 centriolar protein homolog B [Source:NCBI gen... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO487333.147e-2926.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445979.411e-1927.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289372.724e-1527.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458903.850e-623.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000023048.10.000e+099.73SMESG000023048.1[more]
SMESG000047063.18.640e-1730.12SMESG000047063.1[more]
SMESG000060483.14.061e-1330.00SMESG000060483.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025020 ID=SMED30025020|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1428bp
TTATTATTAATGATTTTCAACACAAGTTAATTTTTAAGAATATAAGTAAC
ATCTTCATTTATTTTTTAATGGTTAAATTGTATTTTGAAACAAGTCTAAA
TAAGAATTAATTTTATAATATTCAATCAATATATTATTTTTCAAAGTTAA
ACTAACTTGGTTTTTGAAAATAAAATAACTACTTTTTGTTTGAAGAAAAT
GAATTGCAAAAAAAGCCTTGAACGCGCTATTGGTATTGGAAAAATGATCA
ATTATGGACTGGAACCAATATTTATGTTTTCATCAGTAGAATCTTACAAA
AACATTCCTCCGATTGATGATGCTGGTGAAGACGATGTTGATGTATTTAG
TGTTCAATTCAATCAAGATGGCACAGAATTAGTAGTCGGAGGAATGAACA
GCACTGTCAGAGTGATTAATACCGCCCAACCAAATCGTAAATTAACAATT
AAACCATCAAAATTCATACTTGGAATGCCAATTACGTGCATTCGATATAT
GCCGGTAAAATATGACAGAATTATCGCATGTTCACCGAGTGGACACCTCT
ACATGTCACAGGCTAAAAAAGAAGGCTTCGAAACCATTATCACAGAACAG
AATGAAACTTATGCTTTTGATATATCCGCGGATGGCATGGAATTAGCAAC
TTGTGGTCGGGATAGAAACATCCGTATATATCGTTTTGCTAATGCTGGTT
TTTGCGAGGAAACTCGTCTTGGTTCTTTAATACCAAAATTTATTCCAATG
GCAGTTGATGAGGATATGCGTGAAATGGGGCACGGTATGACTATTCATGC
TGTCAAGTTCCATCCGGATAATTCTTGTCAAATTGTCAGTGCTGGATGGG
ATAATATTGTCAAGATGTGGGATACTCGAGCCAAAATTAATCCAATTTGG
AAAATCAGTGGTCCCCATGTATGTAGTCCTGACGGAATTGATATTAAAGG
ATATGAGATTTTTACAGCGTCATGGAGAGCAAGAAATGCTTTGCAGATTT
GGGATCTTCGGAATCCCACCCTCACAAATATTCCTTTGGAAACAGTGCCG
TTAATTGGCAAAGGATGGAATTGCGAAATCGGGGATACAGAATATCTATA
CGGAGTTAAGGTTGGTGATAACCATTCAATTATCACCAGTGGATCTGGAT
TTTCAGGAATTCGGGTGGTCAATAGAGCAAATCAAAGGCCGATTGGTGAA
GTTTACGCTGCTTCTTGTGTTAATGGGCTTGATATTGCATTTGGAGGTCG
CCAGATAGTTGCCGGATGTTCAGATGGACGAATCATTTTGTGCAGAATGA
ATTAAAATCGATTTTATTGATTATTTTTGGTGCTTCAAGATTTTTATTGC
AATTGTTTTAATGTTTTAATGTTTTCGTTATTTGTTTTTAATAAGGAATT
CAATAAGAGTTTTCTAATTGAAAAAAAA
back to top

protein sequence of SMED30025020-orf-1

>SMED30025020-orf-1 ID=SMED30025020-orf-1|Name=SMED30025020-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MNCKKSLERAIGIGKMINYGLEPIFMFSSVESYKNIPPIDDAGEDDVDVF
SVQFNQDGTELVVGGMNSTVRVINTAQPNRKLTIKPSKFILGMPITCIRY
MPVKYDRIIACSPSGHLYMSQAKKEGFETIITEQNETYAFDISADGMELA
TCGRDRNIRIYRFANAGFCEETRLGSLIPKFIPMAVDEDMREMGHGMTIH
AVKFHPDNSCQIVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDIK
GYEIFTASWRARNALQIWDLRNPTLTNIPLETVPLIGKGWNCEIGDTEYL
YGVKVGDNHSIITSGSGFSGIRVVNRANQRPIGEVYAASCVNGLDIAFGG
RQIVAGCSDGRIILCRMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043029T cell homeostasis
GO:0050863regulation of T cell activation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 35..74
e-value: 1.2
score: 16.6
coord: 83..121
e-value: 290.0
score: 1.5
coord: 328..366
e-value: 14.0
score: 9.8
coord: 186..225
e-value: 1.4E-4
score: 31.3
coord: 124..162
e-value: 1.4
score: 16.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 194..225
e-value: 2.3E-4
score: 21.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 192..227
score: 11.377
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 43..176
e-value: 2.8E-12
score: 48.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 180..368
e-value: 1.1E-15
score: 59.4
NoneNo IPR availablePANTHERPTHR47822FAMILY NOT NAMEDcoord: 32..367
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 212..226
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 192..278
score: 9.863
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 46..366