Vacuolar protein sorting 25 homolog

Overview
NameVacuolar protein sorting 25 homolog
Smed IDSMED30025014
Length (bp)663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vacuolar protein sorting 25 homolog (SMED30025014) t-SNE clustered cells

Violin plots show distribution of expression levels for Vacuolar protein sorting 25 homolog (SMED30025014) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vacuolar protein sorting 25 homolog (SMED30025014) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vacuolar protein sorting 25 homolog (SMED30025014) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025014

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior muscle cellSMED30025014SMESG000018311.1 dd_Smed_v4_5009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025014SMESG000018311.1 dd_Smed_v4_5009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025014SMESG000018311.1 dd_Smed_v4_5009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Human
Match: VPS25 (vacuolar protein sorting 25 homolog [Source:HGNC Symbol;Acc:HGNC:28122])

HSP 1 Score: 205.297 bits (521), Expect = 4.873e-67
Identity = 91/176 (51.70%), Postives = 130/176 (73.86%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DKSK +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT+GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Human
Match: VPS25 (vacuolar protein sorting 25 homolog [Source:HGNC Symbol;Acc:HGNC:28122])

HSP 1 Score: 122.094 bits (305), Expect = 3.153e-35
Identity = 54/108 (50.00%), Postives = 80/108 (74.07%), Query Frame = 3
Query:  216 LNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRIL 539
            + V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DKSK +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT+GE+TE+E FHGLD+  L+ A++ L
Sbjct:    1 MTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQAL 108          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Human
Match: VPS25 (vacuolar protein sorting 25 homolog [Source:HGNC Symbol;Acc:HGNC:28122])

HSP 1 Score: 88.1965 bits (217), Expect = 4.004e-22
Identity = 38/70 (54.29%), Postives = 52/70 (74.29%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDL 290
            +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + R +   L
Sbjct:    4 SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRILPQAL 73          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Human
Match: VPS25 (vacuolar protein sorting 25 homolog [Source:HGNC Symbol;Acc:HGNC:28122])

HSP 1 Score: 81.2629 bits (199), Expect = 2.052e-19
Identity = 35/73 (47.95%), Postives = 54/73 (73.97%), Query Frame = 3
Query:  105 NFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKR 323
             FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+
Sbjct:    2 RFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKK 74          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Celegans
Match: vps-25 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9U354])

HSP 1 Score: 161.384 bits (407), Expect = 5.671e-50
Identity = 71/172 (41.28%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   84 FEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELL-ISEDLEGVKF 596
            F+WPWQY+FPPFFT+Q +  T+ KQ++AW +L++ Y Q+ K Y+L++ +A  S LF+N+ ++R++ +D +  +L  L+++  +E+TD  +    I WR  + W+++IY+W  ++  +NT  TLYE+T G++T NE FH L+++IL+ A+  L + +RA+L+ I  D EGVKF
Sbjct:   11 FKWPWQYDFPPFFTIQKSLNTKDKQLEAWARLVIDYAQHNKIYSLDIAEATTSELFNNQKLNRRLSTDGVNTVLQYLEQKKLIEFTDNGRTRFHIFWRRPDVWANMIYQWAVENAFINTPLTLYEITHGDDTTNESFHNLEREILMKALTCLEEQRRAQLMNIGGDNEGVKF 182          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Celegans
Match: vps-25 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9U354])

HSP 1 Score: 161.384 bits (407), Expect = 5.671e-50
Identity = 71/172 (41.28%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   84 FEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELL-ISEDLEGVKF 596
            F+WPWQY+FPPFFT+Q +  T+ KQ++AW +L++ Y Q+ K Y+L++ +A  S LF+N+ ++R++ +D +  +L  L+++  +E+TD  +    I WR  + W+++IY+W  ++  +NT  TLYE+T G++T NE FH L+++IL+ A+  L + +RA+L+ I  D EGVKF
Sbjct:   11 FKWPWQYDFPPFFTIQKSLNTKDKQLEAWARLVIDYAQHNKIYSLDIAEATTSELFNNQKLNRRLSTDGVNTVLQYLEQKKLIEFTDNGRTRFHIFWRRPDVWANMIYQWAVENAFINTPLTLYEITHGDDTTNESFHNLEREILMKALTCLEEQRRAQLMNIGGDNEGVKF 182          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Fly
Match: Vps25 (gene:FBgn0022027 transcript:FBtr0088694)

HSP 1 Score: 170.629 bits (431), Expect = 9.798e-54
Identity = 74/175 (42.29%), Postives = 120/175 (68.57%), Query Frame = 3
Query:   75 MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            M+ F+WPW+Y FPPFFTLQP+ ETR++Q+  W  L L Y ++  ++TL++ D   SPLF N+++ R++  +L+  IL EL++ G+    DK +   ++ W T EE+ +++Y W++++G  NTICTLYE+  GE T +  F+G+D+ +L+SA+R+L +  R EL+  +   GVKFF
Sbjct:    1 MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQ-NSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Zebrafish
Match: vps25 (vacuolar protein sorting 25 homolog [Source:NCBI gene;Acc:407684])

HSP 1 Score: 209.149 bits (531), Expect = 1.185e-68
Identity = 92/173 (53.18%), Postives = 134/173 (77.46%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +FEWPWQYNFPPFFTLQPN +TR+KQ+ AWC L+LSY ++ K YTL+V +A +SP+F+NK I+RK+  + +  + +EL+K+GNLEW DK+K  C I+WR  EEW  LIY+W+ K+G VN++ TLYEL +G++TE E FHGL+  +L+ +++ L  + +AE++  +D +GVKFF
Sbjct:    2 SFEWPWQYNFPPFFTLQPNVDTRQKQLAAWCSLVLSYCRHRKLYTLDVLEAQESPVFNNKKIERKLSVEAIQVVFEELRKKGNLEWLDKNKSRCLIMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELANGDDTEKEEFHGLEDWMLLRSLQALQTDGKAEIITVDDGKGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Xenopus
Match: siglec10 (sialic acid binding Ig-like lectin 10 [Source:Xenbase;Acc:XB-GENE-6462776])

HSP 1 Score: 200.29 bits (508), Expect = 4.623e-65
Identity = 88/173 (50.87%), Postives = 127/173 (73.41%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
             FEWPWQYNFPPFFTLQPN +TR+KQ+ AW  L+LSY ++ K YT+N+ +  +SPLF+NK I RK+  + +  +L+EL+K+GNLEW DK+K    I+WR  +EW  +IY+W+ K+G  N++ TLYEL  G++TE E FHGLD+ +L+ ++  L +  +AE+++  D  GVKFF
Sbjct:    2 GFEWPWQYNFPPFFTLQPNVDTRQKQLSAWSSLVLSYCRHNKLYTMNLMEIQESPLFNNKKIQRKLSLESVQVVLEELKKKGNLEWIDKNKSRFLIMWRRPDEWGKVIYQWVSKNGMTNSVFTLYELISGDDTEGEEFHGLDEAMLLRSLEALQQEHKAEIILLNDSRGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Mouse
Match: Vps25 (vacuolar protein sorting 25 [Source:MGI Symbol;Acc:MGI:106354])

HSP 1 Score: 203.371 bits (516), Expect = 1.940e-66
Identity = 90/176 (51.14%), Postives = 129/176 (73.30%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Mouse
Match: Vps25 (vacuolar protein sorting 25 [Source:MGI Symbol;Acc:MGI:106354])

HSP 1 Score: 195.667 bits (496), Expect = 2.650e-63
Identity = 90/184 (48.91%), Postives = 129/184 (70.11%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDR--------KVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + R        K+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRHSLNLKPGKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 184          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Mouse
Match: Vps25 (vacuolar protein sorting 25 [Source:MGI Symbol;Acc:MGI:106354])

HSP 1 Score: 168.703 bits (426), Expect = 4.453e-53
Identity = 74/139 (53.24%), Postives = 105/139 (75.54%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENE 488
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE+E
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDE 139          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Mouse
Match: Vps25 (vacuolar protein sorting 25 [Source:MGI Symbol;Acc:MGI:106354])

HSP 1 Score: 167.548 bits (423), Expect = 2.870e-52
Identity = 74/139 (53.24%), Postives = 105/139 (75.54%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENE 488
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE+E
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDE 139          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Mouse
Match: Vps25 (vacuolar protein sorting 25 [Source:MGI Symbol;Acc:MGI:106354])

HSP 1 Score: 135.961 bits (341), Expect = 1.435e-40
Identity = 61/128 (47.66%), Postives = 91/128 (71.09%), Query Frame = 3
Query:  216 LNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            + V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 128          
BLAST of Vacuolar protein sorting 25 homolog vs. UniProt/SwissProt
Match: sp|Q6NWF4|VPS25_DANRE (Vacuolar protein-sorting-associated protein 25 OS=Danio rerio OX=7955 GN=vps25 PE=2 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 8.105e-68
Identity = 92/173 (53.18%), Postives = 134/173 (77.46%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +FEWPWQYNFPPFFTLQPN +TR+KQ+ AWC L+LSY ++ K YTL+V +A +SP+F+NK I+RK+  + +  + +EL+K+GNLEW DK+K  C I+WR  EEW  LIY+W+ K+G VN++ TLYEL +G++TE E FHGL+  +L+ +++ L  + +AE++  +D +GVKFF
Sbjct:    2 SFEWPWQYNFPPFFTLQPNVDTRQKQLAAWCSLVLSYCRHRKLYTLDVLEAQESPVFNNKKIERKLSVEAIQVVFEELRKKGNLEWLDKNKSRCLIMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELANGDDTEKEEFHGLEDWMLLRSLQALQTDGKAEIITMDDGKGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. UniProt/SwissProt
Match: sp|Q9BRG1|VPS25_HUMAN (Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.340e-66
Identity = 91/176 (51.70%), Postives = 130/176 (73.86%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DKSK +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT+GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176          
BLAST of Vacuolar protein sorting 25 homolog vs. UniProt/SwissProt
Match: sp|Q5E9A6|VPS25_BOVIN (Vacuolar protein-sorting-associated protein 25 OS=Bos taurus OX=9913 GN=VPS25 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.103e-65
Identity = 90/176 (51.14%), Postives = 130/176 (73.86%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+L++ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ KSG  N++ TLYELT+GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLTFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQVVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSKSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176          
BLAST of Vacuolar protein sorting 25 homolog vs. UniProt/SwissProt
Match: sp|Q9CQ80|VPS25_MOUSE (Vacuolar protein-sorting-associated protein 25 OS=Mus musculus OX=10090 GN=Vps25 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.357e-65
Identity = 90/176 (51.14%), Postives = 129/176 (73.30%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE+E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176          
BLAST of Vacuolar protein sorting 25 homolog vs. UniProt/SwissProt
Match: sp|P0C0A1|VPS25_RAT (Vacuolar protein-sorting-associated protein 25 OS=Rattus norvegicus OX=10116 GN=Vps25 PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.291e-65
Identity = 90/176 (51.14%), Postives = 128/176 (72.73%), Query Frame = 3
Query:   72 LMSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +  +FEWPWQY FPPFFTLQPN +TR+KQ+ AWC L+LS+ +  KQ ++ V +A +SPLF+N  + RK+  + +  +L+EL+K+GNLEW DK+K +  I+WR  EEW  LIY+W+ +SG  N++ TLYELT GE+TE E FHGLD+  L+ A++ L +  +AE++   D  GVKFF
Sbjct:    1 MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF 176          
BLAST of Vacuolar protein sorting 25 homolog vs. TrEMBL
Match: A0A183ANU8 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8633 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.753e-69
Identity = 102/177 (57.63%), Postives = 134/177 (75.71%), Query Frame = 3
Query:   78 SNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNV---KDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            S FEWPWQY+FPPFFTLQPNAETR+KQ DAWCQL+L Y ++  QYT++V   +DA   PLF NK I R   ++L++ +L+EL++RGNLEW DKS    ++IWRT EEW+DLI KW + +G+ N +CTLYEL++G+ETE EPFHGLD  IL+ A++ L +N +AEL+     EGVKF 
Sbjct:    4 SQFEWPWQYSFPPFFTLQPNAETRRKQHDAWCQLVLDYFKSKNQYTVSVPSIRDA-SCPLFHNKDIQRTANAELVSSVLEELRRRGNLEWVDKSHKNARLIWRTPEEWADLIAKWARSTGHGNAVCTLYELSEGDETEQEPFHGLDPSILLDALKCLQRNGKAELMGD---EGVKFL 176          
BLAST of Vacuolar protein sorting 25 homolog vs. TrEMBL
Match: A0A3S1B6C5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016200 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 3.770e-69
Identity = 95/175 (54.29%), Postives = 132/175 (75.43%), Query Frame = 3
Query:   75 MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            M++F+WPWQY FPPFFT+QPN ETRKKQ++AWC L+L Y ++ KQY L++ +A  S LF NK ++RK+  D +  +L+EL+KRGNL W DK++ +C +IWRT  EW  +IYKW+      NT+CTLYELT+GE++E + FHGLDKD+LI A++ L   ++AEL+  +  EGVKFF
Sbjct:   16 MADFDWPWQYKFPPFFTIQPNIETRKKQLEAWCSLVLEYQRHTKQYGLDITEAQSSVLFYNKQLNRKLSLDAIYTVLEELRKRGNLTWKDKTRKSCTLIWRTYAEWGKIIYKWVVSKSLTNTVCTLYELTNGEDSEGQEFHGLDKDVLIQALKTLEAERKAELMDFDGSEGVKFF 190          
BLAST of Vacuolar protein sorting 25 homolog vs. TrEMBL
Match: A0A4E0S3C8 (Vacuolar protein-sorting-associated protein 25 OS=Fasciola hepatica OX=6192 GN=D915_000441 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 5.521e-69
Identity = 100/177 (56.50%), Postives = 133/177 (75.14%), Query Frame = 3
Query:   78 SNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNV---KDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            + FEWPWQYNFPPFFTLQPNAETR+KQ DAWCQL+L Y ++  QYT++V   +DA   PLF NK I R   ++L++ +L+EL +RGNLEW DKS    ++IWRT EEW+DLI KW + +G+ N++CTLYEL +G++TE EPFHGLD  +L+ A++ L +N +AEL+     EGVKF 
Sbjct:    4 AQFEWPWQYNFPPFFTLQPNAETRRKQHDAWCQLVLEYFKSKNQYTVSVTSIRDA-SCPLFHNKKIQRTANAELVSSVLEELHRRGNLEWVDKSHKNARLIWRTAEEWADLIAKWARSTGHGNSVCTLYELCEGDDTEQEPFHGLDPSLLLDALKCLQRNGKAELMGE---EGVKFL 176          
BLAST of Vacuolar protein sorting 25 homolog vs. TrEMBL
Match: A0A3B4BC52 (Vacuolar protein sorting 25 homolog OS=Periophthalmus magnuspinnatus OX=409849 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 7.094e-69
Identity = 94/173 (54.34%), Postives = 137/173 (79.19%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +FEWPWQYNFPPFFTLQPNA+TR+KQ+ AWC L LSY ++ K YTL+V +A +SP+F+NK I+RK+  + +  + +EL+K+GNL+W DK+K  C ++WR  EEW  LIY+W+ ++G VNT+CTLYEL++G++TENE FHGL++ +L+ +++ L    +AEL+  +D +GVKFF
Sbjct:    2 SFEWPWQYNFPPFFTLQPNADTRQKQLAAWCSLTLSYCRHHKLYTLDVMEAQESPIFNNKKIERKLSMEAIQVVFEELRKKGNLDWLDKNKSRCLVMWRRPEEWGKLIYQWVSRNGMVNTVCTLYELSNGDDTENEEFHGLEEWMLLRSLQALQSEGKAELITMDDSKGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. TrEMBL
Match: A0A5J4P485 (ESCRT-II complex subunit VPS25 OS=Paragonimus westermani OX=34504 GN=DEA37_0013265 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 2.947e-68
Identity = 100/174 (57.47%), Postives = 130/174 (74.71%), Query Frame = 3
Query:   84 FEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSP--LFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            FEWPW YNFPPFFTLQPNAETR+KQ DAWCQL+L Y ++   Y +++     S   LF NKSI R   SDL++ +LDEL +RGNLEW DK ++  +IIWRT EEW+D++++W + +G+ N++CTLYELTDGE+TE+EPFHGLD  IL+ A+R L K  +AEL+     EGVKF 
Sbjct:   46 FEWPWLYNFPPFFTLQPNAETRRKQQDAWCQLVLDYFRHKNVYNISITSIRDSSCSLFHNKSISRSANSDLISNVLDELHRRGNLEWIDKQRINARIIWRTPEEWADILFRWARDTGHGNSVCTLYELTDGEDTESEPFHGLDNTILLEALRCLQKRGKAELISD---EGVKFL 216          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Cavefish
Match: vps25 (vacuolar protein sorting 25 homolog [Source:NCBI gene;Acc:103046356])

HSP 1 Score: 212.616 bits (540), Expect = 4.321e-70
Identity = 92/173 (53.18%), Postives = 135/173 (78.03%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +FEWPWQYNFPPFFTLQPN +TR+KQ+ AWC L+LSY ++ K YT++V +A +SP+F+NK I+RK+  + +  + +EL+K+GNLEW DK+K  C I+WR  EEW  LIY+W+ K+G VN++ TLYEL++G++TENE FHGL+  +L+ +++ L    +AE++  +D +GVKFF
Sbjct:    2 SFEWPWQYNFPPFFTLQPNVDTRQKQLAAWCSLVLSYFRHRKLYTVDVLEAQESPVFNNKKIERKLSVEAIQVVFEELRKKGNLEWMDKNKTRCLIMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELSNGDDTENEEFHGLEDWMLLRSLQALQTEGKAEIITMDDGKGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Sea Lamprey
Match: vps25 (vacuolar protein sorting 25 homolog [Source:NCBI gene;Acc:407684])

HSP 1 Score: 193.741 bits (491), Expect = 2.425e-63
Identity = 88/176 (50.00%), Postives = 127/176 (72.16%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDR---KVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +F +PWQ+ FPPF+TLQPNA+TR+KQ+ AWC L+L Y +  + +T++V +   S LF NK+I R   K+  +++  I+DEL+KRG++EW DK++  C I+WR  EEW  LI++W+ KSG  NT+CTLYELT GE+T  E FHGLD+ +L+ A+  L +  RAE++   D +GVKFF
Sbjct:    4 SFSFPWQHRFPPFYTLQPNADTRQKQLSAWCSLVLDYCRAERIFTMDVLEVQDSALFHNKTIHRIAGKLSLEMINIIMDELRKRGSVEWQDKTRTRCLIMWRRPEEWGKLIHQWVMKSGMSNTVCTLYELTHGEDTAREEFHGLDEWLLLRALESLQEEGRAEVMSIGDGKGVKFF 179          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Yeast
Match: VPS25 (Component of the ESCRT-II complex; ESCRT-II is involved in ubiquitin-dependent sorting of proteins into the endosome [Source:SGD;Acc:S000003863])

HSP 1 Score: 89.3521 bits (220), Expect = 1.364e-22
Identity = 55/189 (29.10%), Postives = 90/189 (47.62%), Query Frame = 3
Query:   93 PWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAY-------------------QSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCK--------IIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISED 578
            P  Y+FPP +T QPN+ TR++QI  W  +I  Y +  K + ++V                          LF+N+ I R V    +  I  ++ K G     D+S             I+W++ + W+ LI +W + SG +N + TLYEL++G+ET N  FH + + +L   ++ L    RA +L  E+
Sbjct:    5 PPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDNELDSGSTDNDDSKKISKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDEN 193          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Nematostella
Match: EDO45855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM9])

HSP 1 Score: 194.512 bits (493), Expect = 2.122e-63
Identity = 86/180 (47.78%), Postives = 129/180 (71.67%), Query Frame = 3
Query:   75 MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLE-----GVKFF 599
            M+ FEWPWQY FPPFFTLQPN +TR+KQ+DAWC L+L+Y++  K Y+++V +A    LF NKSI+RK+  + +  +L+EL+K+GNLEW DK K  C I+WRT EEW+++I+KW++ +G  +T+CTLYEL  G++T  E F+G+D  +L  ++ +L    +A++  + D       GVKF+
Sbjct:    1 MAAFEWPWQYTFPPFFTLQPNLDTRRKQLDAWCDLVLTYYKQRKAYSMDVTEAQTCDLFYNKSIERKLSLEGINAVLEELRKKGNLEWEDKKKQRCYIMWRTPEEWANIIFKWVQDNGMTDTVCTLYELMAGDDTAKEAFYGIDMWMLKKSLLVLEAKGKAQMFEAPDSSDESGLGVKFY 180          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Medaka
Match: vps25 (vacuolar protein sorting 25 homolog [Source:NCBI gene;Acc:101163774])

HSP 1 Score: 214.157 bits (544), Expect = 9.004e-71
Identity = 92/173 (53.18%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFF 599
            +FEWPWQYNFPPFFTLQPNA+TR+KQ++AWC L LSY ++ K YTL+V +A +SP+F+NK I+RK+  + +  + +EL+K+GNLEW DK+K+ C ++WR  EEW  LIY+W+ K+G VN++ TLYEL++G++T+ E FHGL++ +L+ +++ L  + RAE++  +D +GVKFF
Sbjct:    2 SFEWPWQYNFPPFFTLQPNADTRQKQLEAWCSLALSYCRHHKLYTLDVMEAQESPMFNNKKIERKLSMEAIQIVFEELRKKGNLEWLDKNKLRCLVMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELSNGDDTQGEEFHGLEEWMLLRSLQALQTDGRAEIISMDDGKGVKFF 174          
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Medaka
Match: vps25 (vacuolar protein sorting 25 homolog [Source:NCBI gene;Acc:101163774])

HSP 1 Score: 204.527 bits (519), Expect = 5.993e-67
Identity = 87/166 (52.41%), Postives = 132/166 (79.52%), Query Frame = 3
Query:   81 NFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISED 578
            +FEWPWQYNFPPFFTLQPNA+TR+KQ++AWC L LSY ++ K YTL+V +A +SP+F+NK I+RK+  + +  + +EL+K+GNLEW DK+K+ C ++WR  EEW  LIY+W+ K+G VN++ TLYEL++G++T+ E FHGL++ +L+ +++ L  + RAE++  +D
Sbjct:    2 SFEWPWQYNFPPFFTLQPNADTRQKQLEAWCSLALSYCRHHKLYTLDVMEAQESPMFNNKKIERKLSMEAIQIVFEELRKKGNLEWLDKNKLRCLVMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELSNGDDTQGEEFHGLEEWMLLRSLQALQTDGRAEIISMDD 167          
BLAST of Vacuolar protein sorting 25 homolog vs. Planmine SMEST
Match: SMESG000018311.1 (SMESG000018311.1)

HSP 1 Score: 363.614 bits (932), Expect = 6.101e-130
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:   75 MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFFQ 602
            MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFFQ
Sbjct:    1 MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNVKDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIWRTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILISAIRILAKNKRAELLISEDLEGVKFFQ 176          
The following BLAST results are available for this feature:
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
VPS254.873e-6751.70vacuolar protein sorting 25 homolog [Source:HGNC S... [more]
VPS253.153e-3550.00vacuolar protein sorting 25 homolog [Source:HGNC S... [more]
VPS254.004e-2254.29vacuolar protein sorting 25 homolog [Source:HGNC S... [more]
VPS252.052e-1947.95vacuolar protein sorting 25 homolog [Source:HGNC S... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps-255.671e-5041.28Related to yeast Vacuolar Protein Sorting factor ... [more]
vps-255.671e-5041.28Related to yeast Vacuolar Protein Sorting factor ... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Vps259.798e-5442.29gene:FBgn0022027 transcript:FBtr0088694[more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps251.185e-6853.18vacuolar protein sorting 25 homolog [Source:NCBI g... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
siglec104.623e-6550.87sialic acid binding Ig-like lectin 10 [Source:Xenb... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vps251.940e-6651.14vacuolar protein sorting 25 [Source:MGI Symbol;Acc... [more]
Vps252.650e-6348.91vacuolar protein sorting 25 [Source:MGI Symbol;Acc... [more]
Vps254.453e-5353.24vacuolar protein sorting 25 [Source:MGI Symbol;Acc... [more]
Vps252.870e-5253.24vacuolar protein sorting 25 [Source:MGI Symbol;Acc... [more]
Vps251.435e-4047.66vacuolar protein sorting 25 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NWF4|VPS25_DANRE8.105e-6853.18Vacuolar protein-sorting-associated protein 25 OS=... [more]
sp|Q9BRG1|VPS25_HUMAN2.340e-6651.70Vacuolar protein-sorting-associated protein 25 OS=... [more]
sp|Q5E9A6|VPS25_BOVIN1.103e-6551.14Vacuolar protein-sorting-associated protein 25 OS=... [more]
sp|Q9CQ80|VPS25_MOUSE1.357e-6551.14Vacuolar protein-sorting-associated protein 25 OS=... [more]
sp|P0C0A1|VPS25_RAT2.291e-6551.14Vacuolar protein-sorting-associated protein 25 OS=... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183ANU81.753e-6957.63Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3S1B6C53.770e-6954.29Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A4E0S3C85.521e-6956.50Vacuolar protein-sorting-associated protein 25 OS=... [more]
A0A3B4BC527.094e-6954.34Vacuolar protein sorting 25 homolog OS=Periophthal... [more]
A0A5J4P4852.947e-6857.47ESCRT-II complex subunit VPS25 OS=Paragonimus west... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps254.321e-7053.18vacuolar protein sorting 25 homolog [Source:NCBI g... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps252.425e-6350.00vacuolar protein sorting 25 homolog [Source:NCBI g... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VPS251.364e-2229.10Component of the ESCRT-II complex; ESCRT-II is inv... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO458552.122e-6347.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps259.004e-7153.18vacuolar protein sorting 25 homolog [Source:NCBI g... [more]
vps255.993e-6752.41vacuolar protein sorting 25 homolog [Source:NCBI g... [more]
back to top
BLAST of Vacuolar protein sorting 25 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018311.16.101e-130100.00SMESG000018311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025014 ID=SMED30025014|Name=Vacuolar protein sorting 25 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=663bp
TTTTTTTGTTTAAATATAGGCGTTAAATTTTATTTGCGGATTTCTGAAGT
TCCTTAAAAATTTTTTAATTTTTGATGTCGAATTTTGAATGGCCTTGGCA
ATATAATTTCCCACCATTTTTTACTTTGCAGCCAAATGCTGAGACTAGAA
AGAAACAAATAGATGCTTGGTGTCAATTGATATTATCTTATCATCAAAAT
TTCAAGCAGTATACATTAAATGTTAAAGATGCATATCAATCACCTTTATT
TTCAAATAAATCCATAGACAGGAAAGTTAGGTCAGATCTACTAACATGTA
TATTAGATGAATTGCAAAAACGTGGTAATCTTGAATGGACTGATAAGTCA
AAAGTTACATGTAAAATAATTTGGCGAACAACTGAAGAATGGAGTGATTT
GATTTACAAGTGGATTAAAAAAAGTGGAAATGTTAATACAATATGCACTT
TATATGAATTAACGGATGGCGAAGAAACAGAAAATGAGCCATTTCATGGA
TTAGATAAAGATATACTGATTTCGGCAATCCGAATTCTGGCAAAAAATAA
GCGAGCTGAATTATTGATCTCTGAAGATCTTGAAGGTGTCAAATTTTTTC
AATGATTTGAAATTAATTAAAAAACAAAATGTCTTTTATAATTTAAATAT
TTACTATATTATG
back to top

protein sequence of SMED30025014-orf-1

>SMED30025014-orf-1 ID=SMED30025014-orf-1|Name=SMED30025014-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MSNFEWPWQYNFPPFFTLQPNAETRKKQIDAWCQLILSYHQNFKQYTLNV
KDAYQSPLFSNKSIDRKVRSDLLTCILDELQKRGNLEWTDKSKVTCKIIW
RTTEEWSDLIYKWIKKSGNVNTICTLYELTDGEETENEPFHGLDKDILIS
AIRILAKNKRAELLISEDLEGVKFFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0071985multivesicular body sorting pathway
GO:0006810transport
GO:0015031protein transport
GO:0043328protein targeting to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR008570ESCRT-II_cplx_Vps25-sub
IPR011991WHTH_DNA-bd_dom
IPR014041ESCRT-II_cplx_Vps25-sub_N
Vocabulary: cellular component
TermDefinition
GO:0000814ESCRT II complex
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
GO:0042803protein homodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008570ESCRT-II complex, Vps25 subunitPFAMPF05871ESCRT-IIcoord: 9..144
e-value: 4.1E-50
score: 169.7
IPR008570ESCRT-II complex, Vps25 subunitPANTHERPTHR13149VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN VPS25coord: 2..175
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 99..175
e-value: 1.0E-30
score: 107.2
IPR014041ESCRT-II complex, Vps25 subunit, N-terminal winged helixGENE3DG3DSA:1.10.10.570coord: 1..98
e-value: 4.7E-36
score: 125.3
NoneNo IPR availablePANTHERPTHR13149:SF0VACUOLAR PROTEIN-SORTING-ASSOCIATED PROTEIN 25coord: 2..175
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 101..174
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 4..106