SMED30025008

Overview
NameSMED30025008
Smed IDSMED30025008
Length (bp)1275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025008 (SMED30025008) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025008 (SMED30025008) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025008 (SMED30025008) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025008 (SMED30025008) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025008

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025008h1SMcG0009657 dd_Smed_v4_9692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025008h1SMcG0009657 dd_Smed_v4_9692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025008h1SMcG0009657 dd_Smed_v4_9692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025008h1SMcG0009657 dd_Smed_v4_9692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30025008h1SMcG0009657 dd_Smed_v4_9692_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025008 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003841:15660..21902 -6234
Homology
BLAST of SMED30025008 vs. TrEMBL
Match: A0A5J4P1M0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006680 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 4.174e-13
Identity = 46/163 (28.22%), Postives = 81/163 (49.69%), Query Frame = 3
Query:  534 LGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNF-QENPIICSQMKNLKNLGK------------GSLAINIKYAFQTGCLTRLEKIVWPSIVV---VILCQSSLSIIC 974
            +GLQ  + L + + ++A+++T+ + W  N   G++++ Q ++P          IQ+ LRCCG +S KD+ I N     G VP SCC+  Q +   C       + GK              L I  ++A+ +GC  R++ ++ P  V    VI+  ++L I+C
Sbjct:  100 IGLQIIALLFVTLFVVAVLYTYLMHWFTNVKVGVTFSVQQFNPGDHDRMTMAGIQRGLRCCGRESYKDYYIANMAVPAGYVPYSCCDLNQYDDEQCYNSSRSAHRGKLGNRPDSDNRAVDMLVIPKEFAYSSGCEVRIQYVLLPVFVCMSGVIMASTTLCIVC 262          
BLAST of SMED30025008 vs. TrEMBL
Match: A0A4E0S1Q5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_004329 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.056e-13
Identity = 47/165 (28.48%), Postives = 78/165 (47.27%), Query Frame = 3
Query:  534 LGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNL----GKG--------SLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTI 992
            LGLQ  + ++L ++ + +++ F   W  N   G++YA Q + P     +    IQ  L CCG +S KD+ I NE    G VP SCCN Q +     Q  +L  L    GK          L +    AF  GC + L++ + P ++V+     + +++  I  ++
Sbjct:  118 LGLQIFALILLAMLEVGVLYGFLSHWLTNLTVGVTYAVQTFRPGSPGQDDIAAIQTGLHCCGRESYKDYYIANEEIPFGYVPFSCCNTQIHDTEACQNASLTTLKGRIGKAPNSYMVPDQLVVPKHMAFGGGCYSSLQEKILPYVLVLFAVLLTFNLLTTITNSV 282          
BLAST of SMED30025008 vs. TrEMBL
Match: A0A4S2MCS0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000960 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.567e-10
Identity = 31/91 (34.07%), Postives = 53/91 (58.24%), Query Frame = 3
Query:  534 LGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQEN 806
            LGLQ  + L+L ++++A ++    +W A    G+S++ Q ++P   ++     IQ  L+CCG +S +D+ I NE   +  VP SCCN  E+
Sbjct:   34 LGLQIIALLILTVVVVATLYGVATQWIATMPTGVSFSVQEFNPGDPNNMAMANIQNVLKCCGRESYRDYYIANEAIPINWVPFSCCNLNEH 124          
BLAST of SMED30025008 vs. TrEMBL
Match: A0A4Z2D3T8 (Tetraspanin family isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004912 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.762e-10
Identity = 61/229 (26.64%), Postives = 106/229 (46.29%), Query Frame = 3
Query:  534 LGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQ-------ENPIICSQMK---NLKNLGKGSLAINIKY--AFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTILC----ASSD--------LYSKNSTKESK--IVIDPPSMYENVSENKNMKLTSNLAK*QLHLRR 1142
            LG+Q  + + L ++   I++T  V+W  +   G+++A QM+ P    +     IQ+ L CCG  S  D+ + NE      VP SCC+ Q        N  I S+ K    +++  + +L   I Y  A+  GC+ RL+ +  P   ++I C   L  + + +T + C     ++D        L S+N  KE+K    + P    E ++E+    +  +L+  Q  L R
Sbjct:  102 LGIQIFALVFLAVLEGGILYTILVQWLRHLEVGVTFAVQMFQPGLEDNTVMANIQEALHCCGRGSYDDYGVANEAIPKHYVPYSCCDLQTYTIEHCNNASILSKSKLISTIQSTEENNLLYVIPYHMAYTVGCVNRLKHLFLP---IIISCFCLLIFVNLFVTFVNCFYVQKAADEEEYEQNWLNSQNFMKETKEAFCLRPQKQVE-ITEDITTSIRPDLSVFQRQLSR 326          
BLAST of SMED30025008 vs. TrEMBL
Match: A0A504Z003 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_03544 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.142e-10
Identity = 49/147 (33.33%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  354 TMLFATVFLYIIPPLHLFIDSLKHIFNAHXXXXXXXXXXXXXXXXXXXXXXXXXRNEYERLGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCN 794
            T++ AT  +YI  P     +++  I +A+   G L+ LS I +++   GLY +       LGLQ  + ++L ++ + +++ F   W AN   G++YA Q + P          IQ  L CCG +S KD+ I NE    G VP SCCN
Sbjct:   41 TVILATSVVYIHQPWLKLTNAMHSIISANVTLGLLLALSTISVLLGSVGLYTICNRSTLILGLQIFALILLAMLEVGVLYGFLSHWLANLTVGVTYAVQTFRPGSPGQVDIAAIQTGLHCCGRESYKDYYIANEEIPFGYVPFSCCN 187          
BLAST of SMED30025008 vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 48.9062 bits (115), Expect = 3.518e-6
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  558 LVLLIIMIAIIFTFWVEWEANAHFGISY--ATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVV 941
            LV L  ++A I  F    E  A  G +Y  A + Y+   + S   + IQ+ LRCCG K+  D+     YF    +P+SCC    N  +   MK+L   G        K  F TGC   +  ++  ++ V+
Sbjct:   99 LVFLSELVAGISGFIFRHEIKAVMGTAYENAVRSYNGTNSLSVALDTIQRTLRCCGVKNYTDWK-EAPYFISKGIPLSCCKDNGNCTV-EIMKDLDKAG--------KEVFTTGCFALVTTVMESNLGVI 218          
BLAST of SMED30025008 vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 48.521 bits (114), Expect = 4.088e-6
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  558 LVLLIIMIAIIFTFWVEWEANAHFGISY--ATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVV 941
            LV L  ++A I  F    E  A  G +Y  A + Y+   + S   + IQ+ LRCCG K+  D+     YF    +P+SCC    N  +   MK+L   G        K  F TGC   +  ++  ++ V+
Sbjct:   99 LVFLSELVAGISGFIFRHEIKAVMGTAYENAVRSYNGTNSLSVALDTIQRTLRCCGVKNYTDWKEA-PYFISKGIPLSCCKDNGNCTV-EIMKDLDKAG--------KEVFTTGCFALVTTVMESNLGVI 218          
BLAST of SMED30025008 vs. Planmine SMEST
Match: SMESG000051756.1 (SMESG000051756.1)

HSP 1 Score: 374.4 bits (960), Expect = 8.642e-131
Identity = 181/182 (99.45%), Postives = 182/182 (100.00%), Query Frame = 3
Query:  576 MIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTILCASSDLYSKNSTKESKIVIDPPSMYENVSENKNMKLTSNLAK 1121
            MIAIIFTFWVEWEANAHFGISYATQ+YDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTILCASSDLYSKNSTKESKIVIDPPSMYENVSENKNMKLTSNLAK
Sbjct:    1 MIAIIFTFWVEWEANAHFGISYATQIYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTILCASSDLYSKNSTKESKIVIDPPSMYENVSENKNMKLTSNLAK 182          
BLAST of SMED30025008 vs. Planmine SMEST
Match: SMESG000039913.1 (SMESG000039913.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.602e-18
Identity = 46/160 (28.75%), Postives = 82/160 (51.25%), Query Frame = 3
Query:  534 LGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGK----GSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTILCA 1001
            + +Q     +  I+++ +I T    +     +G+++A  MY+P    S+Y E+I+K L+CCG   PKD++   + F   TVP SCC++            +KNL K        I I+ AFQTGCL +   +++P+++V+        +  +I+  + CA
Sbjct:   24 INMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYN-NRDLFDSNTVPFSCCDYYH-----KNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIIINIVYCA 177          
BLAST of SMED30025008 vs. Planmine SMEST
Match: SMESG000039913.1 (SMESG000039913.1)

HSP 1 Score: 83.9593 bits (206), Expect = 9.430e-18
Identity = 47/166 (28.31%), Postives = 83/166 (50.00%), Query Frame = 3
Query:  516 RNEYERLGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGK----GSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIICMILTTILCA 1001
            R     + +Q     +  I+++ +I T    +     +G+++A  MY+P    S+Y E+I+K L+CCG   PKD++   + F   TVP SCC++            +KNL K        I I+ AFQTGCL +   +++P+++V+        +  +I+  + CA
Sbjct:   97 RENSYVINMQTILLSIFWIVLLILIGTSIYGYHIYIDYGLTFAVNMYNPKSPSSQYMEVIEKHLQCCGNLGPKDYN-NRDLFDSNTVPFSCCDYYH-----KNRTTVKNLCKFFEVNYKRIPIELAFQTGCLEKFHDVIFPAMIVISSSLLLSILTNIIINIVYCA 256          
BLAST of SMED30025008 vs. Planmine SMEST
Match: SMESG000043617.1 (SMESG000043617.1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.620e-9
Identity = 50/186 (26.88%), Postives = 82/186 (44.09%), Query Frame = 3
Query:  516 RNEYERLGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTHSEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQMKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSS---LSIICMILTTILCASSDLYSKNSTKESKIVIDPPS 1064
            +N   +L +    +  + I + A++F  W + +      +  A + YD    +S + + +Q  L CCG +   D+   N  F    VP+SCC      II    K   N+ K    INI  A+  GC  +L+ IVW +I  + +   S   L+ + M L  IL   S    +N+ K   I ++  S
Sbjct:   92 KNHICQLFISVIFYFFMAITLGAMLFHTWYDKQIYTKNRVVTAIRSYDWKSFNSHHLDRLQNTLSCCGYEGAADYHQSNNLFLKDNVPLSCCFDNSKSII----KCNPNVTK----INIDNAYPPGCRKQLDSIVWYTIFGIYISLISILFLTFLTMGLLIILEHCSKKTCENTEKTGDIDVENKS 269          
The following BLAST results are available for this feature:
BLAST of SMED30025008 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P1M04.174e-1328.22Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4E0S1Q56.056e-1328.48Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4S2MCS02.567e-1034.07Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2D3T82.762e-1026.64Tetraspanin family isoform 2 OS=Schistosoma japoni... [more]
A0A504Z0034.142e-1033.33Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of SMED30025008 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025008 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tspan73.518e-630.00tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
tspan74.088e-630.00tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
back to top
BLAST of SMED30025008 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051756.18.642e-13199.45SMESG000051756.1[more]
SMESG000039913.12.602e-1828.75SMESG000039913.1[more]
SMESG000039913.19.430e-1828.31SMESG000039913.1[more]
SMESG000043617.14.620e-926.88SMESG000043617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025008 ID=SMED30025008|Name=SMED30025008|organism=Schmidtea mediterranea sexual|type=transcript|length=1275bp
TTTCAATAACTCTCCCAGCTTGTCCAAGGCTGAAATGAATTTCCATACAA
ATCTAGGCTAAAATGGATTTTTGATCCTAATCATGTAAGCAAGTGGGGAA
TCGTATTTATCCGGCATCCCCCTTTTATCAGATTAAATACATCAAATCAA
TTATGAGAAGCGATTTGATTGGTGCTCGTGTGCGCTATAAATGGCATTGA
TCGATCAATCACTGTTGTGGAGAAATGGAAAAATTATTCAATCAATTCAT
TGAAACTTGCGATAAAAAGCTTTCTGAAGCTTGTAAGGTTTGTTTTCCAG
TTTTAAAGATATTAGTCGGGATATTAAATGGCATTATCGTAATACTGGGA
ATTACTATGCTATTTGCTACAGTTTTCTTATATATCATACCACCGCTGCA
TCTATTCATTGATTCTCTAAAACACATTTTTAATGCTCACTCGATTTTTG
GATCGTTGATTATACTTTCTATAATAATAATAATAATTTCTATATCCGGA
CTTTATTTTCTCTACAGAAACGAATATGAAAGACTCGGATTGCAGGGAGC
CAGTTTCCTTGTTCTTCTTATAATTATGATAGCTATCATATTCACATTCT
GGGTGGAATGGGAAGCCAATGCACATTTTGGTATCTCTTATGCAACTCAG
ATGTATGATCCAAACAAGACACACAGCGAATATTATGAAATCATTCAAAA
ATTCCTCCGTTGCTGTGGAGCTAAAAGTCCGAAAGATTTTGACATTGGTA
ATGAATACTTTAAACTTGGTACTGTGCCGATTTCTTGTTGCAACTTTCAA
GAGAACCCAATAATTTGTTCTCAAATGAAAAATTTAAAAAACTTAGGTAA
AGGATCCTTGGCAATAAACATTAAATATGCTTTTCAAACTGGCTGTTTGA
CTAGGTTAGAAAAGATAGTTTGGCCTTCGATTGTTGTGGTGATTCTCTGC
CAGTCTTCACTATCAATCATTTGCATGATATTAACAACAATTCTATGCGC
TTCCAGTGATTTATATTCCAAAAATTCTACAAAAGAATCTAAAATTGTCA
TTGATCCCCCGTCAATGTATGAAAATGTCTCTGAAAACAAGAATATGAAA
CTTACATCGAATCTGGCTAAATAACAACTGCATTTGAGGCGCATGGGTTT
AGGTATATCTCCTATGTCCATATATACGATTTGCCATTTTATTAGTGAAT
AATTCATCTTTACAAATAAACTTTAATGTTAATATTGCTTATGTACCAAT
TTATGATTTCTCTTTTGAAAAAAAA
back to top

protein sequence of SMED30025008-orf-1

>SMED30025008-orf-1 ID=SMED30025008-orf-1|Name=SMED30025008-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MNYSLIKWQIVYMDIGDIPKPMRLKCSCYLARFDVSFIFLFSETFSYIDG
GSMTILDSFVEFLEYKSLEAHRIVVNIMQMIDSEDWQRITTTIEGQTIFS
NLVKQPV*
back to top

protein sequence of SMED30025008-orf-2

>SMED30025008-orf-2 ID=SMED30025008-orf-2|Name=SMED30025008-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=300bp
MEKLFNQFIETCDKKLSEACKVCFPVLKILVGILNGIIVILGITMLFATV
FLYIIPPLHLFIDSLKHIFNAHSIFGSLIILSIIIIIISISGLYFLYRNE
YERLGLQGASFLVLLIIMIAIIFTFWVEWEANAHFGISYATQMYDPNKTH
SEYYEIIQKFLRCCGAKSPKDFDIGNEYFKLGTVPISCCNFQENPIICSQ
MKNLKNLGKGSLAINIKYAFQTGCLTRLEKIVWPSIVVVILCQSSLSIIC
MILTTILCASSDLYSKNSTKESKIVIDPPSMYENVSENKNMKLTSNLAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 27..259
e-value: 2.2E-17
score: 63.6
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 130..209
e-value: 8.7E-7
score: 30.7
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 143..231
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 28..260
NoneNo IPR availablePANTHERPTHR19282:SF286FI23944P1-RELATEDcoord: 28..260
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 104..126