Innexin

Overview
NameInnexin
Smed IDSMED30025007
Length (bp)1329
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30025007) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30025007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30025007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30025007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025007SMESG000001158.1 Contig7030newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025007SMESG000001158.1 Contig7030uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30025007SMESG000001158.1 SmedASXL_020784SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025007SMESG000001158.1 SmedASXL_001022SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025007SMESG000001158.1 SmedASXL_005634SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025007SMESG000001158.1 dd_Smed_v6_53283_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025007SMESG000001158.1 dd_Smed_v6_41056_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30025007SMESG000001158.1 Contig7030newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025007SMESG000001158.1 Contig7030uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 217.624 bits (553), Expect = 1.710e-66
Identity = 115/351 (32.76%), Postives = 183/351 (52.14%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN--EVKYYQWIPIILGIQSLLFSFPCFLWR-YMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTP--VRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y+G PIQCW+P +FT  WE+YTENYCWV NTY+  + S   ++   +   ++ YYQW+P +L +++L F  PC +WR  +   SG+++Q   ++  D    ++ D +A T                  + T   H        R++                 +    R    + L Y+ +K+  LGNV+ Q++++   +G DN  +G   L DLL  R W  SGNFPR+T CDFE + LG    +T+QCVL +NMF EKI+ FLWFWY  +  ++ +S+F WI   F     ++ I+ YL+ ++  + +  +V  F+  FL  D +F +  I  +  D+ A++L   LW
Sbjct:   45 QYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDA-RMMDADARAAT------------------VQTIAGHMEDALEIQREVT------------DVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT-DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALW 363          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 217.624 bits (553), Expect = 1.710e-66
Identity = 115/351 (32.76%), Postives = 183/351 (52.14%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN--EVKYYQWIPIILGIQSLLFSFPCFLWR-YMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTP--VRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y+G PIQCW+P +FT  WE+YTENYCWV NTY+  + S   ++   +   ++ YYQW+P +L +++L F  PC +WR  +   SG+++Q   ++  D    ++ D +A T                  + T   H        R++                 +    R    + L Y+ +K+  LGNV+ Q++++   +G DN  +G   L DLL  R W  SGNFPR+T CDFE + LG    +T+QCVL +NMF EKI+ FLWFWY  +  ++ +S+F WI   F     ++ I+ YL+ ++  + +  +V  F+  FL  D +F +  I  +  D+ A++L   LW
Sbjct:   45 QYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDA-RMMDADARAAT------------------VQTIAGHMEDALEIQREVT------------DVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT-DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALW 363          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 216.853 bits (551), Expect = 1.141e-65
Identity = 115/351 (32.76%), Postives = 183/351 (52.14%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN--EVKYYQWIPIILGIQSLLFSFPCFLWRYMSS-RSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTP--VRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y+G PIQCW+P +FT  WE+YTENYCWV NTY+  + S   ++   +   ++ YYQW+P +L +++L F  PC +WR +    SG+++Q   ++  D    ++ D +A T                  + T   H        R++                 +    R    + L Y+ +K+  LGNV+ Q++++   +G DN  +G   L DLL  R W  SGNFPR+T CDFE + LG    +T+QCVL +NMF EKI+ FLWFWY  +  ++ +S+F WI   F     ++ I+ YL+ ++  + +  +V  F+  FL  D +F +  I  +  D+ A++L   LW
Sbjct:   45 QYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDA-RMMDADARAAT------------------VQTIAGHMEDALEIQREVT------------DVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT-DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALW 363          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 211.46 bits (537), Expect = 5.225e-64
Identity = 126/354 (35.59%), Postives = 184/354 (51.98%), Query Frame = 1
Query:   46 YIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSID---SKSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVR--LIKNYLK----FSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
            Y+G+PIQCWIP +FT  WE+Y+ENYC+V NTYF S D     S + +    E+ YYQW+P ILG+Q++LF  P   WR M+  SGV L+K   +L     +   D+KA  + +K               ST  + +  LT  +R  K+   F               + G   L   YL +K   L  ++FQ  ++   +G     +G   L D+L  R W ESG+FPR+T CDFE + LG   ++T+QCVL +NMF EK+Y FLWFW + + +   L+L  W R+L     R   IK+YL+    FS+ NS     +D F+ + L  D +FI + I  N   + +  +   +W
Sbjct:   44 YVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDR-EGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKK---MLFGAKKADRVDEKARNEAAK---------------STGAHLYESLTLQSRFAKYTSAF---------------TYGGSYLTYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMW 363          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 207.223 bits (526), Expect = 4.449e-62
Identity = 109/354 (30.79%), Postives = 187/354 (52.82%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDS--KSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLL--NDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNW-CFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
             Y+G PI+C++P +FT+  E+YTENYCWV NTY+          +    + ++ YYQW+P +L + +L F  P  +WR ++ +SG++    L+L+  ++ V+ V  D K V  +++ + + ++ +  H      R H  ++ +  +  KF+G +V                        Y+ +K  +L NV+ Q  L+   +   ++  FGA  L+DL   R W +SG FPR+T CDFE + LG   ++T+QCVL +NM  EKI+ FLW W   + ++  L+L  W   L     R  ++++  S     ++  +  F+  FL  D +F+L  I  +  +L A+++TEQLW I+
Sbjct:   51 QYVGHPIECFVPAQFTRAMEQYTENYCWVQNTYWVPFQDLIPHRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGLNAGLVLQLVCGDENVDPVVRD-KTVDIVARHIDDALMYQRDHGA----RRHSVYIFAIFKLGKFYGAYVSS---------------------VYIFIKALHLANVILQFMLLNSFLQTSDYPMFGAHVLYDLFMGREWRDSGKFPRVTLCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCR--EHFV--SKHLDIQSDQISRFVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIF 374          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 74.7146 bits (182), Expect = 2.160e-14
Identity = 87/365 (23.84%), Postives = 148/365 (40.55%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTY-----FYSIDSKSSVKKF------SQNEVKY---YQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGV--NSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTL-FDLL--CQRYWTESGNFPRITFCDFET-KKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQL 1077
             YIG PI C I  E   G     + YCW+ +T+        I  +  V+         ++EVKY   YQW+  +L  Q++LF  P +LW+   S  G  L+  +  LN  +  +  +ND+K +  +   + NL            NR+++Y                                        + + +  N  NV+ QIY +   +  +   +G+  L F  L   +R    +  FP++T C F      G    +   CVLP+N+  EKIY FLWFW++ + +++ +SL   I  +    +R    +L    ++    S     + +  N+   F+LY +  NI  L   ++   L
Sbjct:   46 QYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL-VDYFIGNL------------NRHNFY-------------------------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 74.7146 bits (182), Expect = 2.160e-14
Identity = 87/365 (23.84%), Postives = 148/365 (40.55%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTY-----FYSIDSKSSVKKF------SQNEVKY---YQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGV--NSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTL-FDLL--CQRYWTESGNFPRITFCDFET-KKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQL 1077
             YIG PI C I  E   G     + YCW+ +T+        I  +  V+         ++EVKY   YQW+  +L  Q++LF  P +LW+   S  G  L+  +  LN  +  +  +ND+K +  +   + NL            NR+++Y                                        + + +  N  NV+ QIY +   +  +   +G+  L F  L   +R    +  FP++T C F      G    +   CVLP+N+  EKIY FLWFW++ + +++ +SL   I  +    +R    +L    ++    S     + +  N+   F+LY +  NI  L   ++   L
Sbjct:   46 QYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL-VDYFIGNL------------NRHNFY-------------------------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 74.7146 bits (182), Expect = 2.160e-14
Identity = 87/365 (23.84%), Postives = 148/365 (40.55%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTY-----FYSIDSKSSVKKF------SQNEVKY---YQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGV--NSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTL-FDLL--CQRYWTESGNFPRITFCDFET-KKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQL 1077
             YIG PI C I  E   G     + YCW+ +T+        I  +  V+         ++EVKY   YQW+  +L  Q++LF  P +LW+   S  G  L+  +  LN  +  +  +ND+K +  +   + NL            NR+++Y                                        + + +  N  NV+ QIY +   +  +   +G+  L F  L   +R    +  FP++T C F      G    +   CVLP+N+  EKIY FLWFW++ + +++ +SL   I  +    +R    +L    ++    S     + +  N+   F+LY +  NI  L   ++   L
Sbjct:   46 QYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL-VDYFIGNL------------NRHNFY-------------------------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 74.7146 bits (182), Expect = 2.160e-14
Identity = 87/365 (23.84%), Postives = 148/365 (40.55%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTY-----FYSIDSKSSVKKF------SQNEVKY---YQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGV--NSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTL-FDLL--CQRYWTESGNFPRITFCDFET-KKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQL 1077
             YIG PI C I  E   G     + YCW+ +T+        I  +  V+         ++EVKY   YQW+  +L  Q++LF  P +LW+   S  G  L+  +  LN  +  +  +ND+K +  +   + NL            NR+++Y                                        + + +  N  NV+ QIY +   +  +   +G+  L F  L   +R    +  FP++T C F      G    +   CVLP+N+  EKIY FLWFW++ + +++ +SL   I  +    +R    +L    ++    S     + +  N+   F+LY +  NI  L   ++   L
Sbjct:   46 QYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLNSPIVNDECKNDRKKIL-VDYFIGNL------------NRHNFY-------------------------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0085350)

HSP 1 Score: 70.8626 bits (172), Expect = 5.658e-13
Identity = 84/367 (22.89%), Postives = 146/367 (39.78%), Query Frame = 1
Query:   43 NYIGKPIQC----WIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVK------------KFSQNEV--KYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTL-FDLLCQ--RYWTESGNFPRITFCDFET-KKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQL 1077
            N IG PI C     IP             +CW+  TY Y+I  +   +            ++ Q +    YYQW+P +L  Q L+F  P ++W+ M           ++++ DG+  + +         +   + ILK  ++S L+T+  + +                                       +Y   ++ N  NV+  I+++ K +G     +G   L F  + Q  R+      FPR+T C F      G   K+   CVL +N+  EKIY FLWFW+   I+L T+S    +  L    +   +  +   +  S +   +   +R  L +    IL+F+  N+S  + S + +QL
Sbjct:   52 NLIGDPISCINDGAIPMHVIN-------TFCWI--TYTYTIPGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNME-------DGKIRMITDGLRGMVS---VPDDYRRDRQDRILKYFVNS-LNTHNGYSF---------------------------------------AYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWF---IILATISGVAVLYSLVVIMMPTTRETIIKRSYRSAQRKEIAGLVRR-LEIGDFLILHFLSQNLSTRSYSDMLQQL 355          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.497e-60
Identity = 119/353 (33.71%), Postives = 186/353 (52.69%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDS--KSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDG-VNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVR---LIKNYLK-FSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y+G PIQCW+P  FT+  E+YTENYCWV NTYF  +      +  +    ++ YYQW+P +L +++LLF  P  +WR +S +SG+ +Q  +++  D  +  +E+  +A+  ++  +   +  K  H  +S NR                   +K   L  C      S G  V  L Y+ +K+    N++ QI+L+   +GN +  +G + L DL+  R W ESG+FPR+T CDFE K LG   ++T+QCVL +NMF EKI+ FLWFWY  +      SLF WI  +   P R    +  YL         ++ ++  F+ HFL  D +F+L  +  +  +L   +L + LW
Sbjct:   47 QYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVK--HQVMSGNR-------------------LKLLNLIICTR----SSGAAVTFL-YISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWI-YISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLW 372          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.688e-55
Identity = 112/355 (31.55%), Postives = 188/355 (52.96%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN--EVKYYQWIPIILGIQSLLFSFPCFLWRYMSS-RSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTP--VRLIKNYLKF----SNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y+G PIQCW+P  FT   E+YTENYCWV NTY+  +      + +S+   ++ YYQW+P IL I++LLF  PC LWR +    SG++LQ  +++  D               ++++ + I  + +++ ++ +      LT+ +R+      F   +    CG           + + Y+ +KV    NVL Q +L+  ++G+++  +G   L DL+    W ++G FPR+T CDFE + LG   ++T+QCVL +NMF EKI+ FLWFW+L   ++   +   WI  +F     +  ++ YL+       K   ++ T+  F  +FL  D +F+L  I  +  +L +S+L   LW
Sbjct:  165 QYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACD---------------ARLMDSEIKTRTVYT-MARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCG-----RHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALW 498          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 3.126e-52
Identity = 110/364 (30.22%), Postives = 178/364 (48.90%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSK--SSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTI---KFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMIL---LNTL----------SLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y+G  IQCW+P EF  GWE+Y E+YC++ NT+F    S+    V+   + E+ YYQW+PI+L IQ+ +F  P ++W  +  + G+D             SV ++ +A                + S+ S  R         N+ + F G  +  R   + G     +F      +  + Y+ +K+  L NV  Q  ++ K +GN+ + +G  T  DL   R W +SG FPR+T CDF  +KL    +YT+QCVL +NMF EKIY F+WFW++F+++   +NTL          S   +IR L   PV   K+          E + +  F  + L  D + ++ FI  +   +   ++ E+L+
Sbjct:   47 QYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFP-----------SVISEAEA----------------LRSQDSETRT-----KGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKD----------EKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF 368          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.057e-49
Identity = 110/361 (30.47%), Postives = 178/361 (49.31%), Query Frame = 1
Query:   52 GKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN-----EVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIG-NDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLF--CTPVRLIKNYLK------FSNKNS-YENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
            G+PI+C  P +F   WE+Y ENYCW  +TYF       S+ K  +      ++ YYQW+P  L +Q+  F  P +LW+Y S+ SG+ + + ++   D  N        V +  +  + LILK+ + S L    N        ++ + F  +       +  G I +           YL  KV    NV  Q+YLM   +G N +  +G   + D++    W  SG FPR   CDFE +++    +Y++QCVL +N+F EKI+  LWFWY+ ++L +T+SL  W   L   C     +K +L       F+ +NS  E+S V  F+  +L+ D +F+L  +  +   + A+ L + L+  Y
Sbjct:   49 GRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSAN--------VEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNF------QYSSGFISW----------IYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 173.326 bits (438), Expect = 6.534e-48
Identity = 112/379 (29.55%), Postives = 182/379 (48.02%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTY----FYSIDSKSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVE--NDQKAVTQLS-KMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLS--YLIMKVFNLGNVLFQIYLMKKVIGNDNWCF-GAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLF--CTPVRLIKNYLKFSNKNSY-------ENSTV--------------DHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLW 1080
             Y G PI+CW+     +  EEY E+YCW+ NTY    + ++    + ++  + ++ YYQW+P IL  ++L+FS PC  WR  S +SG+++Q  +    D    ++  + QKAV  ++   + NL                   L S N +I+  GW  +         IKF SR     C+S  Y   K+    NV+ Q +++   + +  + F G + L D+   R WTE+G+FPR+T CDFE + L    +YT+QC L +N+  EK++ FLW WY+ + ++ T S   WI   F     V  +  +++ +  + Y       +++TV              D F+  FL  D I +L  I  +  D+   QL   LW
Sbjct:   47 QYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTARE--EKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNL------------------DLQSPNGRIRARGWIAR---------IKF-SRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLW 395          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 4.812e-88
Identity = 164/387 (42.38%), Postives = 239/387 (61.76%), Query Frame = 1
Query:   46 YIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQNE--VKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSV--ENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPV---RLIKNYLKFSN-KNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIYXXXXXXXXXXXXXXSNYFGLGSRVPSLMIND 1182
            Y+GKPIQCWIPQEFT+GWEEYTENYCWVSNTYF SI ++   K  ++NE  + YYQW PI+LG+QSLLF  PC +WR +S +SG ++++ L++ +D   S+  E  QK+++ +++ +   + +  I  +      H + + S  ++ KF     K R +   G ++    GN  L + Y+ +K   L N++ Q+YLM+K IG     +G + L+DL+    W  SGNFPR+TFCD E KKLGKN  Y++QCVLPMNMF+EKIY FLWFW++ + +    SLF WIRR+  +PV   ++I+NYL+  N  +  +      F   +L  D  F++  I INI DL A  L  ++W IY  +  Q+  E    S    + SR+PSLM+N+
Sbjct:   89 YVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKD-TRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYE------HKHFMRSNGKRSKFSRCLAKLRCICCLGKLQ----GN-FLTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRI-GSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTS--LNVESRLPSLMLNN 460          
BLAST of Innexin vs. TrEMBL
Match: A0A3P8HMG7 (Innexin OS=Echinostoma caproni OX=27848 GN=inx PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.009e-77
Identity = 137/352 (38.92%), Postives = 197/352 (55.97%), Query Frame = 1
Query:   49 IGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSK-SSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDG-VNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCT--PVRLIKNYLKFSNKNSYENSTVDH-FIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
            +GKPIQCWIPQEFT+GWEEY ENYCWVSNTYF  I ++           + YYQW PI++ IQ++ F  PC +WR   ++SG ++++ L++  D  V   E+  K V  +++ +   I +    +    +   W                  C     CG      R    L + Y  +KV  L N++ Q+++M+K +GN+   +G + L DL+  R W  SGNFPR+TFCDFE KKLGKN KYT+QCVLP+NMF+EKIY FLWFW+  + L+   S  +W  R+      V+ I+ YLK  +     +    H F+ ++L  D +F++  I IN+ DL A  L  +LW IY
Sbjct:   16 LGKPIQCWIPQEFTRGWEEYAENYCWVSNTYFAPIQNRLPPAPDREMLLIGYYQWAPIVMAIQAMAFYLPCLIWRLFMAQSGFNVRRILQMACDSNVLLPEHTMKNVRFIARYMEGCIYRHTFRAGTDGSGTGW-----------------GC-----CG-----KRHGNYLVVLYFFIKVLYLTNIVGQLFMMEKFVGNNYTFYGLRVLIDLIKGREWFHSGNFPRVTFCDFEAKKLGKNHKYTLQCVLPLNMFLEKIYIFLWFWHCMVGLVTLSSFIMWFYRMGFPNRRVKFIRKYLKIMSVLRDTDKAASHKFVENYLRPDGVFLIRLIAINVGDLMAGDLACELWHIY 340          
BLAST of Innexin vs. TrEMBL
Match: A0A183ANF5 (Innexin OS=Echinostoma caproni OX=27848 GN=inx PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.064e-77
Identity = 137/352 (38.92%), Postives = 197/352 (55.97%), Query Frame = 1
Query:   49 IGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSK-SSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDG-VNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCT--PVRLIKNYLKFSNKNSYENSTVDH-FIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
            +GKPIQCWIPQEFT+GWEEY ENYCWVSNTYF  I ++           + YYQW PI++ IQ++ F  PC +WR   ++SG ++++ L++  D  V   E+  K V  +++ +   I +    +    +   W                  C     CG      R    L + Y  +KV  L N++ Q+++M+K +GN+   +G + L DL+  R W  SGNFPR+TFCDFE KKLGKN KYT+QCVLP+NMF+EKIY FLWFW+  + L+   S  +W  R+      V+ I+ YLK  +     +    H F+ ++L  D +F++  I IN+ DL A  L  +LW IY
Sbjct:   16 LGKPIQCWIPQEFTRGWEEYAENYCWVSNTYFAPIQNRLPPAPDREMLLIGYYQWAPIVMAIQAMAFYLPCLIWRLFMAQSGFNVRRILQMACDSNVLLPEHTMKNVRFIARYMEGCIYRHTFRAGTDGSGTGW-----------------GC-----CG-----KRHGNYLVVLYFFIKVLYLTNIVGQLFMMEKFVGNNYTFYGLRVLIDLIKGREWFHSGNFPRVTFCDFEAKKLGKNHKYTLQCVLPLNMFLEKIYIFLWFWHCMVGLVTLSSFIMWFYRMGFPNRRVKFIRKYLKIMSVLRDTDKAASHKFVENYLRPDGVFLIRLIAINVGDLMAGDLACELWHIY 340          
BLAST of Innexin vs. TrEMBL
Match: A0A5K3EJF9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.128e-77
Identity = 141/359 (39.28%), Postives = 201/359 (55.99%), Query Frame = 1
Query:   49 IGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSK--SSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDG-----VNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFF--GWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRL--IKNYLK-FSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
            +GKPIQCWIPQEFT+GWEEY ENYCWVSNTYF  +  +   ++     + + YYQW PI++ IQ+LLF  PC +WR  +S SG ++++ +++ ND       + V+N + +  +  K+  N I +                LTS   + +    G     R    CG      R    L + Y  +K   L N++ Q+ LM+K IG +   +G + L DLL    W  SGNFPR+TFCDFE KKLGKN  YTIQCVLP+NMF+EKI+ FLWFW+  + ++  ++   W  R+     RL  I+ YLK  S     + +T   F+ +FL  D IF++  I +N+ D+ A  L  +LW IY
Sbjct:    1 LGKPIQCWIPQEFTRGWEEYAENYCWVSNTYFSPLPKRLPPTMADRENSRILYYQWAPILMAIQALLFYLPCLIWRLFNSHSGFNVRRIMQMANDSNLLLPEHGVKNSRPSHRRTRKLPLNPITESSPAGACG--------LTSPAERAELARRGGKSTSRSYNCCG-----RRSGNFLVVLYFFVKGLYLINIVGQLILMEKFIGTNTAFYGIRVLIDLLQGSDWHTSGNFPRVTFCDFEAKKLGKNQLYTIQCVLPLNMFLEKIFIFLWFWHCTLGVITLITFINWFLRMGFARYRLKFIRRYLKIMSVMKDTDKTTSKKFVENFLRPDGIFLIRLISMNVGDMMAGDLACELWQIY 346          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N2 (Innexin OS=Dugesia japonica OX=6161 GN=inx2 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 2.198e-74
Identity = 138/353 (39.09%), Postives = 203/353 (57.51%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQNE-VKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRL--IKNYLKFSNK-NSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
             Y+GKPIQCWIPQEFT+GWEEY+ENYCWV++TYF  I  K   K   Q   + YYQW PIIL IQ  LF  P  +W+  S  S  +L K + L  + ++S     K++   ++ +   I ++    K S+++             K F W  K +       I         L   Y  +K+  +GN++ Q+YLM+++ G+    FG + L DL+    W  SGNFPR+TFCD ETKKLGKN  YT+QCVLPMN+F+EKIY FLWFW++ ++++ + SLF W  +L     RL  I+ YL+F N     + ST   F+  +L +D +F+++ + ++  +L A+ +  +LW IY
Sbjct:   84 QYVGKPIQCWIPQEFTRGWEEYSENYCWVASTYFAPISEKLPSKVDRQKRLIGYYQWAPIILAIQGFLFYMPYLIWKSCSYYSIYNLPKLISLTEENLDS--EASKSIVFTARYIDLCIQRQRKLKKSSSSQ------CIKTACYKSFSW-AKPKNCVISQHIHIGRLYGNFLISLYCFVKLLYIGNIIGQLYLMERIFGSSKSFFGIRILMDLIKGMEWHHSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHIALVIITSTSLFWWFIKLGTLGRRLKTIRKYLQFQNAIGDTDKSTTRKFVAKYLQIDGVFLVHMMALSDGELVAAGMVAELWNIY 427          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000001158.1 (SMESG000001158.1)

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 391/394 (99.24%), Postives = 393/394 (99.75%), Query Frame = 1
Query:   49 IGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIYXXXXXXXXXXXXXXSNYFGLGSRVPSLMINDQLFNPPQDNENTVDIL 1230
            +GKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRK FKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNK+SYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIYFFQNEQKENEENKFSNYFGLGSRVPSLMINDQLFNPPQDNENTVDIL
Sbjct:   80 VGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKFFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRLIKNYLKFSNKSSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIYFFQNEQKENEENKFSNYFGLGSRVPSLMINDQLFNPPQDNENTVDIL 473          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 282.337 bits (721), Expect = 4.368e-90
Identity = 160/387 (41.34%), Postives = 233/387 (60.21%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQNE-VKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSV--ENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPV---RLIKNYLKFSN-KNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIYXXXXXXXXXXXXXXSNYFGLGSRVPSLMIND 1182
             Y+GKPIQCWIPQEFT+GWEEYTENYCWVSNTYF SI ++   K   + + + YYQW PI+LG+QSLLF  PC +WR +S +SG ++++ L++ +D   S+  E  QK+++ +++ +   + +  I  +         H   TN K        +C    +C       +GN  L + Y+ +K+  L N++ Q+YLM+K IG     +G + L+DL+    W  SGNFPR+TFCD E KKLGKN  Y++QCVLPMNMF+EKIY FLWFW++ + +    SLF WI+R+  +PV   ++I+NYL+  N  +  +      F   +L  D  F++  I INI DL A  L  ++W IY  +  Q+  E    S    + SR+PSLM+N+
Sbjct:   88 QYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHK-------HFMRTNGKRSTIS---RCLAKLRCICCLGKLQGN-FLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRI-GSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTS--LNVESRLPSLMLNN 460          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000055266.1 (SMESG000055266.1)

HSP 1 Score: 246.128 bits (627), Expect = 6.048e-77
Identity = 138/354 (38.98%), Postives = 209/354 (59.04%), Query Frame = 1
Query:   52 GKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN-EVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVEND--QKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWFVKCRKL--FKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCT--PVRLIKNYLKFSN-KNSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
            GKPIQCWIPQEFT+GWEEY E+YCW+S+TYF  +D +       Q+ ++ YYQW  I+L +Q+LLF  PC +WR +  +SG +LQ+ +++  D  N++  D  QK++  ++  +   + +K I+                       G+  K ++L  +  G     + GN  L   Y+I+KV  L NV+ Q+YLM++ IG     +G + L+DL+    W +SG+FPRITFCDF+TKKLGKN  YT+QCVLP+NMF+EKI+  LWFW + +  +  +SL  W+ +L       R I++YLK        E S   +FI  +L  D +FI++ I IN+ D+ A+ +  +LW +Y
Sbjct:   43 GKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDA-NAIIPDHLQKSIKFIAIHMDKCLKRKKIYGT---------------------GYKAKFKRLLSYVNGGCCARNSGN-YLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLY 373          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000045304.1 (SMESG000045304.1)

HSP 1 Score: 248.054 bits (632), Expect = 7.722e-77
Identity = 137/375 (36.53%), Postives = 214/375 (57.07%), Query Frame = 1
Query:   46 YIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVK-KFSQNEVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSV-----------ENDQKAVTQLSKMLHNLILKKDIHS----------KLSTNRNHWYHLTST--NRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRL--IKNYLKFSNK-NSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIY 1089
            YIGKPIQCWIPQEFT+GWEEY ENYCW++NTYF +I  +   K    +  + YYQW PI + +Q+L+F  PC +WR ++ +SG ++++ +++ +   N +            +   A   + + + N IL++ + S          K   N +  + ++++  +R     G F  C     CG       GN ++ L Y+ +K   L N++ Q+Y+M+  IG     +G + L DL+  ++W  SG+FPR+TFCD E KKLGKN  YT+QCVLPMNMF+EKI+ FLWFW++ + ++N LS+  W R++     R+  I+  L+ S      + S    F+  +L  D++FIL  I  NI ++  + LT +LW IY
Sbjct:   51 YIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPISNSCCSRCCANHGCFESC-----CGR----RNGNYLISL-YITVKFLYLINIIIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIVNFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIY 415          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000059204.1 (SMESG000059204.1)

HSP 1 Score: 244.973 bits (624), Expect = 3.862e-76
Identity = 145/400 (36.25%), Postives = 210/400 (52.50%), Query Frame = 1
Query:   43 NYIGKPIQCWIPQEFTQGWEEYTENYCWVSNTYFYSIDSKSSVKKFSQN-EVKYYQWIPIILGIQSLLFSFPCFLWRYMSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKLSTNRNHWYHLTSTNRKIKFFGWF----VKCRKLFKCGTIK-----------------FPSRGNKVLCLSYLIMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPRITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLSLFLWIRRLFCTPVRL--IKNYLKFSNK-NSYENSTVDHFIRHFLNMDMIFILYFIRINISDLTASQLTEQLWCIYXXXXXXXXXXXXXXSNYFGLGSRVPS 1167
             Y+GKPIQCW PQEFT+GWEEY ENYCWVSNTY+ S+  +   K   +   + YYQW  I LG+Q+LLF  PC +WR + ++S  ++++                  + Q+S    ++I+     S+ S N       +S+N  IKF   +    ++ R L +C   K                    +    L + YL +K+  + N + Q+YLM+  IG  N  +G   L DLL  R+W ESG+FPR+TFCDF+ KKLGKN  YT+QCVLP+NM +EKI+  LWFW + + ++N  S   W  RL  +  R+  I+ +L       S +     HF+ H+L  D++FI+  I  N  +  ASQL  +LW IY  +   +  +       FG GS  PS
Sbjct:   50 QYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRR------------------IIQMSASATDIIMPL---SEKSGN-------SSSNTSIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCLSILYLFIKLLYILNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKIFIILWFWIVLLAIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMK-----FGHGSLSPS 416          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.710e-6632.76Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.710e-6632.76Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.141e-6532.76Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-135.225e-6435.59Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
inx-184.449e-6230.79Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx22.160e-1423.84gene:FBgn0027108 transcript:FBtr0301860[more]
Inx22.160e-1423.84gene:FBgn0027108 transcript:FBtr0071005[more]
Inx22.160e-1423.84gene:FBgn0027108 transcript:FBtr0332314[more]
Inx22.160e-1423.84gene:FBgn0027108 transcript:FBtr0071006[more]
Inx35.658e-1322.89gene:FBgn0265274 transcript:FBtr0085350[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.497e-6033.71Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL2.688e-5531.55Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL3.126e-5230.22Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23157|INX11_CAEEL2.057e-4930.47Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|A8WVX4|INX19_CAEBR6.534e-4829.55Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6N14.812e-8842.38Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
A0A3P8HMG71.009e-7738.92Innexin OS=Echinostoma caproni OX=27848 GN=inx PE=... [more]
A0A183ANF51.064e-7738.92Innexin OS=Echinostoma caproni OX=27848 GN=inx PE=... [more]
A0A5K3EJF91.128e-7739.28Uncharacterized protein OS=Mesocestoides corti OX=... [more]
Q2L6N22.198e-7439.09Innexin OS=Dugesia japonica OX=6161 GN=inx2 PE=2 S... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001158.10.000e+099.24SMESG000001158.1[more]
SMESG000060499.14.368e-9041.34SMESG000060499.1[more]
SMESG000055266.16.048e-7738.98SMESG000055266.1[more]
SMESG000045304.17.722e-7736.53SMESG000045304.1[more]
SMESG000059204.13.862e-7636.25SMESG000059204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025007 ID=SMED30025007|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1329bp
GATCTAAATTTTTAAAAGATGTATAGGAAATTTAGACGTTAAAATTACAT
AGGAAAACCAATTCAATGTTGGATTCCTCAAGAGTTTACTCAAGGATGGG
AAGAATATACCGAAAACTATTGCTGGGTGTCAAACACTTATTTCTATTCA
ATTGACTCTAAATCTTCTGTAAAGAAATTCTCCCAAAATGAAGTTAAATA
TTATCAATGGATTCCGATTATTCTAGGAATACAATCCTTACTTTTTTCCT
TTCCGTGTTTCCTCTGGCGATACATGAGCTCAAGATCAGGAGTCGATTTA
CAGAAAACATTGAAACTGCTTAATGATGGAGTAAACAGTGTGGAAAACGA
TCAGAAAGCAGTGACTCAATTGAGCAAAATGTTACATAATCTAATTTTAA
AGAAAGACATTCACTCAAAACTGTCAACAAACCGAAATCACTGGTACCAT
TTGACTAGCACAAATAGAAAAATAAAATTTTTCGGTTGGTTTGTTAAATG
CCGAAAACTTTTCAAATGCGGAACAATAAAATTCCCATCCAGAGGAAACA
AAGTTCTTTGCTTGAGCTATCTGATAATGAAAGTTTTCAATTTGGGAAAC
GTATTGTTTCAGATATATCTAATGAAAAAGGTCATTGGAAATGATAATTG
GTGCTTTGGTGCCAAAACTTTATTTGATTTACTGTGTCAAAGATATTGGA
CAGAATCTGGAAATTTTCCCAGAATAACCTTTTGTGATTTTGAAACGAAA
AAACTCGGCAAAAATCTCAAATATACGATTCAGTGTGTTCTCCCAATGAA
TATGTTTGTAGAAAAGATTTACACATTTCTTTGGTTTTGGTATCTCTTCA
TGATTTTGCTGAATACTCTGAGTTTATTTCTCTGGATTCGACGATTGTTC
TGCACTCCAGTACGGTTGATAAAAAACTACCTGAAATTTTCGAACAAAAA
CAGTTATGAAAACAGCACAGTTGATCATTTCATCCGCCATTTTCTCAATA
TGGACATGATTTTTATTCTATACTTTATTAGGATCAACATCAGCGACTTG
ACGGCCTCTCAGTTGACAGAGCAGCTTTGGTGCATTTATTTCTTTCAGAA
CGAGCAGAAAGAAAATGAAGAGAATAAATTTTCTAACTATTTTGGATTGG
GATCTCGAGTCCCGAGCTTGATGATAAACGATCAGTTGTTTAATCCCCCC
CAGGATAATGAAAATACCGTTGACATTTTGTGAATACATTTTCCACAAAA
GATTTTCGTGTATATAATACATCCAATGGTATTTATTAATTGCAACAAAA
CAAATTGACGAAAATAATATAAATCTGAT
back to top

protein sequence of SMED30025007-orf-1

>SMED30025007-orf-1 ID=SMED30025007-orf-1|Name=SMED30025007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MSSRSGVDLQKTLKLLNDGVNSVENDQKAVTQLSKMLHNLILKKDIHSKL
STNRNHWYHLTSTNRKIKFFGWFVKCRKLFKCGTIKFPSRGNKVLCLSYL
IMKVFNLGNVLFQIYLMKKVIGNDNWCFGAKTLFDLLCQRYWTESGNFPR
ITFCDFETKKLGKNLKYTIQCVLPMNMFVEKIYTFLWFWYLFMILLNTLS
LFLWIRRLFCTPVRLIKNYLKFSNKNSYENSTVDHFIRHFLNMDMIFILY
FIRINISDLTASQLTEQLWCIYFFQNEQKENEENKFSNYFGLGSRVPSLM
INDQLFNPPQDNENTVDIL*
back to top

protein sequence of SMED30025007-orf-2

>SMED30025007-orf-2 ID=SMED30025007-orf-2|Name=SMED30025007-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
IRFILFSSICFVAINKYHWMYYIHENLLWKMYSQNVNGIFIILGGIKQLI
VYHQARDSRSQSKIVRKFILFIFFLLVLKEINAPKLLCQLRGRQVADVDP
NKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 171..187
score: 60.71
coord: 99..113
score: 38.93
coord: 147..156
score: 66.8
IPR000990InnexinPFAMPF00876Innexincoord: 3..271
e-value: 9.8E-57
score: 192.8
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 2..283
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 1..278
score: 17.535
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 94..116