Armadillo repeat-containing protein 3

Overview
NameArmadillo repeat-containing protein 3
Smed IDSMED30025001
Length (bp)2826
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat-containing protein 3 (SMED30025001) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 3 (SMED30025001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo repeat-containing protein 3 (SMED30025001) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 3 (SMED30025001) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025001SMESG000079416.1 SmedASXL_016482SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025001SMESG000079416.1 dd_Smed_v6_9679_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025001SMESG000079416.1 dd_Smed_v4_9679_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Human
Match: ARMC3 (armadillo repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:30964])

HSP 1 Score: 403.29 bits (1035), Expect = 7.321e-128
Identity = 261/664 (39.31%), Postives = 410/664 (61.75%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDD 2049
            MGKKIKK+ +   +D FDPL+IES +A TVVLMLNS EE++  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K++RRN+ M+  ++  + +V+K+L+  D ++  ++  L+  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN++ C+  +++DF+ R  L+  N IP +L+LLKSEYPVIQ   L      + D   R ++RD   ++  + I+   ELNDLH+ +L VIA CLED++ + Q++++GGL +LL+F  +S                                      T+P+++ +A KAI KA    + R++FHE + EK LV LL  E++  KIAA+QAI  M +N +     +N  GI QL++L++SD++E++EAA+LALANLT+ N  N    A   G++ L++ LS+ ++G  +NA   ++NMA +EPLR  +Q + ++ A+++PL+S +T VQSKAAL V +   D ++R + RN+GG+  L  LL S N EVR+   WA+ + A ++ +A EL  +GA+ +L+++N S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + + P++   L   +  R ++LINS   K      SS+ D  D
Sbjct:    1 MGKKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEPLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELD-VMNSVIAQLAPEEEVVIHEFASLCLANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPVIQLLALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQIQQTGGLKKLLSFAENS--------------------------------------TIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCEN-SGSKDFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINS---KSYVSPPSSMEDKSD 621          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Human
Match: ARMC3 (armadillo repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:30964])

HSP 1 Score: 403.675 bits (1036), Expect = 6.899e-126
Identity = 261/664 (39.31%), Postives = 410/664 (61.75%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDD 2049
            MGKKIKK+ +   +D FDPL+IES +A TVVLMLNS EE++  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K++RRN+ M+  ++  + +V+K+L+  D ++  ++  L+  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN++ C+  +++DF+ R  L+  N IP +L+LLKSEYPVIQ   L      + D   R ++RD   ++  + I+   ELNDLH+ +L VIA CLED++ + Q++++GGL +LL+F  +S                                      T+P+++ +A KAI KA    + R++FHE + EK LV LL  E++  KIAA+QAI  M +N +     +N  GI QL++L++SD++E++EAA+LALANLT+ N  N    A   G++ L++ LS+ ++G  +NA   ++NMA +EPLR  +Q + ++ A+++PL+S +T VQSKAAL V +   D ++R + RN+GG+  L  LL S N EVR+   WA+ + A ++ +A EL  +GA+ +L+++N S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + + P++   L   +  R ++LINS   K      SS+ D  D
Sbjct:    1 MGKKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEPLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELD-VMNSVIAQLAPEEEVVIHEFASLCLANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPVIQLLALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQIQQTGGLKKLLSFAENS--------------------------------------TIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCEN-SGSKDFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINS---KSYVSPPSSMEDKSD 621          

HSP 2 Score: 132.109 bits (331), Expect = 1.095e-30
Identity = 67/155 (43.23%), Postives = 95/155 (61.29%), Query Frame = 1
Query: 2224 PSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKS-----PKPNMQLFIIDLISDPGRFIPIDSVDGHSYR 2673
            PSD     Y+ EV + I P+  + EQ  +LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNVIPIG +  GI  HRALLFK LAD++ I  +L RGEY R+WNE+ +  +  K      P P M  ++IDL+  PG  + + S +   YR
Sbjct:  718 PSDPDFSMYVYEVTKSILPITNIKEQIEDLAKYVAEKMGGKIPKEKLPDFSWELHISELKFQLKSNVIPIGHVKKGIFYHRALLFKALADRIGIGCSLVRGEYGRAWNEVMLQNDSRKGVIGGLPAPEM--YVIDLMFHPGGLMKLRSREADLYR 870          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Human
Match: ARMC3 (armadillo repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:30964])

HSP 1 Score: 403.29 bits (1035), Expect = 1.033e-125
Identity = 261/664 (39.31%), Postives = 410/664 (61.75%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDD 2049
            MGKKIKK+ +   +D FDPL+IES +A TVVLMLNS EE++  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K++RRN+ M+  ++  + +V+K+L+  D ++  ++  L+  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN++ C+  +++DF+ R  L+  N IP +L+LLKSEYPVIQ   L      + D   R ++RD   ++  + I+   ELNDLH+ +L VIA CLED++ + Q++++GGL +LL+F  +S                                      T+P+++ +A KAI KA    + R++FHE + EK LV LL  E++  KIAA+QAI  M +N +     +N  GI QL++L++SD++E++EAA+LALANLT+ N  N    A   G++ L++ LS+ ++G  +NA   ++NMA +EPLR  +Q + ++ A+++PL+S +T VQSKAAL V +   D ++R + RN+GG+  L  LL S N EVR+   WA+ + A ++ +A EL  +GA+ +L+++N S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + + P++   L   +  R ++LINS   K      SS+ D  D
Sbjct:    1 MGKKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEPLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELD-VMNSVIAQLAPEEEVVIHEFASLCLANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPVIQLLALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQIQQTGGLKKLLSFAENS--------------------------------------TIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCEN-SGSKDFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINS---KSYVSPPSSMEDKSD 621          

HSP 2 Score: 131.724 bits (330), Expect = 1.239e-30
Identity = 67/155 (43.23%), Postives = 95/155 (61.29%), Query Frame = 1
Query: 2224 PSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININE-----GKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYR 2673
            PSD     Y+ EV + I P+  + EQ  +LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNVIPIG +  GI  HRALLFK LAD++ I  +L RGEY R+WNE+ +  +      G  P P M  ++IDL+  PG  + + S +   YR
Sbjct:  711 PSDPDFSMYVYEVTKSILPITNIKEQIEDLAKYVAEKMGGKIPKEKLPDFSWELHISELKFQLKSNVIPIGHVKKGIFYHRALLFKALADRIGIGCSLVRGEYGRAWNEVMLQNDSRKGVIGGLPAPEM--YVIDLMFHPGGLMKLRSREADLYR 863          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Human
Match: ARMC3 (armadillo repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:30964])

HSP 1 Score: 188.348 bits (477), Expect = 6.719e-50
Identity = 137/339 (40.41%), Postives = 220/339 (64.90%), Query Frame = 1
Query: 1033 TLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDD 2049
            T+P+++ +A KAI KA    + R++FHE + EK LV LL  E++  KIAA+QAI  M +N +     +N  GI QL++L++SD++E++EAA+LALANLT+ N  N    A   G++ L++ LS+ ++G  +NA   ++NMA +EPLR  +Q + ++ A+++PL+S +T VQSKAAL V +   D ++R + RN+GG+  L  LL S N EVR+   WA+ + A ++ +A EL  +GA+ +L+++N S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + + P++   L   +  R ++LINS   K      SS+ D  D
Sbjct:   24 TIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCEN-SGSKDFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINS---KSYVSPPSSMEDKSD 358          

HSP 2 Score: 130.954 bits (328), Expect = 7.041e-31
Identity = 67/155 (43.23%), Postives = 95/155 (61.29%), Query Frame = 1
Query: 2224 PSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKS-----PKPNMQLFIIDLISDPGRFIPIDSVDGHSYR 2673
            PSD     Y+ EV + I P+  + EQ  +LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNVIPIG +  GI  HRALLFK LAD++ I  +L RGEY R+WNE+ +  +  K      P P M  ++IDL+  PG  + + S +   YR
Sbjct:  455 PSDPDFSMYVYEVTKSILPITNIKEQIEDLAKYVAEKMGGKIPKEKLPDFSWELHISELKFQLKSNVIPIGHVKKGIFYHRALLFKALADRIGIGCSLVRGEYGRAWNEVMLQNDSRKGVIGGLPAPEM--YVIDLMFHPGGLMKLRSREADLYR 607          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Human
Match: ARMC3 (armadillo repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:30964])

HSP 1 Score: 82.8037 bits (203), Expect = 3.326e-18
Identity = 43/119 (36.13%), Postives = 75/119 (63.03%), Query Frame = 1
Query:  322 MVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPV 678
            M+  ++  + +V+K+L+  D ++  ++  L+  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN++ C+  +++DF+ R  L+  N IP +L+LLKSEYPV
Sbjct:    1 MIFGILASNNDVKKLLRELD-VMNSVIAQLAPEEEVVIHEFASLCLANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPV 118          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Zebrafish
Match: armc3 (armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-110614-1])

HSP 1 Score: 456.447 bits (1173), Expect = 1.252e-146
Identity = 303/877 (34.55%), Postives = 480/877 (54.73%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPL---NGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKK+KK+ +   +D FDPL IES  A T VLML+S EE+V  KACEAI+KFA K DENK  L+ L   + L  L+  E+K++RRN++M L VM  + EV+K LK  D +IP ++  LS  E     EFA L L  L  +++   ++ +++G+  L++ LSS DPDV+KN++ C+  +++D + R  ++  NG+P +L+LL+SE+ VIQ+  L    K + D+      R++    + ++++   E +DLH  +L+VI  CLED E ++  +  GGL +LL  +G S                                      T+ EVK +A KAI K  +  + R++ HE + EK L  LL+ E+E V+ A  QA+  +++NL+ + +  + DGI  +V+L+ S+  EL+ AA+ AL++LT+ N  N   I    G   LV  L +S  G    A +A++NMA++E LR  +  +  + ALV  L S   ++   A   VAS   D+++R + RN GG+ AL  LL S NAE+RR+  WAI++ A+++ +A EL ++GA+++LQ+++ S  + NKFS+ AL +L DSNL+LK++L G+L  +D   + FYD GQ +       +E      +N  R  I +N    KP    +   P+   + +  D T       +  SK    ++   +   +             K+ + +     + LP D      ++E  E I PL+  ++  + LA  V   MGG + QQ +  F +EL IS+LK E  SN++ IG+I  G + HRALLFK LAD++ +  +L RGEYNR+WNE+ I   +        + +IIDL+  PG  +  +S     Y+ +
Sbjct:    1 MGKKVKKEAETCPKDVFDPLSIESKTATTAVLMLSSPEEEVLAKACEAIHKFAEKGDENKTCLMCLGAIEPLSLLISHEDKIVRRNAVMALGVMASNNEVKKHLKCLD-VIPAIISKLSPEENVMVHEFATLCLASLSVDFSYKIQIFESNGLEPLIQLLSSPDPDVKKNSVECIFNLVQDVQNRAAVQRLNGLPPLLDLLRSEFSVIQQLALHTIEKITTDTETCVAFRNVQGFERILEVVAMKEFSDLHEGALRVILNCLEDTESMQLFQTMGGLEQLLQCVGTS--------------------------------------TVAEVKANAVKAIAKMAQSSENRKILHERNIEKTLTDLLTQENESVRTAVCQAVATVSKNLSSRDTFRSLDGIRPIVQLLNSEGSELRMAAAEALSSLTNSNNLNAYAIYDAEGDRLLVRQLQDSCTGAAVYAAMALTNMASQEELRKSILAHEAMPALVELLHSTDNNILISAVQAVASLTCDAEARQELRNVGGLSALVQLLKSINAEIRRNASWAISVCANDEITASELCNVGALEILQEISLSSHRSNKFSQLALQKLLDSNLSLKYSLTGHLSSSDITTDGFYDPGQIRVGHQFPVLEDISKQVVNQHRATIAVNG---KPQNQFIPKGPEEGKQDSPTDTTASSVLNGRRSSKTPSKTKGKGHKEEDEKKKEEDECKPHQKIMVEE----TWSLPYDAAFHNLVKEAAESIMPLKDEVKMYTALAMLVCDAMGGQVEQQKLHDFLWELHISELKFEACSNIVLIGKIKKGTYFHRALLFKVLADRIGLSCSLIRGEYNRAWNEILIMGPKKAYGYSQPESYIIDLMHQPGNLMKSNSQAALIYQSI 831          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 499.59 bits (1285), Expect = 1.208e-163
Identity = 312/851 (36.66%), Postives = 479/851 (56.29%), Query Frame = 1
Query:  154 MLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINS----ILPKPMTP--ALSSIPDSDDKKA-QEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWI--NINEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            ML S EE++  K+C+A+YKFA K +ENK  LL+L   D L +L+  E+K++RRN+ MV  +M  H +VRK+L+  D IIP L+  L+  E     EFA L L Y+  EYT  +++ + +G+  L++ LSS DPDV+KN   C+ L+ ++F++R  +   N IP +LELLKSEYPVIQ+ TL      S +   R I  +   + + + ++   E +DLHV +L VIA CLED+E +  L++SGGL R+L F                                        +  LPE +++A KAI KA + D+ R+ FHE + E++LV +L  +++ VK AA  AI  M +NL  ++ V+N  GI  ++ ++                        +   +A   G++ L++ LS+ ++G+  NA   + NMA +EPLR  L+ +GL+ AL+ PL S +  V SKAAL VAS   D+  R D RN GG+  L  LL  ++ EVRRS CWA+ + AS++ +A EL  +GA+ +LQ+LN S  +RN FSE ALN+L D+NL LK++  GYL +++ I + FYDCG+ KPD+ + P+E      +N  R +ILIN+    + P    P  A+   P S  + A +E  ++ K    K   K K++   + ++  ++L            +      ++ P D  L   + E  ++I PL  + EQ  ELAK V+ +MGGPI ++ +  F +EL IS+LK   +SNVIPIG+I  G   HRALLFK LAD++ I + L RGEY R+WNE+ +  ++ E     P  + +++DL+ +PGR +   S D  +Y+ +
Sbjct:    1 MLQSPEEEILAKSCDALYKFAKKGEENKLALLELGAVDPLSKLISHEDKIVRRNATMVCGIMASHYDVRKLLRKLD-IIPSLIARLTPEEEVVIHEFATLCLAYMAAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSEYPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVLETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEF--------------------------------------AETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESKN-VFNKQGIICIIHVL----------------------FPSISAVAEADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAVAVCASDELTAVELYKLGALDLLQELNLSRSRRNNFSEWALNKLLDNNLPLKYSQKGYLSYSNLIEDGFYDCGRIKPDAKLLPLEELSKQELNQNRAVILINAKSPDLAPAEEKPEQAVVRTPSSHGRSASKEKGSKGKVRLKKEEEKPKEEEEVAQFLQNQSL------------IVSENKDWQPPYDQELNDCLTEASKMILPLSDIKEQVVELAKLVARKMGGPIEKERLHDFSWELHISELKFALKSNVIPIGKIKKGTFYHRALLFKVLADRVGISSCLIRGEYGRAWNEVRLTGSLQEITRGLPPPKTYVVDLMFEPGRLLVHGSADADNYQHI 777          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 445.277 bits (1144), Expect = 9.957e-142
Identity = 266/649 (40.99%), Postives = 394/649 (60.71%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILP 2004
            MGKKIKK+ +   +D FDPL IES +A T VLML S EE++  K+C+A+YKFA K +ENK  LL+L   D L +L+  E+K++RRN+ MV  +M  H +VRK+L+  D IIP L+  L+  E     EFA L L Y+  EYT  +++ + +G+  L++ LSS DPDV+KN   C+ L+ ++F++R  +   N IP +LELLKSEYPVIQ+ TL      S +   R I  +   + + + ++   E +DLHV +L VIA CLED+E +  L++SGGL R+L F                                        +  LPE +++A KAI KA + D+ R+ FHE + E++LV +L  +++ VK AA  AI  M +NL  + +V+N  GI Q++ L+  +  E++E+A+  LANLT+    N   +A   G++ L++ LS+ ++G+  NA   + NMA +EPLR  L+ +GL+ AL+ PL S +  V SKAAL VAS   D+  R D RN GG+  L  LL  ++ EVRRS CWA+ + AS++ +A EL  +GA+ +LQ+LN S  +RN FSE ALN+L D+NL LK++  GYL +++ I + FYDCG+ KPD+ + P+E      +N  R +ILIN+  P
Sbjct:    1 MGKKIKKEVEPPPKDVFDPLPIESKKAATAVLMLQSPEEEILAKSCDALYKFAKKGEENKLALLELGAVDPLSKLISHEDKIVRRNATMVCGIMASHYDVRKLLRKLD-IIPSLIARLTPEEEVVIHEFATLCLAYMAAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSEYPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVLETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEF--------------------------------------AETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESK-NVFNKQGIPQIITLLTRESAEVRESAAFVLANLTTNCPANASAVAEADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAVAVCASDELTAVELYKLGALDLLQELNLSRSRRNNFSEWALNKLLDNNLPLKYSQKGYLSYSNLIEDGFYDCGRIKPDAKLLPLEELSKQELNQNRAVILINAKSP 609          

HSP 2 Score: 130.568 bits (327), Expect = 2.359e-30
Identity = 65/157 (41.40%), Postives = 98/157 (62.42%), Query Frame = 1
Query: 2215 YKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWI--NINEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            ++ P D  L   + E  ++I PL  + EQ  ELAK V+ +MGGPI ++ +  F +EL IS+LK   +SNVIPIG+I  G   HRALLFK LAD++ I + L RGEY R+WNE+ +  ++ E     P  + +++DL+ +PGR +   S D  +Y+ +
Sbjct:  707 WQPPYDQELNDCLTEASKMILPLSDIKEQVVELAKLVARKMGGPIEKERLHDFSWELHISELKFALKSNVIPIGKIKKGTFYHRALLFKVLADRVGISSCLIRGEYGRAWNEVRLTGSLQEITRGLPPPKTYVVDLMFEPGRLLVHGSADADNYQHI 863          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 387.882 bits (995), Expect = 1.033e-123
Identity = 235/585 (40.17%), Postives = 353/585 (60.34%), Query Frame = 1
Query:  154 MLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQ 1908
            ML S EE++  K+C+A+YKFA K +ENK  LL+L   D L +L+  E+K++RRN+ MV  +M  H +VRK+L+  D IIP L+  L+  E     EFA L L Y+  EYT  +++ + +G+  L++ LSS DPDV+KN   C+ L+ ++F++R  +   N IP +LELLKSEYPVIQ+ TL      S +   R I  +   + + + ++   E +DLHV +L VIA CLED+E +  L++SGGL R+L F                                        +  LPE +++A KAI KA + D+ R+ FHE + E++LV +L  +++ VK AA  AI  M +NL  + +V+N  GI Q++ L+  +  E++E+A+  LANLT+    N   +A   G++ L++ LS+ ++G+  NA   + NMA +EPLR  L+ +GL+ AL+ PL S +  V SKAAL VAS   D+  R D RN GG+  L  LL  ++ EVRRS CWA+ + AS++ +A EL  +GA+ +LQ+LN S  +RN FSE ALN+L D+NL LK++  GYL +++ I + FYDCG+
Sbjct:    1 MLQSPEEEILAKSCDALYKFAKKGEENKLALLELGAVDPLSKLISHEDKIVRRNATMVCGIMASHYDVRKLLRKLD-IIPSLIARLTPEEEVVIHEFATLCLAYMAAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSEYPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVLETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEF--------------------------------------AETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESK-NVFNKQGIPQIITLLTRESAEVRESAAFVLANLTTNCPANASAVAEADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAVAVCASDELTAVELYKLGALDLLQELNLSRSRRNNFSEWALNKLLDNNLPLKYSQKGYLSYSNLIEDGFYDCGR 545          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 387.882 bits (995), Expect = 3.203e-121
Identity = 235/585 (40.17%), Postives = 353/585 (60.34%), Query Frame = 1
Query:  154 MLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQ 1908
            ML S EE++  K+C+A+YKFA K +ENK  LL+L   D L +L+  E+K++RRN+ MV  +M  H +VRK+L+  D IIP L+  L+  E     EFA L L Y+  EYT  +++ + +G+  L++ LSS DPDV+KN   C+ L+ ++F++R  +   N IP +LELLKSEYPVIQ+ TL      S +   R I  +   + + + ++   E +DLHV +L VIA CLED+E +  L++SGGL R+L F                                        +  LPE +++A KAI KA + D+ R+ FHE + E++LV +L  +++ VK AA  AI  M +NL  + +V+N  GI Q++ L+  +  E++E+A+  LANLT+    N   +A   G++ L++ LS+ ++G+  NA   + NMA +EPLR  L+ +GL+ AL+ PL S +  V SKAAL VAS   D+  R D RN GG+  L  LL  ++ EVRRS CWA+ + AS++ +A EL  +GA+ +LQ+LN S  +RN FSE ALN+L D+NL LK++  GYL +++ I + FYDCG+
Sbjct:    1 MLQSPEEEILAKSCDALYKFAKKGEENKLALLELGAVDPLSKLISHEDKIVRRNATMVCGIMASHYDVRKLLRKLD-IIPSLIARLTPEEEVVIHEFATLCLAYMAAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSEYPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVLETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEF--------------------------------------AETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESK-NVFNKQGIPQIITLLTRESAEVRESAAFVLANLTTNCPANASAVAEADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAVAVCASDELTAVELYKLGALDLLQELNLSRSRRNNFSEWALNKLLDNNLPLKYSQKGYLSYSNLIEDGFYDCGR 545          

HSP 2 Score: 130.568 bits (327), Expect = 2.040e-30
Identity = 65/157 (41.40%), Postives = 98/157 (62.42%), Query Frame = 1
Query: 2215 YKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWI--NINEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            ++ P D  L   + E  ++I PL  + EQ  ELAK V+ +MGGPI ++ +  F +EL IS+LK   +SNVIPIG+I  G   HRALLFK LAD++ I + L RGEY R+WNE+ +  ++ E     P  + +++DL+ +PGR +   S D  +Y+ +
Sbjct:  602 WQPPYDQELNDCLTEASKMILPLSDIKEQVVELAKLVARKMGGPIEKERLHDFSWELHISELKFALKSNVIPIGKIKKGTFYHRALLFKVLADRVGISSCLIRGEYGRAWNEVRLTGSLQEITRGLPPPKTYVVDLMFEPGRLLVHGSADADNYQHI 758          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 330.872 bits (847), Expect = 3.749e-99
Identity = 214/587 (36.46%), Postives = 327/587 (55.71%), Query Frame = 1
Query:  244 LLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILP 2004
            LL+L   D L +L+  E+K++RRN+ MV  +M  H +                                    + C+  T I ++   +G+  L++ LSS DPDV+KN   C+ L+ ++F++R  +   N IP +LELLKSEYPVIQ+ TL      S +   R I  +   + + + ++   E +DLHV +L VIA CLED+E +  L++SGGL R+L F                                        +  LPE +++A KAI KA + D+ R+ FHE + E++LV +L  +++ VK AA  AI  M +NL  ++ V+N  GI Q++ L+  +  E++E+A+  LANLT+    N   +A   G++ L++ LS+ ++G+  NA   + NMA +EPLR  L+ +GL+ AL+ PL S +  V SKAAL VAS   D+  R D RN GG+  L  LL  ++ EVRRS CWA+ + AS++ +A EL  +GA+ +LQ+LN S  +RN FSE ALN+L D+NL LK++  GYL +++ I + FYDCG+ KPD+ + P+E      +N  R +ILIN+  P
Sbjct:   53 LLELGAVDPLSKLISHEDKIVRRNATMVCGIMASHCK------------------------------------FDCRNKTQIHEL---NGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSEYPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVLETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEF--------------------------------------AETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESKN-VFNKQGIPQIITLLTRESAEVRESAAFVLANLTTNCPANASAVAEADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAVAVCASDELTAVELYKLGALDLLQELNLSRSRRNNFSEWALNKLLDNNLPLKYSQKGYLSYSNLIEDGFYDCGRIKPDAKLLPLEELSKQELNQNRAVILINAKSP 561          

HSP 2 Score: 130.183 bits (326), Expect = 3.011e-30
Identity = 65/157 (41.40%), Postives = 98/157 (62.42%), Query Frame = 1
Query: 2215 YKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWI--NINEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            ++ P D  L   + E  ++I PL  + EQ  ELAK V+ +MGGPI ++ +  F +EL IS+LK   +SNVIPIG+I  G   HRALLFK LAD++ I + L RGEY R+WNE+ +  ++ E     P  + +++DL+ +PGR +   S D  +Y+ +
Sbjct:  659 WQPPYDQELNDCLTEASKMILPLSDIKEQVVELAKLVARKMGGPIEKERLHDFSWELHISELKFALKSNVIPIGKIKKGTFYHRALLFKVLADRVGISSCLIRGEYGRAWNEVRLTGSLQEITRGLPPPKTYVVDLMFEPGRLLVHGSADADNYQHI 815          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Mouse
Match: Armc3 (armadillo repeat containing 3 [Source:MGI Symbol;Acc:MGI:1918132])

HSP 1 Score: 375.555 bits (963), Expect = 1.908e-115
Identity = 254/646 (39.32%), Postives = 400/646 (61.92%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINS 1995
            MGKKIKK+ +   +D FDP+ IES +A TVVLML S EED+  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K +RRN++M+  ++  +++V+K+L+  + ++  ++  LS  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN+I C+  +++DF+ R  L+  N IP +LELL+SEYP+IQ   L      + D   R ++++   ++    I+   ELNDLHV +L VIA CLED++ +  ++++G L ++L+F                                        S T+P+++ +A KAI KA    + R++FHE + EK LV LL  +S+  KIAA+QAI  + +NL+C+   +N  GI Q+V+L+RSD++E++EAA+LALANLT+ +  N    A    ++ L++ LS+ ++G  +NA   ++NMAT+EPLR  +Q + ++ AL+ PL S +T VQS AAL VA+   D ++R   RN GG+V L  LL S N EVRR   WA+ + A ++  A EL  +GA+ +L+++N+S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + +  ++   L  +N +R I+L+N+
Sbjct:    1 MGKKIKKEVEPPPKDVFDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILASNSDVKKLLRELE-VMNSVIAQLSPEEEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQDFQCRTTLQELNAIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLSF--------------------------------------AESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAISALCENLSCK-EFFNTQGIPQIVQLLRSDNEEVREAAALALANLTTSSPANANAAAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEARTQLRNCGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVELCRLGALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISDGFYDYGRINPGTKLLSLKELCLQELNDQRAILLVNN 606          

HSP 2 Score: 125.561 bits (314), Expect = 7.122e-29
Identity = 68/161 (42.24%), Postives = 97/161 (60.25%), Query Frame = 1
Query: 2215 YKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININE------GKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            +  P D     Y+ EV + I P+  + EQ   LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNV+PIG I  GI  HRALLFK LADK+ +  +L RGEY+R WNE+ + +NE      G  P P  + +I+DL+  PG  + + S +   YR L
Sbjct:  712 WNPPPDPEFCVYVLEVTKSILPIVNLKEQIEVLAKYVADKMGGKIPKEKLADFSWELHISELKFQLKSNVVPIGYIKKGIFYHRALLFKALADKIGVGCSLVRGEYSRGWNEVKL-VNEARKGMIGNLPPP--EEYIVDLMFHPGNLLKLRSKEADLYRFL 869          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Mouse
Match: Armc3 (armadillo repeat containing 3 [Source:MGI Symbol;Acc:MGI:1918132])

HSP 1 Score: 375.555 bits (963), Expect = 2.243e-115
Identity = 254/646 (39.32%), Postives = 400/646 (61.92%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINS 1995
            MGKKIKK+ +   +D FDP+ IES +A TVVLML S EED+  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K +RRN++M+  ++  +++V+K+L+  + ++  ++  LS  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN+I C+  +++DF+ R  L+  N IP +LELL+SEYP+IQ   L      + D   R ++++   ++    I+   ELNDLHV +L VIA CLED++ +  ++++G L ++L+F                                        S T+P+++ +A KAI KA    + R++FHE + EK LV LL  +S+  KIAA+QAI  + +NL+C+   +N  GI Q+V+L+RSD++E++EAA+LALANLT+ +  N    A    ++ L++ LS+ ++G  +NA   ++NMAT+EPLR  +Q + ++ AL+ PL S +T VQS AAL VA+   D ++R   RN GG+V L  LL S N EVRR   WA+ + A ++  A EL  +GA+ +L+++N+S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + +  ++   L  +N +R I+L+N+
Sbjct:    1 MGKKIKKEVEPPPKDVFDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILASNSDVKKLLRELE-VMNSVIAQLSPEEEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQDFQCRTTLQELNAIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLSF--------------------------------------AESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAISALCENLSCK-EFFNTQGIPQIVQLLRSDNEEVREAAALALANLTTSSPANANAAAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEARTQLRNCGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVELCRLGALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISDGFYDYGRINPGTKLLSLKELCLQELNDQRAILLVNN 606          

HSP 2 Score: 125.561 bits (314), Expect = 6.791e-29
Identity = 68/161 (42.24%), Postives = 97/161 (60.25%), Query Frame = 1
Query: 2215 YKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININE------GKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            +  P D     Y+ EV + I P+  + EQ   LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNV+PIG I  GI  HRALLFK LADK+ +  +L RGEY+R WNE+ + +NE      G  P P  + +I+DL+  PG  + + S +   YR L
Sbjct:  724 WNPPPDPEFCVYVLEVTKSILPIVNLKEQIEVLAKYVADKMGGKIPKEKLADFSWELHISELKFQLKSNVVPIGYIKKGIFYHRALLFKALADKIGVGCSLVRGEYSRGWNEVKL-VNEARKGMIGNLPPP--EEYIVDLMFHPGNLLKLRSKEADLYRFL 881          
BLAST of Armadillo repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q5W041|ARMC3_HUMAN (Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2)

HSP 1 Score: 403.675 bits (1036), Expect = 3.313e-125
Identity = 261/664 (39.31%), Postives = 410/664 (61.75%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDD 2049
            MGKKIKK+ +   +D FDPL+IES +A TVVLMLNS EE++  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K++RRN+ M+  ++  + +V+K+L+  D ++  ++  L+  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN++ C+  +++DF+ R  L+  N IP +L+LLKSEYPVIQ   L      + D   R ++RD   ++  + I+   ELNDLH+ +L VIA CLED++ + Q++++GGL +LL+F  +S                                      T+P+++ +A KAI KA    + R++FHE + EK LV LL  E++  KIAA+QAI  M +N +     +N  GI QL++L++SD++E++EAA+LALANLT+ N  N    A   G++ L++ LS+ ++G  +NA   ++NMA +EPLR  +Q + ++ A+++PL+S +T VQSKAAL V +   D ++R + RN+GG+  L  LL S N EVR+   WA+ + A ++ +A EL  +GA+ +L+++N S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + + P++   L   +  R ++LINS   K      SS+ D  D
Sbjct:    1 MGKKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVEPLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELD-VMNSVIAQLAPEEEVVIHEFASLCLANMSAEYTSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPVIQLLALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQIQQTGGLKKLLSFAENS--------------------------------------TIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCEN-SGSKDFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINS---KSYVSPPSSMEDKSD 621          

HSP 2 Score: 132.109 bits (331), Expect = 5.256e-30
Identity = 67/155 (43.23%), Postives = 95/155 (61.29%), Query Frame = 1
Query: 2224 PSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKS-----PKPNMQLFIIDLISDPGRFIPIDSVDGHSYR 2673
            PSD     Y+ EV + I P+  + EQ  +LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNVIPIG +  GI  HRALLFK LAD++ I  +L RGEY R+WNE+ +  +  K      P P M  ++IDL+  PG  + + S +   YR
Sbjct:  718 PSDPDFSMYVYEVTKSILPITNIKEQIEDLAKYVAEKMGGKIPKEKLPDFSWELHISELKFQLKSNVIPIGHVKKGIFYHRALLFKALADRIGIGCSLVRGEYGRAWNEVMLQNDSRKGVIGGLPAPEM--YVIDLMFHPGGLMKLRSREADLYR 870          
BLAST of Armadillo repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|A2AU72|ARMC3_MOUSE (Armadillo repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Armc3 PE=1 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.569e-114
Identity = 254/646 (39.32%), Postives = 400/646 (61.92%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINS 1995
            MGKKIKK+ +   +D FDP+ IES +A TVVLML S EED+  KACEAIYKFA K +ENK  LL+L   + L +LL  E+K +RRN++M+  ++  +++V+K+L+  + ++  ++  LS  E     EFA+L L  +  EYT   ++ ++ G+  L+  LSS DPDV+KN+I C+  +++DF+ R  L+  N IP +LELL+SEYP+IQ   L      + D   R ++++   ++    I+   ELNDLHV +L VIA CLED++ +  ++++G L ++L+F                                        S T+P+++ +A KAI KA    + R++FHE + EK LV LL  +S+  KIAA+QAI  + +NL+C+   +N  GI Q+V+L+RSD++E++EAA+LALANLT+ +  N    A    ++ L++ LS+ ++G  +NA   ++NMAT+EPLR  +Q + ++ AL+ PL S +T VQS AAL VA+   D ++R   RN GG+V L  LL S N EVRR   WA+ + A ++  A EL  +GA+ +L+++N+S  ++NKFSEAA N+L ++NL+LK++  GYL  ++ I + FYD G+  P + +  ++   L  +N +R I+L+N+
Sbjct:    1 MGKKIKKEVEPPPKDVFDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILASNSDVKKLLRELE-VMNSVIAQLSPEEEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQDFQCRTTLQELNAIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLSF--------------------------------------AESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAISALCENLSCK-EFFNTQGIPQIVQLLRSDNEEVREAAALALANLTTSSPANANAAAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEARTQLRNCGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVELCRLGALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISDGFYDYGRINPGTKLLSLKELCLQELNDQRAILLVNN 606          

HSP 2 Score: 125.561 bits (314), Expect = 4.751e-28
Identity = 68/161 (42.24%), Postives = 97/161 (60.25%), Query Frame = 1
Query: 2215 YKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININE------GKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            +  P D     Y+ EV + I P+  + EQ   LAKYV+ +MGG I ++ +  F +EL IS+LK + +SNV+PIG I  GI  HRALLFK LADK+ +  +L RGEY+R WNE+ + +NE      G  P P  + +I+DL+  PG  + + S +   YR L
Sbjct:  724 WNPPPDPEFCVYVLEVTKSILPIVNLKEQIEVLAKYVADKMGGKIPKEKLADFSWELHISELKFQLKSNVVPIGYIKKGIFYHRALLFKALADKIGVGCSLVRGEYSRGWNEVKL-VNEARKGMIGNLPPP--EEYIVDLMFHPGNLLKLRSKEADLYRFL 881          
BLAST of Armadillo repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q9FPR3|EDR1_ARATH (Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana OX=3702 GN=EDR1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.179e-10
Identity = 43/141 (30.50%), Postives = 68/141 (48.23%), Query Frame = 1
Query: 2227 SDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPID 2649
            S LH +  I E + +     +V      LA+ V+  MGG      I+   +  + S+ K    + V PIG +  GI  HRALLFK LAD + +P  L +G +     +  +N    +  +     +++DL++DPG  IP D
Sbjct:  194 SSLHELLEIAECIALGCSTTSVSVLVQRLAELVTEHMGGSAEDSSIVLARWTEKSSEFKAALNTCVFPIGFVKIGISRHRALLFKVLADSVRLPCRLVKGSHYTGNEDDAVNTIRLEDERE----YLVDLMTDPGTLIPAD 330          
BLAST of Armadillo repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q9C9U5|SIS8_ARATH (Probable serine/threonine-protein kinase SIS8 OS=Arabidopsis thaliana OX=3702 GN=SIS8 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.247e-9
Identity = 38/120 (31.67%), Postives = 60/120 (50.00%), Query Frame = 1
Query: 2296 EQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSV 2655
            E   +LA  V   MGGP+   + M   +      LK    S V+P+G +T G+  HRALLFK L D + +P  + +G+      ++ +N  +    +     +I+DL+ DPG  IP D+ 
Sbjct:  273 ELVRKLAILVGDYMGGPVVHPESMLRAWRSLSYSLKATLGSMVLPLGSLTIGLARHRALLFKVLCDSVGVPCRIVKGQQYTGSEDVAMNFIKADDGRE----YIVDLMGDPGTLIPADAA 388          
BLAST of Armadillo repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q05609|CTR1_ARATH (Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.801e-7
Identity = 55/172 (31.98%), Postives = 83/172 (48.26%), Query Frame = 1
Query: 2155 LDDPLNGSTKLDIVDG-STPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELE-ISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQL---FIIDLISDPGRFIPIDSV 2655
            +D  ++ S +  IVD  S PA+K   +LH       V +I     T  E   +LAK +  RMGGP+   +    P   E I  LK  F+  V+PIG ++ G+  HRALLFK LAD + +P  + +G         + N ++  S      L   +++DL+  PG     DS+
Sbjct:  263 VDSGVDSSLEAIIVDRRSDPAFK---ELH-----NRVHDISCSCITTKEVVDQLAKLICNRMGGPVIMGEDELVPMWKECIDGLKEIFKV-VVPIGSLSVGLCRHRALLFKVLADIIDLPCRIAKG-------CKYCNRDDAASCLVRFGLDREYLVDLVGKPGHLWEPDSL 418          
BLAST of Armadillo repeat-containing protein 3 vs. TrEMBL
Match: A0A267H3H0 (Cnd1 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015696g3 PE=4 SV=1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 396/891 (44.44%), Postives = 574/891 (64.42%), Query Frame = 1
Query:   52 LVMGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGD-SQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAA-KHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVAL-YNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALS------------SIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            +V+ +   KDDK   ED FDPL +ES  A+T +LML+S EE+VQ KAC+ +YKFANKCDENK+ LL     D L+RL+ SE++ IRRNS+M LA +  H +VRK+L+ ++  +PLLL LL   E++TT+EFA +AL  L +E+  I+ ++D+ G+  LVEC+  EDPDVQ+NA  C+ L+L+DFEA+  L+   G+  +L LL+SE+P IQE  L A  +A+ D+  R  +R+LD +  FV+I+GRPE NDLHV +L V+A C +D++ + QLKE+GGL+R +AFI + +  PEE     AK   K  SA+KKK E++ K  E V S  LPEVK+HA +AI +A R +  +R+ H+C+ EK+LVQLL+HE + V+ AAA A+ IM ++  CQ ++  Y+G+E LVK+ + ++KE+KEA+SLA+ANLTSGN   C  + A  HG+E+L+ CLSN  E I  N L A+ N++T + LR K+   GL+ AL  PL S S  VQ +AA  VA F+ +   R DFR +G  + L   LL+S++  VRR+ CWA+ ++A++ E+A E+  +  +++LQ +NKS+ KRNKFSE ALN+L DSNLNLK+AL GYL  TD+I +LFYD GQ +P+ ++  +E +G   +N++RP++L+N+  P P    L+            S    DD KA     R K     +  K       ++   A         +    +     P Y  P D  L   IEE   ++    +  E+  +LA  VS RMGG I   ++M F YEL +S+LK   +SNV+PIG +++GIH HRALLFKFLAD++ I   L RG+YNR+WNE+W+  +EG+   P  Q F++DL+ +PGR +  DSV+  SY+K+
Sbjct:    4 MVIRRGKGKDDKAPPEDVFDPLPLESKTAQTAILMLDSPEEEVQAKACDGLYKFANKCDENKKQLLDGGAVDGLLRLMASEDRTIRRNSVMALATLTAHPDVRKLLRKREDPVPLLLRLLQAEEFTTTNEFATMALANLAKEFASIAVILDHGGLDQLVECMRDEDPDVQRNAAECVALLLQDFEAKAALKEAGGLEALLSLLQSEFPAIQELALQALIRATQDAGNRAALRELDALKAFVNIVGRPECNDLHVHALHVLANCADDIDSLLQLKENGGLVRFVAFITEQTPPPEEQAAKDAKGKGKPKSAKKKKGEDDKKEAESVPSHMLPEVKMHAARAIARAARTEAGKRVLHDCEAEKMLVQLLTHEDDKVRAAAATALAIMGESFQCQQAIVRYEGLEPLVKMTKLENKEIKEASSLAVANLTSGNSDICSAVGAISHGIENLIGCLSNENERIACNGLTALVNLSTTDSLRHKVLHQGLLNALQNPLGSKSLLVQQRAATAVACFVCEPGPREDFRKSGKCLPLLVPLLMSDSDPVRRAACWAVAVLAADSETANEIYKLKGLELLQAINKSDTKRNKFSEIALNKLLDSNLNLKYALTGYLSTTDRIPDLFYDPGQLRPEDHLPSLEAFGRQEVNTRRPVLLLNAQPPLPPPETLNDAATEADSEEQKSSQQMDDSKATPTGRRSKSPKDSAKGKRGDAEAAAAAAAATAAAAAAAAAAAAAVEATPKP-YSPPEDAGLRRCIEEAERLVAQSGSAREEIQQLAGLVSERMGGAIEHGELMQFGYELPLSQLKFALKSNVVPIGLVSAGIHCHRALLFKFLADRVGINCTLVRGQYNRAWNEVWLTESEGQRSHPPSQ-FVVDLVFEPGRLLRPDSVEACSYKKI 892          
BLAST of Armadillo repeat-containing protein 3 vs. TrEMBL
Match: A0A1S3H6M2 (armadillo repeat-containing protein 3 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152570 PE=4 SV=1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 369/893 (41.32%), Postives = 571/893 (63.94%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEED-----------NXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIV--DGST----PAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGK--SPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKK+KK++K A +D FD LL+ES QA TVVLML+S EE+VQ KACEAIYKF +KCDENK++L+ L   +++++L++SE++++RRN++M   VM  H +VRK+L+ Q+  IP ++ LL+  E +   EFAA+ L YL  +++    + + +G+  L+ CLS+ DPDVQKNAI  +  +L+D++AR  +   NG+P +++LLKSEY VIQE  L +  +A+ D   R  +R+++ ++  +  IG PE +DLHV ++QV++ CL+D+E ++Q+KESGGL +L+AFI D   PE++              +  K  K      K K +     +IV   TLP+VK  A KAI +A +  + R++ HE + EK+L+ LL HE   V++AA QA+  MA+NLTC+ ++  ++GIE LVKL++SD+ E++EA +LALANLT+ N  NC E+    G+E L+  L + +EG+ +NA V ++NM+ +E +R  +Q  G+I AL+ PL+S + SVQSK AL VA+F+ D+ +R +FRN GG+  L  +L S NAEVRRS  WAIT+ A ++ +A E++ +G + +LQ + +S  ++N F++ AL+RL DSNL+ K+AL G L   + I + F+D GQ +P + +  +E Y    ++ +RP++LI+     P TP  S +    D   +     K+  + K  S+    + ++     ++  D  + S + + V  DG        +  P D +   Y+EEV E + PL T  EQ   LA+YV+ +MGG I +  + +F YEL IS++K + +SNVIPIG I +GIH HRALLFK LAD + +P  L+RGEYNR+WNE+WI  ++G   +PK   + +I+DLI  PG  +  DS +   Y++L
Sbjct:    1 MGKKVKKEEKTAPDDVFDTLLVESRQAATVVLMLDSPEEEVQSKACEAIYKFVDKCDENKKVLMDLGAVEKMLKLMQSEDRIVRRNALMAFGVMSAHPDVRKLLRKQEECIPTVVSLLNPEEDTVCHEFAAMCLSYLSNDFSSKVAIFEQNGLEPLIRCLSASDPDVQKNAIESIAHMLQDYQARTAINELNGLPSIIDLLKSEYTVIQELALISLERAAQDPENRATMREIEALDTLIKFIGTPEYSDLHVYAVQVLSNCLDDIESMEQIKESGGLQKLVAFITDVAPPEDEPKAKGGKGEKGGGSRKGKKGKDDDDESKHKGKGGNEGDIVP--TLPDVKQFAAKAIARAAKNAENRKVLHEQEVEKMLIILLGHEEPHVQVAACQALATMAENLTCRDAIREWEGIEPLVKLLKSDNGEVREAVTLALANLTTANSNNCNEVINFGGIEPLIGMLGDPKEGVVANAAVVLTNMSLDEVMRVNIQAQGVIYALIDPLRSSNPSVQSKTALGVAAFVCDADTRAEFRNAGGLEPLVAMLNSGNAEVRRSASWAITVCAVDEPTAMEIARLGGLDILQTIQQSGSRKNCFTDVALDRLLDSNLSAKYALTGLLGTGNLITDGFFDPGQLRPGTKLGSLEDYCKMEVDQRRPVLLISFRTDGPTTPMPSDVDVRQDGSNKAALAAKQSKSVKDASRVDSANLKADSARTKSQRDRDDKSREEEAVNRDGEQGQEESTFIHPPDSNFAKYMEEVQEKVQPLNTTKEQVVALAQYVADKMGGAIERGQLANFSYELPISQIKFDLKSNVIPIGMIKTGIHYHRALLFKALADSVAVPCTLQRGEYNRAWNEVWITDDDGAPGAPKFPPKAYIVDLIHHPGDLMRSDSAEAVQYQRL 891          
BLAST of Armadillo repeat-containing protein 3 vs. TrEMBL
Match: A0A1S3H948 (armadillo repeat-containing protein 3 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106152570 PE=4 SV=1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 365/887 (41.15%), Postives = 568/887 (64.04%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEED-----------NXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGK--SPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKK+KK++K A +D FD LL+ES QA TVVLML+S EE+VQ KACEAIYKF +KCDENK++L+ L   +++++L++SE++++RRN++M   VM  H +VRK+L+ Q+  IP ++ LL+  E +   EFAA+ L YL  +++    + + +G+  L+ CLS+ DPDVQKNAI  +  +L+D++AR  +   NG+P +++LLKSEY VIQE  L +  +A+ D   R  +R+++ ++  +  IG PE +DLHV ++QV++ CL+D+E ++Q+KESGGL +L+AFI D   PE++              +  K  K      K K +     +IV   TLP+VK  A KAI +A +  + R++ HE + EK+L+ LL HE   V++AA QA+  MA+NLTC+ ++  ++GIE LVKL++SD+ E++EA +LALANLT+ N  NC E+    G+E L+  L + +EG+ +NA V ++NM+ +E +R  +Q  G+I AL+ PL+S + SVQSK AL VA+F+ D+ +R +FRN GG+  L  +L S NAEVRRS  WAIT+ A ++ +A E++ +G + +LQ + +S  ++N F++ AL+RL DSNL+ K+AL G L   + I + F+D GQ +P + +  +E Y    ++ +RP++LI+     P TP  S +    D   +     K+  + K  S+  +   +    +    ++ +N   +    + +   +  P D +   Y+EEV E + PL T  EQ   LA+YV+ +MGG I +  + +F YEL IS++K + +SNVIPIG I +GIH HRALLFK LAD + +P  L+RGEYNR+WNE+WI  ++G   +PK   + +I+DLI  PG  +  DS +   Y++L
Sbjct:    1 MGKKVKKEEKTAPDDVFDTLLVESRQAATVVLMLDSPEEEVQSKACEAIYKFVDKCDENKKVLMDLGAVEKMLKLMQSEDRIVRRNALMAFGVMSAHPDVRKLLRKQEECIPTVVSLLNPEEDTVCHEFAAMCLSYLSNDFSSKVAIFEQNGLEPLIRCLSASDPDVQKNAIESIAHMLQDYQARTAINELNGLPSIIDLLKSEYTVIQELALISLERAAQDPENRATMREIEALDTLIKFIGTPEYSDLHVYAVQVLSNCLDDIESMEQIKESGGLQKLVAFITDVAPPEDEPKAKGGKGEKGGGSRKGKKGKDDDDESKHKGKGGNEGDIVP--TLPDVKQFAAKAIARAAKNAENRKVLHEQEVEKMLIILLGHEEPHVQVAACQALATMAENLTCRDAIREWEGIEPLVKLLKSDNGEVREAVTLALANLTTANSNNCNEVINFGGIEPLIGMLGDPKEGVVANAAVVLTNMSLDEVMRVNIQAQGVIYALIDPLRSSNPSVQSKTALGVAAFVCDADTRAEFRNAGGLEPLVAMLNSGNAEVRRSASWAITVCAVDEPTAMEIARLGGLDILQTIQQSGSRKNCFTDVALDRLLDSNLSAKYALTGLLGTGNLITDGFFDPGQLRPGTKLGSLEDYCKMEVDQRRPVLLISFRTDGPTTPMPSDVDVRQDGSNKAALAAKQSKSVKDASRVARTKSQRDRDDKSREEEAVNRDGEQGQEEST---FIHPPDSNFAKYMEEVQEKVQPLNTTKEQVVALAQYVADKMGGAIERGQLANFSYELPISQIKFDLKSNVIPIGMIKTGIHYHRALLFKALADSVAVPCTLQRGEYNRAWNEVWITDDDGAPGAPKFPPKAYIVDLIHHPGDLMRSDSAEAVQYQRL 882          
BLAST of Armadillo repeat-containing protein 3 vs. TrEMBL
Match: A0A210QJI7 (Armadillo repeat-containing protein 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12452 PE=4 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 368/898 (40.98%), Postives = 560/898 (62.36%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXX------------XXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXY----------VNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQ--LFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKK+K+D K   +D FD + +ES QA TVVLMLNS EE+VQ KACEAIYKF  KCDEN++LLL L   D L++L++SE++++RRN+ M +  M    +VRK L+ +D  IP+ + LL+  E S   EF+AL L  +  E++  S + +N G+  LV+CL+S DPDVQKN I  L  ++ D++ R  ++   G+  ML+LLKS++ ++Q+  L A  +AS D++ RG +R+L+ +++ +D + +PELNDLHV+++ V++  LEDLE ++++KE+GGL RL+A I D   PEE+ K    +      A KK  ++  K             + I+   TLP+VK+ A KAI ++ R  + R++ HE + EK+L+ LL+HES  V+ AAAQA+ +M++NL  + S+  +DG++ L+KL+ SD+ ++KE ASLALANLT+ N  NCQE++   G E L++ L++ +E   +NA   ++NMATEE LR + Q  G++  L+  LKS +T VQ+K +L +A+++ DS SR +FRN  GI  L  LL S N EVRR+  WAIT+ A ++ +A E+  +G M +LQ++  S  ++N F+EAAL RL DSNL+ K+AL G L  T+     FYD GQ +  S    +       +N KR I+L+N+   KP   A  S+   + +  QE         S    +  K   RS            + A+ L + ++   +      S P ++ PSD  L+ Y+EEV+E I P+ ++ EQ   LA++V+ +MGGPI +  + +F +EL I ++K E +SNV+PIG+I +GIH+HRALLFK LAD++ +P  L RGEYNR+WNE+ +  ++     P      +I+DLI DPG  +  DS +  +YRKL
Sbjct:    1 MGKKVKEDKKPPPDDVFDVVALESRQAGTVVLMLNSPEEEVQAKACEAIYKFVEKCDENRKLLLDLGAGDPLLQLMQSEDRLVRRNACMAMGSMTAQPDVRKYLRKKDRSIPIFIALLAPEEDSVCHEFSALGLSNMATEFSSKSAIYENGGIEPLVKCLNSNDPDVQKNGIEALAQMMMDYQTRASIKDAEGLAPMLDLLKSDFQIVQKLALLALDRASQDADNRGALRELEAMSRLIDFVAKPELNDLHVMAVMVLSNLLEDLESLEEVKETGGLKRLVALITDQTPPEEEPKGGKGEKKAGSRAAKKSAKDGKKGGSEPEKDDTPPGEAIIP--TLPDVKMSAAKAIARSARNSENRKILHEQEAEKMLIHLLAHESSEVQTAAAQALAVMSENLMSKDSIREWDGMQPLIKLLNSDNGDVKEGASLALANLTTSNSTNCQEVSNFGGTETLINLLTDPREEAVANAACVLTNMATEEALRVEAQGKGVVTTLIEGLKSKNTMVQAKTSLCIAAYVCDSDSRAEFRNASGIEHLVILLHSGNDEVRRNASWAITVCAVDEPTATEVCKLGGMDILQEIQVSGTRKNPFAEAALERLLDSNLSAKYALTGNLSSTNLTENGFYDAGQLRSGSKFMTLVDCCKQELNDKRAILLVNA---KPAPAAQQSLTQQEVEVKQESSKTSVSGKSSRTGRESKAKSRSQRDKEEKQREEEMQAQLLKEAMSQGGR-----DSKP-FESPSDPTLLKYMEEVIEKIQPIPSLHEQVITLARFVADKMGGPIEKGQLTNFSWELPIGQIKFELKSNVVPIGKIKTGIHIHRALLFKTLADQIAVPCTLTRGEYNRAWNEIMLPDSDPTPGAPKFPPLAYIVDLIHDPGHLMKSDSPEAITYRKL 887          
BLAST of Armadillo repeat-containing protein 3 vs. TrEMBL
Match: A0A2C9LYI7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106076214 PE=4 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 371/908 (40.86%), Postives = 564/908 (62.11%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIV---SSF-------TLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINS-ILP--KPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGST-------------------KLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKS--PKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKK+KKD+K    D F+ LL+ES QA TVVLMLNS EEDVQ KACEAIYKF +KCDENK++LL L+  D L+ L++  ++ +RR++IM L VMC H EVRK L+ +   IP ++ LL+++E S   EFAALAL ++  E+     +   +GV  LV  LSS DPDVQKN++  +  ++ D++AR  +R  NG+  +L+L+KSEY +IQ   L A  + S DS  R ++R++D + + +DI+ +P LNDLHV+++ V++  LED E +  ++++G L R +A I D+  PE+D K+  KKSS     +K  KE + K ++     + F       TLP+VKV A KAI ++ R  + R++ HE + EK+L  LLSH+S  V+ AAA AIG++ +N++ +  +    G+  LVKL+ S++ E+KEAASLA+ANLT+ N KNC EI+   G++ L+ CL   +E + +NA  A++NMA +E LRT+    G++ AL+ PL S +T+VQSK AL V++F  D++SR +F+ NGG+  L  LL S N EVRR+  WAIT+   ++ +A E+  +G +++LQ++  S  + N F EAAL RL DSNL+ KF+L  +L   + I + F+DCGQ K  ++ + +E Y    +N KRP++L+N+  +P  +  T ++SS  + DD+K +     K              S      NA N + P N                      + + V      +  P D  L  YIEEV++ I PL ++  Q   LA++VS++MGG I + ++ +F +EL +++L+ + +SNVIPIGRI +GIH+HRALL+K LAD++ +P +L RGEYNR+WNE+ +   +     PK   + +I+DL+ +PG  +  D+    SY KL
Sbjct:    1 MGKKVKKDEKGPPSDVFETLLVESRQAATVVLMLNSPEEDVQSKACEAIYKFVDKCDENKKVLLDLEVLDPLLSLIQGPDRTVRRHAIMALGVMCAHTEVRKALRKRSGAIPAIISLLNSDEDSVIHEFAALALSFMANEFASKVAIQAANGVEQLVHLLSSHDPDVQKNSVEAIAQLVMDYKARSSVREYNGLQPVLDLVKSEYAIIQRLALLALDRLSQDSENRRVLREIDAIGRLLDILAQPTLNDLHVMAVMVLSNLLEDPESLVLVRDNGALKRFVALITDAAPPEDDKKEGGKKSSSRTGNKKSAKETKGKKEDDAKEDAPFGGDCIIPTLPDVKVCAAKAIARSARSAENRKLLHEQEAEKMLTTLLSHDSPEVQAAAALAIGVICENVSSRDCIKEMGGLAPLVKLLNSEYGEVKEAASLAIANLTTANNKNCLEISRLGGIDALLMCLGEVREEVIANAACALTNMAQDEKLRTEAHAKGVVTALIYPLSSYNTNVQSKVALAVSAFACDAESRREFKENGGLQPLVQLLNSGNDEVRRNTAWAITVCGVDEPTASEICRLGGLQILQEIQTSASRHNTFIEAALQRLLDSNLSAKFSLYNHLGAGNIIEDGFFDCGQLKQGTSFKTLEEYCAQEMNDKRPVLLVNAKWVPSEEDYTASISSKLE-DDQKTESSSKVKDTLLKSKSKIKNVRSS-----NASNRESPDNKKGKKFKEKEEKNPKEDDSQDKERESVIREPGVFCPPPDPQLFKYIEEVIDKILPLPSIRVQVVALAEFVSLKMGGRIPRGEVANFSWELPLNQLRFQLKSNVIPIGRIKAGIHIHRALLYKTLADRIALPCSLTRGEYNRAWNEVLLPDEDEDPLIPKFPPKRYIVDLVHEPGSLLVPDTQAAVSYMKL 902          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Cavefish
Match: armc3 (armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-110614-1])

HSP 1 Score: 362.459 bits (929), Expect = 9.534e-112
Identity = 275/877 (31.36%), Postives = 436/877 (49.71%), Query Frame = 1
Query:   55 VMGKKIKKD-DKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLS-SEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            +MGKK+KK+ +  A  D FDPL IES +AETVVLML+S EE+V  KACEAI++FA K DEN                         RNS++ L                  + PL    L ++E  T    A +A+G +     V   +   + + S++  LS  ED  V + A  CL  +  DF  +  +   NG+  +L LL S  P ++++++                   +C+   V      E +DLH  +L+VI  CLED E VK ++ +GGL +LL F                                      V + T PEV+ +A KAI +     + R++ HE + EK L+ LL+ E++ V  A  QA+ ++++N +   +    +GI+ +V+L+ S    +KEAA+ AL++L+SGN  N Q I+   G + +V  L +   G  S+    ++NMA++E LR  +  +  I AL+ PL+S           +VA+   +++ R + R+ GG+  L  +L SNN E+ R+ CWA+++ A+++ +A E+  +GA+++LQ++N S  +R+KFSE AL RL DSN ++K++L G+L  TD   + FYD GQ +    V  +E      IN  R II +N    KP         ++ + + QE  T  + S+        + S+       E         +K  + +     + LP D      I E  + + P     E  + LAK V   MGG +  ++  +FP+EL IS+LKIE QSN+IPIG I  G + HRALLFK LAD++ +  +L RG+YNR+WNE+ ++        P  Q +I+DL+ +PG  +   +     Y+ +
Sbjct:    1 MMGKKVKKEAEPAAPRDAFDPLPIESKKAETVVLMLDSPEEEVLAKACEAIHRFAEKGDEN-------------------------RNSLLALGA----------------VEPLTR--LISHEDKTVRRNAFMAVGVMASNNDVRRLMKKLNIIPSVISKLSPEEDIIVHEFATLCLASLSVDFTCKVQIYEQNGLEPLLRLLSSPDPDVKKNSV-------------------ECIFNLVQ-----EFSDLHADALRVIFNCLEDTESVKLIQGNGGLEKLLQF--------------------------------------VITPTTPEVQTNAVKAIARVAESSETRKLLHEQNVEKALIDLLATENKSVHTAVCQAVAVLSKNQSSMDTFRLLNGIKPIVQLLNSQENGVKEAAAQALSSLSSGNPLNAQAISEAEGEKLMVQILKDCCSGTVSHVAAILTNMASQEALRCSIITHRAIPALLEPLQSTEQHTLISTTQLVAALTCETEGRAELRDAGGLPLLVKMLQSNNTEICRNACWAVSVCANDEPTATEMCKLGALEILQEINCSLNRRSKFSEVALQRLLDSNPSIKYSLTGWLSHTDITADGFYDPGQARVGHRVPTLEDIAKQVINQHRAIIAVNG---KPQD------QETAEDRQQESPTEPQTSSVLGSKGSSRASKVKGKGRQEEEKQKDEDESKASVSEEK--PWSLPYDADFHNLISEAAKTVVPKNEKAEMYTALAKLVCNAMGGLVDIEEQHNFPWELHISELKIELQSNIIPIGMIKKGTYYHRALLFKALADRIGVNCSLVRGDYNRTWNEVLLSSPRKTGFYPQPQCYIVDLMHEPGNLMKCGTPAAIQYQTI 761          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001567.1 (pep scaffold:Pmarinus_7.0:GL478323:89:6694:-1 gene:ENSPMAG00000001415.1 transcript:ENSPMAT00000001567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 1.254e-58
Identity = 119/344 (34.59%), Postives = 180/344 (52.33%), Query Frame = 1
Query:  121 IESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLS 1152
            IESH   TVVLML S E DV  KAC+A+++FA KC+ N+ +L+ L   + L  LL  ++K +RRN+I+ L  +  +  VRKIL + D + P +L LLS  E     E+ +L L  L QE+   + V+   G + LV  L+S DPDVQKNA+ CL L+ +D E R  L   + +P +L+LL SE+PVIQ+  L      + D   RG +R    +++ V I+ + E  DLH  +LQV   CL D+E ++Q + SG L  +L+F                                      V++ + P+++ HA +A+      D+   + HE   E ++V LL 
Sbjct:    2 IESHSVATVVLMLRSPEPDVLAKACDALHRFAGKCEGNRAMLMDLGAVEPLASLLTQDDKTVRRNAIVTLGTLASNVAVRKILLNADVVSP-VLKLLSPEEEVVCHEYGSLVLACLAQEFNGKAGVVAQGGTACLVRLLTSPDPDVQKNAVECLSLLAQDTEGRLALHASHAVPPLLDLLASEFPVIQKLALDTLVAVARDGEGRGALR--QGLDRVVGILSQKEWMDLHAQALQVFTLCLGDVETMRQAQGSGTLETMLSF--------------------------------------VTASSQPDLQSHATRALAHMAGSDESWGILHEQGVEAVMVALLG 304          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005330.1 (pep scaffold:Pmarinus_7.0:GL481917:332:1862:1 gene:ENSPMAG00000004858.1 transcript:ENSPMAT00000005330.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 2.356e-33
Identity = 69/180 (38.33%), Postives = 105/180 (58.33%), Query Frame = 1
Query: 2194 VDGST---PAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWI------------NINEGKSPKPNM---QLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            ++G+T   P ++LP D  L  ++EE +  + PL     QA+ LA+ VS RMGGP+ +  +  F +EL +S+LK E QSN+IP+GRI  G+  HRALLFK +AD+L +P +L RG YN +WNE+ +             ++   S  P +   QL ++DLI + G  +  DS +  +Y  L
Sbjct:   23 MEGATIEQPPWQLPPDPELRVFVEEAIRAVLPLACPRLQAATLARLVSDRMGGPVERDSLSDFSWELHVSQLKNELQSNLIPLGRIQRGVQPHRALLFKVVADRLGVPCSLVRGPYNHAWNELLLPPAPPQPAVPADGLSHPASNGPLLLPPQLHVVDLIHNVGALLHADSAEASNYTHL 202          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO38462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCU6])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 321/876 (36.64%), Postives = 520/876 (59.36%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWI--NINEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKK  K+ +   +D FDPL + S +  TVVLML+S EE++Q  ACEA+YKF+ KCDEN++LLL L     L+ L+ SE+KV++RN+ M L  + Q+  VR+ L+    I PL+  LL  +E     EFA+LAL  +  ++T   ++ +  G+  L++ LSS D DVQKNA+  + L+++D+ +R  +   NG+  +L LL SEY +IQ+  L + ++ +LD++ R  +RDL+ + K VD IG  E  DLHV +LQV++ CL+D+E ++ ++ SGGL +LLAF+ +SQ                                      +P+V+ HA KAI  A +  D R++ HE + EK ++ LLS +   V+ + A A+ +M++NL+ +  +   +GI  ++ L+ +++ E++E+ASLA+AN+T+ N  NC E+  K G+E ++  L +++  + +NA V ++N+A +E  R+++QQ+G++ ALV  LKS ST VQSK A+ VA+++ D++SR +FR  GG+  L  LL SNN EVRRS  WA+    ++  +A E+  +G + VL ++++S  +++ F++ A+  L DSNL  K+A  G L   + I + FYD G  +    + P+E     P+N  RPI+L+N           +  PDS  +  +E +  K      +                                + ++P+++ P D  LIGYIEEV + I PL +  +Q + LA++VS +MGG + +  + SF YEL IS+LK E QSN+IPIG+I +G++ HRALLFK LAD++ +  +L RGEYNR+WNE+ +  N  +G+ P+   Q +I+DL+ +PGR +  +S +  +Y++L
Sbjct:    1 MGKKKTKEPEAPPKDEFDPLELVSKKPHTVVLMLDSPEENIQQLACEALYKFSEKCDENRQLLLTLGAVPSLLHLIGSEDKVVKRNATMCLGTLSQNLSVRRELRKSSCIQPLV-ALLGPDEDVLCHEFASLALASMSADFTSKVEIFEQGGLEPLIKLLSSPDCDVQKNAVESICLLVQDYHSRSAITELNGLQPLLALLGSEYSIIQQLALESLSQITLDADNRNALRDLEGLEKLVDFIGNKEFEDLHVPALQVLSNCLQDVESMQLIQTSGGLQKLLAFVAESQ--------------------------------------IPDVQQHAAKAISLAAKNGDNRKILHEQECEKTIISLLSSDVPGVQSSLALALAVMSENLSSRDMIGKLEGIPPIIALLSNENPEVRESASLAVANITTANPTNCNEMVEKGGIEPIIMMLMDTKPLVQANAAVCLTNLAADESWRSEVQQHGVVPALVQALKSNSTIVQSKVAMAVAAYVCDAESRSEFRTEGGLPRLVELLQSNNDEVRRSASWAVLQCGNDSATAAEICKLGGLDVLFEISQSATRQSSFTQVAMECLLDSNLPAKYATTGSLSANNIIQDGFYDIGPMRQGEKIMPLEDLSKQPVNEHRPILLVN-----------AKNPDSKSRMMREREEMKAKEAEAAAESQPPQ-------------------------EDASPSWEPPIDPILIGYIEEVRDTIQPLVSTRDQVTALARFVSDQMGGAVQRDALTSFSYELPISQLKTELQSNIIPIGKIKTGLYYHRALLFKALADQIAVSCSLVRGEYNRAWNEVMLCNNAQDGQ-PQFPPQPYIVDLMHEPGRLMRSNSSEASAYQRL 800          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO43886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR2])

HSP 1 Score: 53.1434 bits (126), Expect = 4.773e-7
Identity = 73/291 (25.09%), Postives = 130/291 (44.67%), Query Frame = 1
Query: 1042 EVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSH-ESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNN--GGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDL--NKSEKKRNKFSEAALNRLYDSNLNLKFA-------LVGYLDFTDQ 1878
            E++ H   AI K    +D R +  +      LV LL++ E++ +  AA  AI   + ++   +       IEQLV L+ +D  E      +      +  + N   I    G+  LV+ L+++ + +  N   A+   ATE      + +   ++ L + LKS +  VQ+ AA  +   + ++K   +   +  GG+  + +LL SN+ EV  SVC AI  +A ++E+   ++  G + +L  L   K ++ R   +E+        N  + F        LVGYL    Q
Sbjct:  470 ELQRHCASAIFKCAEDEDTRNLVRQYGGLDPLVSLLTNIENKELLAAATGAIWKCSISVENVTRFQELKAIEQLVALL-TDQPEEVLINVVGALGECAQMLANRTAIRKAGGIPSLVNLLTSTNQALLVNVTKAVGACATEPDNMAIIDRLDGVRLLWSLLKSTNPRVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSNDQEVLASVCAAIANIAKDEENLAVITDHGVVPMLAKLASTKEDRLRQYLAESIARCCMWGNNRVAFGKEGAVPPLVGYLKSPSQ 759          
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Medaka
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:101162265])

HSP 1 Score: 319.701 bits (818), Expect = 1.151e-95
Identity = 212/642 (33.02%), Postives = 342/642 (53.27%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPII 1983
            M  K +KD +  ++D F  + IES   ET VL+LNS EE+V +KAC+AI+ FA K DENK  LL L   + LIRLL    + +RR +++ L  M  H EV+  LK  + I P +L  LS  E +   EFA L+L +L ++++  +++ D++G+  L++ LSS DPDV+KN++  +  +++D+++R       GIP +LELLKS++PVIQ   L      + D + R   R+    ++ +D++  P+ +DLH  +LQ ++ CL D + VK + +S GL RLL F+                                       +   P V+  A   + K  +  +  R+ HE  TEK+L +LLS +   VK +A QA+  M+ +   +    +   +  L +L+R     L+ AA+ AL  L+ G+  N   I    G E LV  L  +     +++   + NMA +E +R+ +  +G ++AL   LKS  T V   + L VA    + ++R + R  GG+ AL  LL S + EV ++ C+A+ + AS+K SA E+  +GA+++LQ++   E  RN     ALN L  SNL++K++L+G+L  +D I   FYD G+ +    V  +E     P+N  RP+ 
Sbjct:    1 MTHKTRKDSEPLSKDKFGFISIESKSPETAVLLLNSPEEEVIVKACDAIFTFAEKGDENKLSLLGLGALEPLIRLLSHSSRAVRRGAVVALGSMAVHGEVKNALKKLNAI-PSILEKLSPEEETVVHEFATLSLTHLSKDFSCKAQMFDSNGLPPLIQLLSSPDPDVKKNSVEVIYNLVQDYKSRLAFHKLGGIPSLLELLKSDFPVIQHLALGTLQCVTTDPDSRRTFREEQGFDRLMDVLSNPDFSDLHAAALQTLSNCLSDSQTVKLVHKSRGLARLLHFL--------------------------------------MAPNAPGVQSAAVDCLTKVAQSAESLRLLHEEGTEKVLAELLSVDDIGVKTSACQAVAAMSFHPASKDIFRDLGVVPALTQLLRRQSLMLRAAATRALYGLSHGDQLNALSIYNTGGHEILVQQLHEACPKTVASSAATLYNMAAQEAIRSSIVSHGAMQALAEALKSKDTEVLLSSTLCVAELACEEEARAELRRAGGLEALVRLLHSPHEEVWKNACFAVKVCASDKPSAVEMCRLGALEILQEMICPESGRNALGGLALNSLLKSNLSVKYSLMGHLASSDIITCGFYDAGKARTGQRVLTLEELTQQPLNQHRPVF 603          

HSP 2 Score: 118.242 bits (295), Expect = 8.711e-27
Identity = 60/149 (40.27%), Postives = 92/149 (61.74%), Query Frame = 1
Query: 2251 IEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQ------LFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            I+E  E I  L T  EQ + LA+ VS  MGG ++++++  FP+ L +S+LK   QSNV+PIG I  GI+ HRALLFK L+D + +  +L RG+YNR+WNE+ +     +   P+MQ       FI+DL+  PGR + +++     Y+ +
Sbjct:  635 IQEAKESILQLNTEKEQYAALARLVSEAMGGAVAEEELHEFPWMLHLSELKFHLQSNVVPIGLIRKGIYCHRALLFKCLSDCIGLSCSLIRGDYNRAWNEVVLF----EENPPSMQRSSRRSRFIVDLMHQPGRLLDVNTPAAQQYQTI 779          
BLAST of Armadillo repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000079416.1 (SMESG000079416.1)

HSP 1 Score: 1596.64 bits (4133), Expect = 0.000e+0
Identity = 869/874 (99.43%), Postives = 871/874 (99.66%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLR CNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPE NDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNKDKAKKSSKAGSARKKKKEEEDKPKEIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKIAAAQAIGIMAQNLTCQSSVYNYDGIEQLVKLIRSDHKELKEAASLALANLTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKS+STSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPA+SSIPDSDDKKAQEDKTRKKGSTSKSHSKGKKDSRRSSYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGH YRKL
Sbjct:    1 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRPCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPEFNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNKDKAKKSSKAGSARKKKKEEEDKPKEIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKIAAAQAIGIMAQNLTCQSSVYNYDGIEQLVKLIRSDHKELKEAASLALANLTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSMSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPAVSSIPDSDDKKAQEDKTRKKGSTSKSHSKGKKDSRRSSYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHYYRKL 874          
BLAST of Armadillo repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000079416.1 (SMESG000079416.1)

HSP 1 Score: 1587.39 bits (4109), Expect = 0.000e+0
Identity = 858/874 (98.17%), Postives = 860/874 (98.40%), Query Frame = 1
Query:   58 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNXXXXXXXXXXXXXXXXXXXXXXXXXXIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKXXXXXXXXXXXXNLTCQSSVYNYDGIEQLVKLIRSDHXXXXXXXXXXXXXXTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPALSSIPDSDDKKAQEXXXXXXXXXXXXXXXXXXXXXXXXYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHSYRKL 2679
            MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLR CNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPE NDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNKDKAKKSSKAGSARKKKKEEEDKPKEIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKIAAAQAIGIMAQNLTCQSSVYNYDGIEQLVKLIRSDHKELKEAASLALANLTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKS+STSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPA+SSIPDSDDKKAQE        T K  SKGKKDSRRSSYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGH YRKL
Sbjct:    1 MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIYKFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEVRKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDNSGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRPCNGIPIMLELLKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPEFNDLHVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNKDKAKKSSKAGSARKKKKEEEDKPKEIVSSFTLPEVKVHACKAIMKACRIDDVRRMFHECDTEKLLVQLLSHESEPVKIAAAQAIGIMAQNLTCQSSVYNYDGIEQLVKLIRSDHKELKEAASLALANLTSGNVKNCQEIAAKHGLEHLVSCLSNSQEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSMSTSVQSKAALVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASEKESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVGYLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPKPMTPAVSSIPDSDDKKAQE------DKTRKKGSKGKKDSRRSSYVNAENLDDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQASELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIHLHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFIIDLISDPGRFIPIDSVDGHYYRKL 868          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARMC37.321e-12839.31armadillo repeat containing 3 [Source:HGNC Symbol;... [more]
ARMC36.899e-12639.31armadillo repeat containing 3 [Source:HGNC Symbol;... [more]
ARMC31.033e-12539.31armadillo repeat containing 3 [Source:HGNC Symbol;... [more]
ARMC36.719e-5040.41armadillo repeat containing 3 [Source:HGNC Symbol;... [more]
ARMC33.326e-1836.13armadillo repeat containing 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc31.252e-14634.55armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
armc31.208e-16336.66armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
armc39.957e-14240.99armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
armc31.033e-12340.17armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
armc33.203e-12140.17armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
armc33.749e-9936.46armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Armc31.908e-11539.32armadillo repeat containing 3 [Source:MGI Symbol;A... [more]
Armc32.243e-11539.32armadillo repeat containing 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5W041|ARMC3_HUMAN3.313e-12539.31Armadillo repeat-containing protein 3 OS=Homo sapi... [more]
sp|A2AU72|ARMC3_MOUSE1.569e-11439.32Armadillo repeat-containing protein 3 OS=Mus muscu... [more]
sp|Q9FPR3|EDR1_ARATH3.179e-1030.50Serine/threonine-protein kinase EDR1 OS=Arabidopsi... [more]
sp|Q9C9U5|SIS8_ARATH1.247e-931.67Probable serine/threonine-protein kinase SIS8 OS=A... [more]
sp|Q05609|CTR1_ARATH1.801e-731.98Serine/threonine-protein kinase CTR1 OS=Arabidopsi... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H3H00.000e+044.44Cnd1 domain-containing protein (Fragment) OS=Macro... [more]
A0A1S3H6M20.000e+041.32armadillo repeat-containing protein 3 isoform X1 O... [more]
A0A1S3H9480.000e+041.15armadillo repeat-containing protein 3 isoform X2 O... [more]
A0A210QJI70.000e+040.98Armadillo repeat-containing protein 3 OS=Mizuhopec... [more]
A0A2C9LYI70.000e+040.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc39.534e-11231.36armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001567.11.254e-5834.59pep scaffold:Pmarinus_7.0:GL478323:89:6694:-1 gene... [more]
ENSPMAT00000005330.12.356e-3338.33pep scaffold:Pmarinus_7.0:GL481917:332:1862:1 gene... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO384620.000e+036.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438864.773e-725.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc31.151e-9533.02armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000079416.10.000e+099.43SMESG000079416.1[more]
SMESG000079416.10.000e+098.17SMESG000079416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025001 ID=SMED30025001|Name=Armadillo repeat-containing protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2826bp
GCATAGCAACTTTGACCGCGGATTTTTAAATTACACAATTACTTTTATAA
TTTAGTTATGGGTAAGAAAATCAAGAAAGATGACAAAAATGCCACAGAGG
ACACATTCGATCCGTTGCTAATTGAATCCCACCAAGCAGAAACAGTCGTT
CTAATGCTCAACAGTTCGGAAGAAGATGTTCAAATTAAAGCCTGTGAAGC
TATATATAAATTTGCCAATAAATGTGATGAAAACAAGGAATTGTTGTTGC
AATTAAAAACATGTGATCAATTGATAAGATTATTGAAAAGTGAAGAGAAA
GTAATTCGAAGAAATTCCATAATGGTTTTAGCAGTAATGTGTCAACATGC
TGAAGTTAGGAAAATCCTGAAATCTCAAGACACAATAATACCGTTATTAT
TGGGATTATTATCCAACAACGAATATTCGACAACAAGTGAATTTGCAGCG
TTGGCCTTGGGATATCTTTGCCAAGAATATACAGTAATTTCCAAAGTTAT
TGACAACAGTGGTGTATCAAGTTTGGTGGAATGCCTATCCAGTGAAGATC
CAGACGTTCAAAAAAATGCCATTTGTTGCTTAGATTTGGTTTTGCGAGAT
TTTGAAGCTCGGCCATTATTGAGACTCTGCAATGGGATTCCGATTATGTT
AGAATTGTTGAAATCTGAGTACCCTGTCATTCAAGAAAGTACTCTCAGCG
CATTTGCCAAGGCATCTCTAGATAGTAATATTCGAGGAATAATCCGCGAC
TTGGATTGCGTAAATAAATTTGTCGACATTATTGGTCGACCGGAATTAAA
TGACCTCCATGTCATCAGTTTGCAAGTGATAGCGACATGTCTTGAGGACC
TAGAATGTGTCAAACAACTTAAAGAGAGTGGAGGCTTGATGCGCCTCTTA
GCATTTATTGGTGACTCGCAGTTACCAGAAGAAGATAATAAAGACAAAGC
TAAAAAATCAAGTAAAGCAGGCAGTGCTAGAAAGAAAAAGAAAGAGGAAG
AAGATAAACCTAAAGAAATTGTTTCATCCTTTACCCTTCCTGAAGTAAAG
GTTCATGCTTGTAAAGCTATAATGAAGGCCTGTAGAATTGATGACGTACG
AAGAATGTTTCATGAATGTGACACAGAGAAACTTCTCGTTCAATTGTTGT
CTCATGAATCTGAACCAGTCAAGATCGCTGCTGCACAGGCTATTGGAATA
ATGGCTCAGAATTTAACATGTCAGTCCAGTGTATATAACTACGACGGTAT
AGAACAATTAGTCAAGCTTATTCGAAGTGATCATAAAGAATTAAAAGAAG
CTGCATCTTTAGCTCTCGCTAATCTAACATCAGGAAACGTTAAAAATTGC
CAAGAAATTGCCGCTAAACACGGACTGGAACATCTAGTGAGTTGCTTATC
AAATTCCCAAGAAGGGATTTGCTCCAATGCACTGGTAGCTATCTCAAACA
TGGCAACTGAGGAACCCTTGCGAACTAAACTTCAGCAAAACGGTCTGATA
AAAGCTCTTGTAGCACCATTGAAGTCATTGTCAACTTCCGTTCAATCAAA
GGCAGCTTTAGTTGTAGCATCATTTCTGAATGATTCAAAATCAAGAATAG
ATTTTCGAAACAATGGTGGAATCGTAGCTTTATATAATTTATTGTTATCA
AATAATGCTGAAGTTCGTCGATCTGTCTGTTGGGCAATAACTATTGTAGC
AAGTGAAAAAGAATCCGCCGAAGAATTGTCTCATATTGGGGCTATGAAGG
TTTTGCAGGATCTTAACAAGTCAGAAAAAAAACGCAACAAGTTTTCTGAA
GCTGCCCTTAATCGGCTTTATGATAGCAATTTGAATTTAAAATTTGCCCT
AGTTGGATATTTAGATTTCACAGATCAAATTGGGGAATTGTTTTATGATT
GTGGACAACAGAAACCTGATTCCAATGTTGAACCGATAGAAATATACGGA
CTTGATCCAATTAATAGCAAAAGGCCGATTATTCTGATTAACTCTATTTT
ACCAAAACCAATGACTCCGGCTCTTTCGTCGATCCCCGACAGTGACGATA
AAAAGGCTCAAGAGGATAAGACACGAAAGAAAGGATCCACTTCTAAGTCT
CATTCAAAAGGTAAAAAAGATTCACGAAGATCGAGTTATGTGAATGCGGA
AAATTTAGATGATCCTCTGAATGGTTCAACGAAACTTGATATTGTTGATG
GCTCAACGCCGGCTTATAAGTTACCATCAGATCTTCATTTGATCGGTTAT
ATTGAAGAAGTAGTGGAAATCATAACTCCTTTGAGAACCGTCCTGGAACA
GGCATCAGAACTCGCCAAATATGTTTCCATGCGTATGGGAGGACCGATTT
CTCAACAAGATATTATGTCATTTCCTTATGAATTGGAGATCAGTAAATTG
AAAATTGAATTCCAGTCCAACGTCATTCCAATAGGTCGTATTACATCCGG
AATCCATCTTCATCGAGCACTTTTATTTAAATTCTTAGCGGATAAATTAT
GCATTCCTACTAACCTTCGACGAGGAGAATATAATCGCTCCTGGAATGAA
ATGTGGATTAATATTAATGAAGGAAAATCTCCGAAACCCAACATGCAGCT
ATTCATCATTGATCTGATCAGTGATCCGGGGCGGTTCATTCCAATTGATT
CAGTAGATGGCCATTCTTATCGAAAACTTTAAACATAGAAATAGTTTACA
TTCGAATCACTAAATAATATTTTAACCGACTTTTTATGGAATATAAAAGT
TTGAAATGAAAGTGTTTTTCAAAAGTTCAAATTTTCTGAAAGGTAAATTT
TCAAGGTCTTATTGCTTATCTTATAT
back to top

protein sequence of SMED30025001-orf-1

>SMED30025001-orf-1 ID=SMED30025001-orf-1|Name=SMED30025001-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=875bp
MGKKIKKDDKNATEDTFDPLLIESHQAETVVLMLNSSEEDVQIKACEAIY
KFANKCDENKELLLQLKTCDQLIRLLKSEEKVIRRNSIMVLAVMCQHAEV
RKILKSQDTIIPLLLGLLSNNEYSTTSEFAALALGYLCQEYTVISKVIDN
SGVSSLVECLSSEDPDVQKNAICCLDLVLRDFEARPLLRLCNGIPIMLEL
LKSEYPVIQESTLSAFAKASLDSNIRGIIRDLDCVNKFVDIIGRPELNDL
HVISLQVIATCLEDLECVKQLKESGGLMRLLAFIGDSQLPEEDNKDKAKK
SSKAGSARKKKKEEEDKPKEIVSSFTLPEVKVHACKAIMKACRIDDVRRM
FHECDTEKLLVQLLSHESEPVKIAAAQAIGIMAQNLTCQSSVYNYDGIEQ
LVKLIRSDHKELKEAASLALANLTSGNVKNCQEIAAKHGLEHLVSCLSNS
QEGICSNALVAISNMATEEPLRTKLQQNGLIKALVAPLKSLSTSVQSKAA
LVVASFLNDSKSRIDFRNNGGIVALYNLLLSNNAEVRRSVCWAITIVASE
KESAEELSHIGAMKVLQDLNKSEKKRNKFSEAALNRLYDSNLNLKFALVG
YLDFTDQIGELFYDCGQQKPDSNVEPIEIYGLDPINSKRPIILINSILPK
PMTPALSSIPDSDDKKAQEDKTRKKGSTSKSHSKGKKDSRRSSYVNAENL
DDPLNGSTKLDIVDGSTPAYKLPSDLHLIGYIEEVVEIITPLRTVLEQAS
ELAKYVSMRMGGPISQQDIMSFPYELEISKLKIEFQSNVIPIGRITSGIH
LHRALLFKFLADKLCIPTNLRRGEYNRSWNEMWININEGKSPKPNMQLFI
IDLISDPGRFIPIDSVDGHSYRKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000225ArmadilloSMARTSM00185arm_5coord: 385..425
e-value: 2.9
score: 16.9
coord: 97..139
e-value: 11.0
score: 12.8
coord: 344..384
e-value: 45.0
score: 8.2
coord: 427..467
e-value: 0.084
score: 22.0
coord: 140..180
e-value: 1.4
score: 17.9
coord: 56..96
e-value: 20.0
score: 10.9
coord: 181..221
e-value: 74.0
score: 6.5
coord: 509..549
e-value: 0.023
score: 23.9
IPR000225ArmadilloPFAMPF00514Armcoord: 392..425
e-value: 3.9E-4
score: 20.4
coord: 427..466
e-value: 3.1E-5
score: 23.9
coord: 145..175
e-value: 1.2E-4
score: 21.9
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 396..427
score: 10.517
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 320..588
e-value: 2.8E-41
score: 143.5
coord: 3..300
e-value: 9.8E-37
score: 128.6
NoneNo IPR availablePFAMPF14381EDR1coord: 592..860
e-value: 8.4E-33
score: 113.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 654..700
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 662..676
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..315
NoneNo IPR availablePANTHERPTHR46618FAMILY NOT NAMEDcoord: 322..874
coord: 1..312
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 147..585
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 28..174