CTF/NF-I domain-containing protein

Overview
NameCTF/NF-I domain-containing protein
Smed IDSMED30024999
Length (bp)1970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CTF/NF-I domain-containing protein (SMED30024999) t-SNE clustered cells

Violin plots show distribution of expression levels for CTF/NF-I domain-containing protein (SMED30024999) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CTF/NF-I domain-containing protein (SMED30024999) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CTF/NF-I domain-containing protein (SMED30024999) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024999

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30024999SMESG000010567.1 dd_Smed_v4_9508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024999SMESG000010567.1 dd_Smed_v4_9508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30024999SMESG000010567.1 dd_Smed_v4_9508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30024999SMESG000010567.1 dd_Smed_v4_9508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024999SMESG000010567.1 dd_Smed_v6_9508_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30024999SMESG000010567.1 SMED30024999smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIA (nuclear factor I A [Source:HGNC Symbol;Acc:HGNC:7784])

HSP 1 Score: 72.7886 bits (177), Expect = 4.305e-14
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEYREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIX (nuclear factor I X [Source:HGNC Symbol;Acc:HGNC:7788])

HSP 1 Score: 71.2478 bits (173), Expect = 1.051e-13
Identity = 48/163 (29.45%), Postives = 82/163 (50.31%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQH 628
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +      L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H
Sbjct:   31 FIEALLPHVRAFSYTWF-NLQARKRKYFKKHEKRMSKDEERAVKDE-----LLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHH 183          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIA (nuclear factor I A [Source:HGNC Symbol;Acc:HGNC:7784])

HSP 1 Score: 74.3294 bits (181), Expect = 1.122e-13
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEYREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIX (nuclear factor I X [Source:HGNC Symbol;Acc:HGNC:7788])

HSP 1 Score: 73.9442 bits (180), Expect = 2.153e-13
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K  +   K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:   18 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 171          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIX (nuclear factor I X [Source:HGNC Symbol;Acc:HGNC:7788])

HSP 1 Score: 73.9442 bits (180), Expect = 2.153e-13
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K  +   K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:   18 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 171          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Match: nfi-1 (NFI (Nuclear Factor I) family [Source:UniProtKB/TrEMBL;Acc:Q5H9N3])

HSP 1 Score: 65.0846 bits (157), Expect = 1.051e-10
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHT--CQRDLCIRPQHL 631
            FV  +LP  +     W       R+ F+E   +         L    N   +L  ++     LL K+ ++IQ       I   +N  E    + CI++  D +G+M+RID  + ADKVWRLD +  IL+ G+PL S D   +  +  C   LCI P H+
Sbjct:   59 FVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDEL--KVKWASRLLGKIKKDIQNDDKEAFISA-INGSE---PNKCIISVADQKGKMRRIDCLRQADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHPLCINPFHM 211          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Match: nfi-1 (NFI (Nuclear Factor I) family [Source:UniProtKB/TrEMBL;Acc:Q5H9N3])

HSP 1 Score: 65.0846 bits (157), Expect = 1.056e-10
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHT--CQRDLCIRPQHL 631
            FV  +LP  +     W       R+ F+E   +         L    N   +L  ++     LL K+ ++IQ       I   +N  E    + CI++  D +G+M+RID  + ADKVWRLD +  IL+ G+PL S D   +  +  C   LCI P H+
Sbjct:   39 FVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDEL--KVKWASRLLGKIKKDIQNDDKEAFISA-INGSE---PNKCIISVADQKGKMRRIDCLRQADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHPLCINPFHM 191          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Match: nfi-1 (NFI (Nuclear Factor I) family [Source:UniProtKB/TrEMBL;Acc:Q5H9N3])

HSP 1 Score: 65.0846 bits (157), Expect = 1.196e-10
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHT--CQRDLCIRPQHL 631
            FV  +LP  +     W       R+ F+E   +         L    N   +L  ++     LL K+ ++IQ       I   +N  E    + CI++  D +G+M+RID  + ADKVWRLD +  IL+ G+PL S D   +  +  C   LCI P H+
Sbjct:   75 FVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDEL--KVKWASRLLGKIKKDIQNDDKEAFISA-INGSE---PNKCIISVADQKGKMRRIDCLRQADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHPLCINPFHM 227          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Fly
Match: NfI (gene:FBgn0042696 transcript:FBtr0333678)

HSP 1 Score: 63.929 bits (154), Expect = 3.311e-10
Identity = 46/165 (27.88%), Postives = 85/165 (51.52%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQL-NEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LP+ K     W  N+   ++K+    ++ +EK   + L+ + +   +L NE+  +       LL KL ++I  +S  + ++  +     K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+  +PL S D   +    +     LC+ P H+
Sbjct:   33 FIEALLPYVKSFSYSWF-NLQAAKRKY----YKKHEK--RMSLEEERHCKDELQNEKTEVKQKWASRLLGKLRKDITQESREDFVQSIIG----KRKSICVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHI 186          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Fly
Match: NfI (gene:FBgn0042696 transcript:FBtr0089141)

HSP 1 Score: 63.929 bits (154), Expect = 3.587e-10
Identity = 46/165 (27.88%), Postives = 85/165 (51.52%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQL-NEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LP+ K     W  N+   ++K+    ++ +EK   + L+ + +   +L NE+  +       LL KL ++I  +S  + ++  +     K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+  +PL S D   +    +     LC+ P H+
Sbjct:   33 FIEALLPYVKSFSYSWF-NLQAAKRKY----YKKHEK--RMSLEEERHCKDELQNEKTEVKQKWASRLLGKLRKDITQESREDFVQSIIG----KRKSICVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHI 186          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 73.1738 bits (178), Expect = 5.355e-14
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   38 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 191          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 73.559 bits (179), Expect = 3.295e-13
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 73.1738 bits (178), Expect = 3.398e-13
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 73.1738 bits (178), Expect = 4.386e-13
Identity = 48/166 (28.92%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K  +   K +  +VK   L+E+  +       LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKY-------FKKHEKRMSKEEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfic (nuclear factor I/C [Source:ZFIN;Acc:ZDB-GENE-080305-2])

HSP 1 Score: 72.4034 bits (176), Expect = 6.651e-13
Identity = 48/166 (28.92%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRD---LCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K  +   K +  +VK   L E+  +       LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +    Q     LC++P H+
Sbjct:   16 FIEALLPHVRAFAYTWF-NLQARKRKY-------FKKHEKRMTKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVLSITG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKGGQCSNPILCVQPHHI 169          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: kif2c (kinesin family member 2C [Source:Xenbase;Acc:XB-GENE-961445])

HSP 1 Score: 80.8777 bits (198), Expect = 1.550e-15
Identity = 51/166 (30.72%), Postives = 84/166 (50.60%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIY---HTCQRDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       Y+K  +   K +   VK   LNE+  +       LL KL ++I+P+   + +         K   SC+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +    H     LC++P H+
Sbjct:    7 FIEALLPHVRAFAYTWF-NLQARKRKY-------YKKHEKKMTKEEERGVKDELLNEKAEVKQKWASRLLAKLRKDIRPEFREDFVLSITG----KKAASCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKASHCSNHQLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: kif2c (kinesin family member 2C [Source:Xenbase;Acc:XB-GENE-961445])

HSP 1 Score: 80.1073 bits (196), Expect = 3.852e-15
Identity = 51/166 (30.72%), Postives = 84/166 (50.60%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIY---HTCQRDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       Y+K  +   K +   VK   LNE+  +       LL KL ++I+P+   + +         K   SC+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +    H     LC++P H+
Sbjct:    7 FIEALLPHVRAFAYTWF-NLQARKRKY-------YKKHEKKMTKEEERGVKDELLNEKAEVKQKWASRLLAKLRKDIRPEFREDFVLSITG----KKAASCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKASHCSNHQLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: kif2c (kinesin family member 2C [Source:Xenbase;Acc:XB-GENE-961445])

HSP 1 Score: 80.1073 bits (196), Expect = 4.078e-15
Identity = 51/166 (30.72%), Postives = 84/166 (50.60%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIY---HTCQRDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       Y+K  +   K +   VK   LNE+  +       LL KL ++I+P+   + +         K   SC+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +    H     LC++P H+
Sbjct:   16 FIEALLPHVRAFAYTWF-NLQARKRKY-------YKKHEKKMTKEEERGVKDELLNEKAEVKQKWASRLLAKLRKDIRPEFREDFVLSITG----KKAASCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKASHCSNHQLCVQPHHI 169          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: nfix (nuclear factor I/X (CCAAT-binding transcription factor) [Source:NCBI gene;Acc:100158549])

HSP 1 Score: 73.9442 bits (180), Expect = 2.745e-13
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K  +   K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:    7 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: nfix (nuclear factor I/X (CCAAT-binding transcription factor) [Source:NCBI gene;Acc:100158549])

HSP 1 Score: 73.9442 bits (180), Expect = 2.745e-13
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K  +   K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:    7 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHEKRMSKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfia (nuclear factor I/A [Source:MGI Symbol;Acc:MGI:108056])

HSP 1 Score: 73.9442 bits (180), Expect = 2.212e-14
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:    7 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEYREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfix (nuclear factor I/X [Source:MGI Symbol;Acc:MGI:97311])

HSP 1 Score: 73.9442 bits (180), Expect = 1.387e-13
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K      + L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:    7 FIEALLPHVRAFSYTWF-NLQARKRKYFKKHEKRMSKDEERAVK-----DELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfix (nuclear factor I/X [Source:MGI Symbol;Acc:MGI:97311])

HSP 1 Score: 73.559 bits (179), Expect = 2.004e-13
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K      + L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFSYTWF-NLQARKRKYFKKHEKRMSKDEERAVK-----DELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfia (nuclear factor I/A [Source:MGI Symbol;Acc:MGI:108056])

HSP 1 Score: 73.9442 bits (180), Expect = 2.046e-13
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEYREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfia (nuclear factor I/A [Source:MGI Symbol;Acc:MGI:108056])

HSP 1 Score: 73.559 bits (179), Expect = 2.116e-13
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEYREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P14057|NFIL_PIG (Nuclear factor 1 (Fragment) OS=Sus scrofa OX=9823 GN=NFI PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.286e-13
Identity = 48/164 (29.27%), Postives = 80/164 (48.78%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLK----FDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRD---LCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K     +   VKQ          LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +    Q     LC++P H+
Sbjct:   13 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQ-----KWASRLLAKLRKDIRPECREDFVLAITG----KKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHI 166          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P13623|NFIX_MESAU (Nuclear factor 1 X-type OS=Mesocricetus auratus OX=10036 GN=NFIX PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.507e-12
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +      L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFSYTWF-NLQARKRKYFKKHEKRMSKDEERAVKDE-----LLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P70257|NFIX_MOUSE (Nuclear factor 1 X-type OS=Mus musculus OX=10090 GN=Nfix PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.712e-12
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K      + L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFSYTWF-NLQARKRKYFKKHEKRMSKDEERAVK-----DELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P09414|NFIA_RAT (Nuclear factor 1 A-type OS=Rattus norvegicus OX=10116 GN=Nfia PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.787e-12
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEYREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14938|NFIX_HUMAN (Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.816e-12
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K      + L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G+PL S D   +Y + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFSYTWF-NLQARKRKYFKKHEKRMSKDEERAVK-----DELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: G7YHM3 (Nuclear factor 1 A-type OS=Clonorchis sinensis OX=79923 GN=CLF_108118 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.193e-55
Identity = 117/263 (44.49%), Postives = 174/263 (66.16%), Query Frame = 2
Query:  143 KPSESLFVRSILPHCKRIGPLWLKNITNIRQK-------FRENSHQTYEKSNEIFLKFDSNSVKQLN--EEIHIVVNLLRKLYREIQPQSVMNIIKCWL-NFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSI---KINNSQDK---HLNDEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLK 883
            KPSE+LFVR+++  CKRI PLW + ++++R++          NS QT    + I LK     + ++N   E   V NLL+KLY+E+   SV   +KCWL +   ++  DSC++++GD +GRM+RIDGGKG+DKVWRLDT++G+LYHGLP++S D+N++ HTC ++LC+RPQH+RFRA+SV+LV+VLKAL Q GY++    I    D    + +DE VD+ GPF I EL+  R E +   + +  KL+ S+ D    +  P L+
Sbjct:  161 KPSEALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMANNSGQTQGDWSLIGLK-----IAEMNATSETDAVANLLKKLYKELPADSVFWFLKCWLCSEDSLQDPDSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDQELCVRPQHIRFRASSVALVVVLKALAQAGYTVIPPPIPAGPDGVAPNASDESVDVFGPFTIDELQQYRRENLNPAEESISKLSLSAADREFAETVPVLR 418          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A5K3FM28 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.287e-55
Identity = 112/221 (50.68%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  149 SESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFD--SNSVKQLNE--EIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSD-DSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSIKINNSQDKH--LNDEFVDIAGPFGILELETLR 790
            SE+LFVR I+  CKRI PLW + I+++R++ RE + +T   + +    +   S  ++++N+  E   VVNLL+KL++E+   SV+  IKCWL   +  +D DSC+L++ D +GRM+RIDGGKG+DKVWRLDT++G+LYHGLP++S D+N++ HTC ++LC+RPQH+RFRA+SV+LV+VLKAL Q GYSI I  S   H   +DE VD+ GPF I EL+  R
Sbjct:   76 SEALFVRIIVSRCKRIAPLWFRGISSMRERNREENRRTSTNAGQTQNDWSIISGKIREMNQIMETDTVVNLLKKLHKELPADSVLKFIKCWLGDADALNDPDSCVLSRPDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCAQELCVRPQHIRFRASSVALVIVLKALAQAGYSI-IPPSPGLHPQPSDESVDVFGPFSIEELQQYR 295          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A183P8I7 (CTF/NF-I domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10671 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.001e-53
Identity = 111/235 (47.23%), Postives = 162/235 (68.94%), Query Frame = 2
Query:  134 TESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRE-------NSHQTYEKSNEIFLKFDSNSVKQLN--EEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDD-SCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGY-----SIKIN-NSQDKHLNDEFVDIAGPFGILELETLR 790
              +KPSE+LFVR+++  CKRI PLW + ++++R++ RE       NS Q+    + I LK     ++++N   E   V NLL+KLY+E+   SV   +KCWL   +  +D  SC++++GD +GRM+RIDGGKG+DKVWRLDT++G+LYHGLP++S D+N++ HTC  +LC+RPQH+RFRA+SV+LV+VLKAL Q GY     SI  N      ++ DE+VD+ GPF I +L+  R
Sbjct:  147 AAAKPSEALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMACNSGQSQSDWSLIALK-----IREMNAGSETDAVSNLLKKLYKELPSDSVFWFLKCWLGSEDTLNDPHSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDHELCVRPQHIRFRASSVALVVVLKALAQAGYTIIPPSIAANPEGIAPNVPDEYVDVFGPFSIEQLQQYR 376          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A4V3SD97 (CTF/NF-I domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008887 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 8.140e-53
Identity = 117/263 (44.49%), Postives = 174/263 (66.16%), Query Frame = 2
Query:  143 KPSESLFVRSILPHCKRIGPLWLKNITNIRQK-------FRENSHQTYEKSNEIFLKFDSNSVKQLN--EEIHIVVNLLRKLYREIQPQSVMNIIKCWL-NFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSI---KINNSQD---KHLNDEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLK 883
            KPSE+LFVR+++  CKRI PLW + ++++R++          NS QT    + I LK     + ++N   E   V NLL+KLY+E+   SV   +KCWL +   ++  DSC++++GD +GRM+RIDGGKG+DKVWRLDT++G+LYHGLP++S D+N++ HTC ++LC+RPQH+RFRA+SV+LV+VLKAL Q GY++    I    D    + +DE VD+ GPF I EL+  R E +   + +  KL+ S+ D    +  P L+
Sbjct:  161 KPSEALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMANNSGQTQGDWSLIGLK-----IAEMNATSETDAVANLLKKLYKELPADSVFWFLKCWLCSEDSLQDPDSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDQELCVRPQHIRFRASSVALVVVLKALAQAGYTVIPPPIPAGPDGVAPNASDESVDVFGPFTIDELQQYRRENLNPAEESISKLSLSAADREFAETVPVLR 418          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A183KEY0 (CTF/NF-I domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS13574 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.156e-52
Identity = 111/235 (47.23%), Postives = 161/235 (68.51%), Query Frame = 2
Query:  134 TESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRE-------NSHQTYEKSNEIFLKFDSNSVKQLN--EEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDD-SCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGY-----SIKIN-NSQDKHLNDEFVDIAGPFGILELETLR 790
              +KPSE+LFVR+++  CKRI PLW + ++++R++ RE       NS Q+    + I LK     + ++N   E   V NLL+KLY+E+   SV   +KCWL   +  +D  SC++++GD +GRM+RIDGGKG+DKVWRLDT++G+LYHGLP++S D+N++ HTC  +LC+RPQH+RFRA+SV+LV+VLKAL Q GY     SI  N      ++ DE+VD+ GPF I +L+  R
Sbjct:  149 AAAKPSEALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMACNSGQSQSDWSLIALK-----IGEMNAGSETDAVSNLLKKLYKELPSDSVFWFLKCWLGSEDTLNDPHSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDHELCVRPQHIRFRASSVALVVVLKALAQAGYTIIPPSIAANPEGIAPNVPDEYVDVFGPFSIEQLQQYR 378          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 74.7146 bits (182), Expect = 9.794e-14
Identity = 46/160 (28.75%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K D    ++   +      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVK-DELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 74.3294 bits (181), Expect = 1.345e-13
Identity = 46/160 (28.75%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K D    ++   +      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   15 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVK-DELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 74.3294 bits (181), Expect = 1.676e-13
Identity = 46/160 (28.75%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K D    ++   +      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   38 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVK-DELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 191          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 74.3294 bits (181), Expect = 1.710e-13
Identity = 46/160 (28.75%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K D    ++   +      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   73 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVK-DELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 226          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 74.3294 bits (181), Expect = 1.715e-13
Identity = 46/160 (28.75%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K D    ++   +      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:   38 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVK-DELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 191          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Sea Lamprey
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 72.7886 bits (177), Expect = 3.971e-15
Identity = 48/164 (29.27%), Postives = 82/164 (50.00%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLK----FDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K     + + VKQ          LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:    7 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKDEERAVKDELLGEKSEVKQ-----KWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGVPLESTDGERLVKSPQCANPGLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Nematostella
Match: EDO45394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT45])

HSP 1 Score: 63.929 bits (154), Expect = 1.162e-11
Identity = 45/162 (27.78%), Postives = 81/162 (50.00%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENS-HQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRK-LYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHT--CQR-DLCIRPQHL 631
            F+ S+LPH K     W       R+ ++++    T  +      + D+ + +  ++    ++  LRK +  E + + VM I        +  S   C+++  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  +  C+   LC+ P H+
Sbjct:   16 FIESLLPHVKAFAYTWFNLQARKRKHYKKHDIRMTPAEERRCKEELDAEADEVKHKWASRLLGKLRKDILAECREEFVMAIAG-----GKPGSSCRCVISNQDQKGKMRRIDCLRQADKVWRLDLVMVILFRGIPLESTDGERLGKSEYCRHPGLCVLPNHI 172          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:101158842])

HSP 1 Score: 73.559 bits (179), Expect = 2.818e-13
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+ +   +   K  E  +K +  S K   ++      LL KL ++I+P+   + +         K    C+L+  D +G+M+RID  + ADKVWRLD ++ IL+ G+PL S D   +  + Q     LC++P H+
Sbjct:    6 FIEALLPHVRAFAYTWF-NLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQ-KWASRLLAKLRKDIRPEFREDFVLTVTG----KKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPSLCVQPHHI 159          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: nfixb (nuclear factor 1 X-type [Source:NCBI gene;Acc:101164563])

HSP 1 Score: 70.4774 bits (171), Expect = 2.285e-12
Identity = 75/272 (27.57%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL--RFRXXXXXXXXXXXXXEQTGYSIKINNSQDK--------HLN--DEFVDIAGPFGILELETLRHELVQVTQLNSHKLA-CSSDDIYILDQNPDLKKYYLTSTPS 910
            F+ ++LPH +     W  N+   ++K+       ++K      K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G PL S D   +  + Q     LC++P H+    +   + L   +   EQ+G S   N   D         HL+  D FV  +G + + EL  +    V      +  LA   S   Y ++Q   L +  +TSTPS
Sbjct:   47 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHERRMTKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKSPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGSPLESTDGERLVKSPQCSNHGLCVQPHHIGVTVKELDLYLAYFVHTPEQSGQSDNSNQQGDTDVKPPANGHLSFQDCFV-TSGVWNVAELVRVSQTPVATATGPNFSLADLDSPGYYNINQV-ALGRRSITSTPS 304          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: nfixb (nuclear factor 1 X-type [Source:NCBI gene;Acc:101164563])

HSP 1 Score: 70.4774 bits (171), Expect = 2.294e-12
Identity = 75/272 (27.57%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL--RFRXXXXXXXXXXXXXEQTGYSIKINNSQDK--------HLN--DEFVDIAGPFGILELETLRHELVQVTQLNSHKLA-CSSDDIYILDQNPDLKKYYLTSTPS 910
            F+ ++LPH +     W  N+   ++K+       ++K      K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G PL S D   +  + Q     LC++P H+    +   + L   +   EQ+G S   N   D         HL+  D FV  +G + + EL  +    V      +  LA   S   Y ++Q   L +  +TSTPS
Sbjct:    7 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHERRMTKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKSPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGSPLESTDGERLVKSPQCSNHGLCVQPHHIGVTVKELDLYLAYFVHTPEQSGQSDNSNQQGDTDVKPPANGHLSFQDCFV-TSGVWNVAELVRVSQTPVATATGPNFSLADLDSPGYYNINQV-ALGRRSITSTPS 264          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: nfixb (nuclear factor 1 X-type [Source:NCBI gene;Acc:101164563])

HSP 1 Score: 70.8626 bits (172), Expect = 2.301e-12
Identity = 75/272 (27.57%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL--RFRXXXXXXXXXXXXXEQTGYSIKINNSQDK--------HLN--DEFVDIAGPFGILELETLRHELVQVTQLNSHKLA-CSSDDIYILDQNPDLKKYYLTSTPS 910
            F+ ++LPH +     W  N+   ++K+       ++K      K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G PL S D   +  + Q     LC++P H+    +   + L   +   EQ+G S   N   D         HL+  D FV  +G + + EL  +    V      +  LA   S   Y ++Q   L +  +TSTPS
Sbjct:   35 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHERRMTKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKSPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGSPLESTDGERLVKSPQCSNHGLCVQPHHIGVTVKELDLYLAYFVHTPEQSGQSDNSNQQGDTDVKPPANGHLSFQDCFV-TSGVWNVAELVRVSQTPVATATGPNFSLADLDSPGYYNINQV-ALGRRSITSTPS 292          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: nfixb (nuclear factor 1 X-type [Source:NCBI gene;Acc:101164563])

HSP 1 Score: 70.0922 bits (170), Expect = 2.334e-12
Identity = 48/166 (28.92%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  161 FVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQ--LNEEIHI----VVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQ---RDLCIRPQHL 631
            F+ ++LPH +     W  N+   ++K+       ++K      K +  +VK   L E+  I       LL KL ++I+P+   + +         K    C+L+  D +G+++RID  + ADKVWRLD ++ IL+ G PL S D   +  + Q     LC++P H+
Sbjct:   35 FIEALLPHVRAFSYTWF-NLQARKRKY-------FKKHERRMTKDEERAVKDELLGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITG----KKSPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGSPLESTDGERLVKSPQCSNHGLCVQPHHI 188          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000010567.1 (SMESG000010567.1)

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 486/490 (99.18%), Postives = 487/490 (99.39%), Query Frame = 2
Query:  131 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSIKINNSQDKHLNDEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKSFNVVKEEENCGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAVTMSSLDIMNKNIIEIQTDELEDXXXXXXXXXXXXXXXXXXXXXXDNWYPNALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSEEGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPV 1600
            MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQT EKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKIN+S DKHLNDEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKS NVVKEEENCGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAVTMSSLDIMNKNIIEIQTDELEDKELIEIMETKKETTKKAKAEMIDNWYPNALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSEEGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPV
Sbjct:    1 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTCEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKINDSHDKHLNDEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKSLNVVKEEENCGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAVTMSSLDIMNKNIIEIQTDELEDKELIEIMETKKETTKKAKAEMIDNWYPNALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSEEGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPV 490          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000010567.1 (SMESG000010567.1)

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 486/530 (91.70%), Postives = 487/530 (91.89%), Query Frame = 2
Query:  131 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSIKINNSQDKHLNDEFVDIAGPFGILELETLRH----------------------------------------ELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKSFNVVKEEENCGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAVTMSSLDIMNKNIIEIQTDELEDXXXXXXXXXXXXXXXXXXXXXXDNWYPNALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSEEGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPV 1600
            MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQT EKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKIN+S DKHLNDEFVDIAGPFGILELETLRH                                        ELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKS NVVKEEENCGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAVTMSSLDIMNKNIIEIQTDELEDKELIEIMETKKETTKKAKAEMIDNWYPNALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSEEGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPV
Sbjct:    1 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTCEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKINDSHDKHLNDEFVDIAGPFGILELETLRHDISKRNFAGDLICEMGIIGKGKSTKLPVGRRDYIRKFSKEELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKSLNVVKEEENCGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAVTMSSLDIMNKNIIEIQTDELEDKELIEIMETKKETTKKAKAEMIDNWYPNALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSEEGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPV 530          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000010567.1 (SMESG000010567.1)

HSP 1 Score: 432.565 bits (1111), Expect = 2.259e-149
Identity = 218/223 (97.76%), Postives = 221/223 (99.10%), Query Frame = 2
Query:  131 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSIKINNSQDKHLNDEFVDIAGPFGILELETLRHEL 799
            MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQT EKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKIN+S DKHLNDEFVDIAGPFGILELETLRH++
Sbjct:    1 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTCEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKINDSHDKHLNDEFVDIAGPFGILELETLRHDI 223          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000029310.1 (SMESG000029310.1)

HSP 1 Score: 245.358 bits (625), Expect = 2.105e-70
Identity = 131/273 (47.99%), Postives = 188/273 (68.86%), Query Frame = 2
Query:  131 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQL------NEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEM-KSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSIKINNSQDKHLN--------DEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTST 904
            +++ +PSE+LFVR +LPHCKR+ PLW K ++++R K RE  H+    S     + D   +  L        E   VVNLL+KLY+E+   +V+  IKCWL FPE  ++++ C L++GD RGRM+RIDGGKG+DKVWRLDT++G+++HG+P++S D+N++ HTC ++LCIRPQHLRF+A+SV+LV+VLKAL+QTGYSI I    + + N        DEFVD++GPF I +L+  R E ++  + +  KL  SS DI +LD  P LK YY + T
Sbjct:   99 VSQMRPSEALFVRCLLPHCKRLAPLWFKGVSSMRDKSRE-EHRRISASTTCQNQNDWERISNLINDMTAASETETVVNLLKKLYKELPADTVLWFIKCWLKFPETTENEEKCALSRGDARGRMRRIDGGKGSDKVWRLDTIVGMMFHGMPMSSTDTNIMVHTCDQELCIRPQHLRFKASSVALVVVLKALQQTGYSI-IPPPDETYSNGDIRSSPSDEFVDVSGPFKIEQLQQYRLEELRPCEQSMGKLNSSSTDINLLDTYPLLKNYYPSYT 369          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000029310.1 (SMESG000029310.1)

HSP 1 Score: 245.358 bits (625), Expect = 3.331e-70
Identity = 131/273 (47.99%), Postives = 188/273 (68.86%), Query Frame = 2
Query:  131 MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNEIFLKFDSNSVKQL------NEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEM-KSDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRXXXXXXXXXXXXXEQTGYSIKINNSQDKHLN--------DEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDLKKYYLTST 904
            +++ +PSE+LFVR +LPHCKR+ PLW K ++++R K RE  H+    S     + D   +  L        E   VVNLL+KLY+E+   +V+  IKCWL FPE  ++++ C L++GD RGRM+RIDGGKG+DKVWRLDT++G+++HG+P++S D+N++ HTC ++LCIRPQHLRF+A+SV+LV+VLKAL+QTGYSI I    + + N        DEFVD++GPF I +L+  R E ++  + +  KL  SS DI +LD  P LK YY + T
Sbjct:  123 VSQMRPSEALFVRCLLPHCKRLAPLWFKGVSSMRDKSRE-EHRRISASTTCQNQNDWERISNLINDMTAASETETVVNLLKKLYKELPADTVLWFIKCWLKFPETTENEEKCALSRGDARGRMRRIDGGKGSDKVWRLDTIVGMMFHGMPMSSTDTNIMVHTCDQELCIRPQHLRFKASSVALVVVLKALQQTGYSI-IPPPDETYSNGDIRSSPSDEFVDVSGPFKIEQLQQYRLEELRPCEQSMGKLNSSSTDINLLDTYPLLKNYYPSYT 393          
The following BLAST results are available for this feature:
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFIA4.305e-1429.38nuclear factor I A [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIX1.051e-1329.45nuclear factor I X [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIA1.122e-1329.38nuclear factor I A [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIX2.153e-1329.52nuclear factor I X [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIX2.153e-1329.52nuclear factor I X [Source:HGNC Symbol;Acc:HGNC:77... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nfi-11.051e-1030.19NFI (Nuclear Factor I) family [Source:UniProtKB/T... [more]
nfi-11.056e-1030.19NFI (Nuclear Factor I) family [Source:UniProtKB/T... [more]
nfi-11.196e-1030.19NFI (Nuclear Factor I) family [Source:UniProtKB/T... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NfI3.311e-1027.88gene:FBgn0042696 transcript:FBtr0333678[more]
NfI3.587e-1027.88gene:FBgn0042696 transcript:FBtr0089141[more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfia5.355e-1429.38nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
nfia3.295e-1329.38nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
nfia3.398e-1329.38nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
nfia4.386e-1328.92nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
nfic6.651e-1328.92nuclear factor I/C [Source:ZFIN;Acc:ZDB-GENE-08030... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif2c1.550e-1530.72kinesin family member 2C [Source:Xenbase;Acc:XB-GE... [more]
kif2c3.852e-1530.72kinesin family member 2C [Source:Xenbase;Acc:XB-GE... [more]
kif2c4.078e-1530.72kinesin family member 2C [Source:Xenbase;Acc:XB-GE... [more]
nfix2.745e-1329.52nuclear factor I/X (CCAAT-binding transcription fa... [more]
nfix2.745e-1329.52nuclear factor I/X (CCAAT-binding transcription fa... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nfia2.212e-1429.38nuclear factor I/A [Source:MGI Symbol;Acc:MGI:1080... [more]
Nfix1.387e-1329.27nuclear factor I/X [Source:MGI Symbol;Acc:MGI:9731... [more]
Nfix2.004e-1329.27nuclear factor I/X [Source:MGI Symbol;Acc:MGI:9731... [more]
Nfia2.046e-1329.38nuclear factor I/A [Source:MGI Symbol;Acc:MGI:1080... [more]
Nfia2.116e-1329.38nuclear factor I/A [Source:MGI Symbol;Acc:MGI:1080... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14057|NFIL_PIG2.286e-1329.27Nuclear factor 1 (Fragment) OS=Sus scrofa OX=9823 ... [more]
sp|P13623|NFIX_MESAU1.507e-1229.27Nuclear factor 1 X-type OS=Mesocricetus auratus OX... [more]
sp|P70257|NFIX_MOUSE1.712e-1229.27Nuclear factor 1 X-type OS=Mus musculus OX=10090 G... [more]
sp|P09414|NFIA_RAT1.787e-1229.38Nuclear factor 1 A-type OS=Rattus norvegicus OX=10... [more]
sp|Q14938|NFIX_HUMAN1.816e-1229.27Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YHM31.193e-5544.49Nuclear factor 1 A-type OS=Clonorchis sinensis OX=... [more]
A0A5K3FM281.287e-5550.68Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183P8I75.001e-5347.23CTF/NF-I domain-containing protein OS=Schistosoma ... [more]
A0A4V3SD978.140e-5344.49CTF/NF-I domain-containing protein OS=Opisthorchis... [more]
A0A183KEY01.156e-5247.23CTF/NF-I domain-containing protein OS=Schistosoma ... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfia9.794e-1428.75nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia1.345e-1328.75nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia1.676e-1328.75nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia1.710e-1328.75nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia1.715e-1328.75nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nfia3.971e-1529.27nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453941.162e-1127.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfia2.818e-1329.38nuclear factor I A [Source:NCBI gene;Acc:101158842... [more]
nfixb2.285e-1227.57nuclear factor 1 X-type [Source:NCBI gene;Acc:1011... [more]
nfixb2.294e-1227.57nuclear factor 1 X-type [Source:NCBI gene;Acc:1011... [more]
nfixb2.301e-1227.57nuclear factor 1 X-type [Source:NCBI gene;Acc:1011... [more]
nfixb2.334e-1228.92nuclear factor 1 X-type [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010567.10.000e+099.18SMESG000010567.1[more]
SMESG000010567.10.000e+091.70SMESG000010567.1[more]
SMESG000010567.12.259e-14997.76SMESG000010567.1[more]
SMESG000029310.12.105e-7047.99SMESG000029310.1[more]
SMESG000029310.13.331e-7047.99SMESG000029310.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024999 ID=SMED30024999|Name=CTF/NF-I domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1970bp
CTTTGGCAAGGATTTTATTGGGGATTTCTGCTAGGCTGTTTCTATTTGAA
TTTTGATTTTTAAAATTCAAATATTAATTCTCAATTTTTTCGTTGTTGCA
TTGATGACTGATAAAAGTTGAAATGTGAAAATGACGGAAAGCAAACCAAG
TGAATCGCTATTTGTTCGCAGCATTCTACCGCACTGCAAACGAATTGGAC
CGTTATGGTTGAAAAATATCACAAATATTCGTCAAAAATTCCGAGAAAAT
AGCCACCAGACCTATGAAAAATCCAATGAAATATTTTTAAAATTCGACAG
CAATTCGGTGAAACAATTGAACGAAGAAATTCATATTGTCGTAAATTTGT
TGCGCAAACTTTACAGAGAAATTCAGCCGCAATCAGTCATGAATATTATT
AAATGTTGGTTGAATTTTCCGGAAATGAAATCGGATGATTCGTGTATTCT
GACGAAAGGAGATTGCAGAGGAAGAATGAAACGAATTGATGGGGGGAAAG
GAGCGGATAAAGTTTGGAGACTCGATACTCTTATTGGTATTCTGTACCAC
GGATTGCCTTTGACCAGTGCTGACAGCAATATGATTTATCATACCTGCCA
ACGAGATTTATGCATAAGACCGCAACATTTGCGATTCAGAGCAGCTTCGG
TTTCACTGGTTTTAGTTTTAAAAGCCTTAGAACAGACGGGATACTCAATA
AAAATTAATAATTCTCAGGATAAACATCTCAATGACGAATTTGTGGACAT
TGCCGGCCCGTTTGGCATTCTGGAGTTGGAAACCCTTCGTCATGAGTTGG
TTCAAGTGACGCAATTAAATTCCCATAAACTGGCCTGCTCCTCAGATGAC
ATTTATATTCTTGACCAAAATCCAGATCTGAAAAAATATTATTTGACCAG
CACGCCTTCCGGTTCACCGATAAATGCCGCTTCCAAGTCCAATGAGAATG
AGATAACGAAGCGATTGTTAACCCGGATTTCTGAAAAATCCAAATTCAAG
TCCTTTAATGTGGTTAAAGAAGAAGAAAATTGCGGCAATAAGAATTTTGA
AAATGTTCTTCCAATCTCAAGTGAAGTGGAACGGCACGTTGTCCATGTTG
GTCCAGCCAACCTTAAAAGGAAAATCAAAATTATTCGAGACGGAATGAAC
GATTCAGGGGCAAAGCGTCAAAAAGCCGTCACAATGTCATCATTAGATAT
AATGAATAAGAATATTATCGAAATCCAAACCGACGAGCTAGAAGACAAAG
AACTCATTGAAATCATGGAGACGAAAAAAGAAACGACAAAGAAGGCAAAG
GCTGAGATGATCGACAATTGGTATCCAAATGCTCTAGAATCTCCTTACAA
GCTGAATAACGAGAATCTGATTCGAGTAATTACGAGATCGGAATCGGAAT
CAACCTTAGAGTTAATGGAAAAGAAAACCAATAGCCAAGTGAGCATCTGT
TGCTACAGCCAGTTGAAACGGACTTCAGAGGAAGGCAGTAAGTTAGATGA
TTACCGAACGAGTGAATTCCTCGACCTATTCCACTCAATGAGGCACCAAC
TGAACACAGGAAGTTCCTTAAAAATGACTCCGAATATTTTTTCCCCAGTT
TCAGAGATTGAAGAATCATAGGCAGCAAGAGAGTCATCCGATCAAGTTTA
CCTTGGTCCTTGAGTTTATTTTGTTGATAATTTTATTTGCCATTGTCGAG
GAAGTGATTCCGGAAGTTCCTGTTGCGATATGCCTTAGCCTGCACTCGAC
TGTTTTAGGAATACAAATAATTACTAGAAATAATATTTTATGATAGCGAT
GTTTATAATTGTTCCGTATATTATTTTCTAGATTATCCAGATGTTCTGTT
TATTGAATTATTTATTATACACAATGTATTATTTATGAATAATAATAATA
ATATTTTCATTTCTTTGACCAGCTCTGTCTGTATCTCTCTCATTTATTTT
ATGTATTTTATTAAATGTGG
back to top

protein sequence of SMED30024999-orf-1

>SMED30024999-orf-1 ID=SMED30024999-orf-1|Name=SMED30024999-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=497bp
MTESKPSESLFVRSILPHCKRIGPLWLKNITNIRQKFRENSHQTYEKSNE
IFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMK
SDDSCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSN
MIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSIKINNSQDKHL
NDEFVDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDL
KKYYLTSTPSGSPINAASKSNENEITKRLLTRISEKSKFKSFNVVKEEEN
CGNKNFENVLPISSEVERHVVHVGPANLKRKIKIIRDGMNDSGAKRQKAV
TMSSLDIMNKNIIEIQTDELEDKELIEIMETKKETTKKAKAEMIDNWYPN
ALESPYKLNNENLIRVITRSESESTLELMEKKTNSQVSICCYSQLKRTSE
EGSKLDDYRTSEFLDLFHSMRHQLNTGSSLKMTPNIFSPVSEIEES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000647CTF/NFI
IPR020604CTF/NFI_DNA-bd-dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006260DNA replication
GO:0006351transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 60..80
NoneNo IPR availablePANTHERPTHR11492:SF6NUCLEAR FACTOR 1 A-TYPEcoord: 11..177
IPR000647CTF transcription factor/nuclear factor 1PANTHERPTHR11492NUCLEAR FACTOR Icoord: 11..177
IPR020604CTF transcription factor/nuclear factor 1, DNA-binding domainPROSITEPS51080CTF_NFI_2coord: 1..193
score: 14.33