ATP-dependent RNA helicase, putative

Overview
NameATP-dependent RNA helicase, putative
Smed IDSMED30024997
Length (bp)5430
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase, putative (SMED30024997) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase, putative (SMED30024997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase, putative (SMED30024997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase, putative (SMED30024997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024997SMESG000056880.1 dd_Smed_v4_4870_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024997SMESG000056880.1 dd_Smed_v4_4870_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024997SMESG000056881.1 dd_Smed_v4_4309_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: MPP2 (membrane palmitoylated protein 2 [Source:HGNC Symbol;Acc:HGNC:7220])

HSP 1 Score: 229.565 bits (584), Expect = 3.709e-65
Identity = 138/430 (32.09%), Postives = 227/430 (52.79%), Query Frame = 3
Query: 3690 IISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNL-EKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            ++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L  +V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L +VN ++ +T   + + +        W+P SW +
Sbjct:    1 MVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 413          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: MPP2 (membrane palmitoylated protein 2 [Source:HGNC Symbol;Acc:HGNC:7220])

HSP 1 Score: 228.409 bits (581), Expect = 2.333e-63
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNL-EKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L  +V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L +VN ++ +T   + + +        W+P SW +
Sbjct:  128 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 541          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: MPP2 (membrane palmitoylated protein 2 [Source:HGNC Symbol;Acc:HGNC:7220])

HSP 1 Score: 228.409 bits (581), Expect = 2.333e-63
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNL-EKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L  +V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L +VN ++ +T   + + +        W+P SW +
Sbjct:  128 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 541          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: MPP2 (membrane palmitoylated protein 2 [Source:HGNC Symbol;Acc:HGNC:7220])

HSP 1 Score: 228.409 bits (581), Expect = 2.333e-63
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNL-EKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L  +V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L +VN ++ +T   + + +        W+P SW +
Sbjct:  128 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 541          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Match: MPP2 (membrane palmitoylated protein 2 [Source:HGNC Symbol;Acc:HGNC:7220])

HSP 1 Score: 228.409 bits (581), Expect = 2.861e-63
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEK-VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L + V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L +VN ++ +T   + + +        W+P SW +
Sbjct:  139 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 552          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12406131:-1 gene:WBGene00002991.1 transcript:F17E5.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 192.586 bits (488), Expect = 4.955e-51
Identity = 129/446 (28.92%), Postives = 225/446 (50.45%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDS--------------TENQAFLIPSQSLQE---RIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEA--KKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +++  QK+  + +GIT+    V+ DG    RC + RI+   ++ +Q  L VGD I E+N   V N   + L  +L   +G +TFKI+ S +    ++    ++++RA FDY+PS+D L+P  Q G+ FK GDI +V++++D N+WQA  + S               +  A LIPS  LQE     +AM+ +    +   +  +K KK    +  +   A  +  + DL TYEEV++    R   ++L+G  G+G++ IK+ L+ + PNRF++PI  T+    K       +  V    MM D + + Y+        +YG K  +IR +   GK  +LD + + +  L+T  ++P+V+ IAAP+L        +G+Q            L++++ +S+   Q + HL +  I N DI+ T   +  ++        W+P +W +
Sbjct:  203 LRLVQFQKDTQEPMGITL---KVNEDG----RCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYR----SAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMERSKNTCNTHCMWFNKKKKYYTTKYLQKHSA--LFDQLDLVTYEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNL--------QGMQD-------PDGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 620          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12414037:-1 gene:WBGene00002991.1 transcript:F17E5.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 194.512 bits (493), Expect = 4.797e-50
Identity = 129/446 (28.92%), Postives = 225/446 (50.45%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDS--------------TENQAFLIPSQSLQE---RIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEA--KKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +++  QK+  + +GIT+    V+ DG    RC + RI+   ++ +Q  L VGD I E+N   V N   + L  +L   +G +TFKI+ S +    ++    ++++RA FDY+PS+D L+P  Q G+ FK GDI +V++++D N+WQA  + S               +  A LIPS  LQE     +AM+ +    +   +  +K KK    +  +   A  +  + DL TYEEV++    R   ++L+G  G+G++ IK+ L+ + PNRF++PI  T+    K       +  V    MM D + + Y+        +YG K  +IR +   GK  +LD + + +  L+T  ++P+V+ IAAP+L        +G+Q            L++++ +S+   Q + HL +  I N DI+ T   +  ++        W+P +W +
Sbjct:  544 LRLVQFQKDTQEPMGITL---KVNEDG----RCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYR----SAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMERSKNTCNTHCMWFNKKKKYYTTKYLQKHSA--LFDQLDLVTYEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNL--------QGMQD-------PDGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 961          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 155.992 bits (393), Expect = 1.215e-38
Identity = 125/417 (29.98%), Postives = 207/417 (49.64%), Query Frame = 3
Query: 3774 NRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKIL-------KSPKRPISNSVNLEKV-----YMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQAL--PLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIIS---EADLHTYEEVV-KFPPS--RVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNR--TQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            N+  + R++   IV+K  L Q GD +LE+N   ++    +E+  +L    G ITF +        + P    +N+V  +K      ++RALFDYDP  D  +P +++ M F+ GDI  VLN  D N+WQA     D   + A LIPS S +++++   + +  +  +  K+ K KK KK E+ +  D  ++ +    +D  TYEEVV + P +  R P ++L G  G+G   ++  L++ +    + P+  TS   K        ++ V +     D K+  +V   E     YG     +  +I +GKT V+  + + +  +++P   PY+I IAAPSL IL   Q+E       K+     EL+ I+ QS+  EQ Y HL +  IVN D  ++   +  +L        W+PA+W
Sbjct:  255 NKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDGEDIQHSLAGLIPSSSFRQQVVLYADEVEREQEQKRKECKGKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRP-IVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILR-RQREVEGTFGVKD----DELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 665          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 155.992 bits (393), Expect = 1.215e-38
Identity = 125/417 (29.98%), Postives = 207/417 (49.64%), Query Frame = 3
Query: 3774 NRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKIL-------KSPKRPISNSVNLEKV-----YMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQAL--PLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIIS---EADLHTYEEVV-KFPPS--RVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNR--TQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            N+  + R++   IV+K  L Q GD +LE+N   ++    +E+  +L    G ITF +        + P    +N+V  +K      ++RALFDYDP  D  +P +++ M F+ GDI  VLN  D N+WQA     D   + A LIPS S +++++   + +  +  +  K+ K KK KK E+ +  D  ++ +    +D  TYEEVV + P +  R P ++L G  G+G   ++  L++ +    + P+  TS   K        ++ V +     D K+  +V   E     YG     +  +I +GKT V+  + + +  +++P   PY+I IAAPSL IL   Q+E       K+     EL+ I+ QS+  EQ Y HL +  IVN D  ++   +  +L        W+PA+W
Sbjct:  255 NKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDGEDIQHSLAGLIPSSSFRQQVVLYADEVEREQEQKRKECKGKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRP-IVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILR-RQREVEGTFGVKD----DELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 665          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 156.377 bits (394), Expect = 2.587e-38
Identity = 125/417 (29.98%), Postives = 207/417 (49.64%), Query Frame = 3
Query: 3774 NRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKIL-------KSPKRPISNSVNLEKV-----YMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQAL--PLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIIS---EADLHTYEEVV-KFPPS--RVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNR--TQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            N+  + R++   IV+K  L Q GD +LE+N   ++    +E+  +L    G ITF +        + P    +N+V  +K      ++RALFDYDP  D  +P +++ M F+ GDI  VLN  D N+WQA     D   + A LIPS S +++++   + +  +  +  K+ K KK KK E+ +  D  ++ +    +D  TYEEVV + P +  R P ++L G  G+G   ++  L++ +    + P+  TS   K        ++ V +     D K+  +V   E     YG     +  +I +GKT V+  + + +  +++P   PY+I IAAPSL IL   Q+E       K+     EL+ I+ QS+  EQ Y HL +  IVN D  ++   +  +L        W+PA+W
Sbjct:  417 NKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDGEDIQHSLAGLIPSSSFRQQVVLYADEVEREQEQKRKECKGKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRP-IVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILR-RQREVEGTFGVKD----DELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 827          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: vari (gene:FBgn0250785 transcript:FBtr0335146)

HSP 1 Score: 214.542 bits (545), Expect = 2.275e-58
Identity = 163/567 (28.75%), Postives = 278/567 (49.03%), Query Frame = 3
Query: 3354 NIIRRNSKKNR-DAGKLYHILKKIHFKTLFNCMKELNN--EEHIPISYNGSLEEIEIDVKNQDYHDGYXXXXXXXXXXXXXXGTEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKI-------LKSPKRPISNS-------VNLEK-----VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK----NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLK-TPLFNPYVILIAAPSL----TILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            +IIR+ S   R ++ +L  +L + HF+ L     E+    E+ +  +  GS  ++EI  + Q    GY               TED+   N+ +P                   +++ ++++P++ LG+TV       +     +  + RIL   ++DKQ +L VGDVILEVN  PV  PDEL   + + K  +T KI       +KS +  +S          +LE       YMRALF Y+PS+D LLP   IG+ FK+GDI +++N  D N+WQA  + +  ++  LIPSQ L+ER    +A + +        +  +++ K K+  ++R+    +   +A+L  YEEV + PP R   ++LIG +G+G++ +K+ L+  + ++F   I  TS  K+    N +   F  +DR  M    + + ++   E +G LYG    SI+++IN G+  +LDC    +  L  +    P+VI +AAP +    TI    +  G  +NL     S  +L   + +S   ++ Y+   ++ IVNED ++T   +   L    +   W+P +W
Sbjct:   93 DIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLKAA-GGSTSQLEIASQRQT--GGYLF-------------TEDVL--NTKMPVET---------------IKMVGLRRDPSKPLGLTV-------ELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADY--VHKIGICGTRISKRKRKTMYRSVANCE-FDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWF--MDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATGSNRNL-----SDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNW 609          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0112873)

HSP 1 Score: 209.92 bits (533), Expect = 4.010e-58
Identity = 139/440 (31.59%), Postives = 233/440 (52.95%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPD--ELLFLLGKCKGTITFKILKSPKRPISNSVNLEKV-------YMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQN-NLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPS----RVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++  QK  ++ +GIT+    ++ DG    RC + RI+   ++ +Q  L VGD I E+N +PV++    +L  +L + +G++TFKI+ S  R       L ++       ++RA FDY+P  D+L+P  Q G++F+ GDI ++++++D ++WQA  LD+    A LIPS  LQE  IA Q  +   +   N      KK +  + + AK  A I    D+ TYEEVVK P      +   ++L+G  G+G++ IK+ L+ K P+++++PI  T+   K   +    +  V  + MM D  A+ Y+        +YG K  +IR +  +GK  +LD + + +  L+T  F PYV+ IAAPSL            +N+     S   L+ +  +SE   Q+Y H  +LTIVN DI++T   + + +        W+P SW +
Sbjct:   55 RLVQFQKNTDEPMGITL---KMTEDG----RCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPS-YRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQAR-LDTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNA-IFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSL------------QNIADYDGS---LERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 469          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: vari (gene:FBgn0250785 transcript:FBtr0089945)

HSP 1 Score: 211.846 bits (538), Expect = 1.917e-57
Identity = 159/568 (27.99%), Postives = 277/568 (48.77%), Query Frame = 3
Query: 3354 NIIRRNSKKNR-DAGKLYHILKKIHFKTLFNCMKELNN--EEHIPISYNGSLEEIEIDVKNQDYHDGYXXXXXXXXXXXXXXGTEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK----NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLK-TPLFNPYVILIAAPSL----TILEAMQKEGLQKNLTKNKRST--------------------SELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            +IIR+ S   R ++ +L  +L + HF+ L     E+    E+ +  +  GS  ++EI  + Q    GY               TED+   N+ +P                   +++ ++++P++ LG+TV       +     +  + RIL   ++DKQ +L VGDVILEVN  PV  PDEL   + + K  +T KI  +    I +       YMRALF Y+PS+D LLP   IG+ FK+GDI +++N  D N+WQA  + +  ++  LIPSQ L+ER    +A + +        +  +++ K K+  ++R+    +   +A+L  YEEV + PP R   ++LIG +G+G++ +K+ L+  + ++F   I  TS  K+    N +   F  +DR  M    + + ++   E +G LYG    SI+++IN G+  +LDC    +  L  +    P+VI +AAP +    TI    +  G  +NL+ +++S+                     +L   + +S   ++ Y+   ++ IVNED ++T   +   L    +   W+P +W
Sbjct:   93 DIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLKAA-GGSTSQLEIASQRQT--GGYLF-------------TEDVL--NTKMPVET---------------IKMVGLRRDPSKPLGLTV-------ELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRY--TCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADY--VHKIGICGTRISKRKRKTMYRSVANCE-FDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWF--MDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNW 613          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: vari (gene:FBgn0250785 transcript:FBtr0335501)

HSP 1 Score: 207.223 bits (526), Expect = 3.201e-57
Identity = 137/471 (29.09%), Postives = 240/471 (50.96%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKI-------LKSPKRPISNS-------VNLEK-----VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLK-TPLFNPYVILIAAPSL----TILEAMQKEGLQKNLTKNKRST--------------------SELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            +++ ++++P++ LG+TV       +     +  + RIL   ++DKQ +L VGDVILEVN  PV  PDEL   + + K  +T KI       +KS +  +S          +LE       YMRALF Y+PS+D LLP   IG+ FK+GDI +++N  D N+WQA  + +  ++  LIPSQ L+ER    +A + +        +  +++ K K+  ++R+    +   +A+L  YEEV + PP R   ++LIG +G+G++ +K+ L+  + ++F   I  TS  K+   +    +  +DR  M    + + ++   E +G LYG    SI+++IN G+  +LDC    +  L  +    P+VI +AAP +    TI    +  G  +NL+ +++S+                     +L   + +S   ++ Y+   ++ IVNED ++T   +   L    +   W+P +W
Sbjct:    7 KMVGLRRDPSKPLGLTV-------ELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADY--VHKIGICGTRISKRKRKTMYRSVANCE-FDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNW 467          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Match: vari (gene:FBgn0250785 transcript:FBtr0089946)

HSP 1 Score: 207.223 bits (526), Expect = 3.201e-57
Identity = 137/471 (29.09%), Postives = 240/471 (50.96%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKI-------LKSPKRPISNS-------VNLEK-----VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLK-TPLFNPYVILIAAPSL----TILEAMQKEGLQKNLTKNKRST--------------------SELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            +++ ++++P++ LG+TV       +     +  + RIL   ++DKQ +L VGDVILEVN  PV  PDEL   + + K  +T KI       +KS +  +S          +LE       YMRALF Y+PS+D LLP   IG+ FK+GDI +++N  D N+WQA  + +  ++  LIPSQ L+ER    +A + +        +  +++ K K+  ++R+    +   +A+L  YEEV + PP R   ++LIG +G+G++ +K+ L+  + ++F   I  TS  K+   +    +  +DR  M    + + ++   E +G LYG    SI+++IN G+  +LDC    +  L  +    P+VI +AAP +    TI    +  G  +NL+ +++S+                     +L   + +S   ++ Y+   ++ IVNED ++T   +   L    +   W+P +W
Sbjct:    7 KMVGLRRDPSKPLGLTV-------ELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADY--VHKIGICGTRISKRKRKTMYRSVANCE-FDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNW 467          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: mpp6b (membrane protein, palmitoylated 6b (MAGUK p55 subfamily member 6) [Source:ZFIN;Acc:ZDB-GENE-040426-775])

HSP 1 Score: 238.424 bits (607), Expect = 4.857e-67
Identity = 153/437 (35.01%), Postives = 227/437 (51.95%), Query Frame = 3
Query: 3657 NNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            NN        ++I I+K+  + LG+T        D   L    I RIL   ++D+QGLL VGD+I EVN K V  NP EL  +L +C G IT KIL S +    ++    +VY++  FDY+P+ D L+P  + G+AFK GDI +++NR D N+WQA  L   E    LIPSQ L+E+  A        +         KK KK     AK+A       +L  YEEV + PP +   ++LIG  G+G++++K+ LV   P RF   +  TS   +N  R    +  V R  M  D K   Y+   E  G LYG K  SI E++N G+T +LD   + +  LKTP F PYV+ IAAP    L+ M K  +   LT  + +  +L++ + +S    + Y+H  +L IVN++++     + S + +      W+P SW +
Sbjct:  119 NNALMQADAVRMIGIRKKAGEPLGVTF-----RMDKGDL---VIARILHGGLIDRQGLLHVGDIIKEVNGKDVGTNPTELQEMLKECSGGITLKILPSYR----DAPAPPQVYVKPHFDYNPASDNLIPCREAGLAFKRGDILQIVNREDPNWWQACHL--AEGGTGLIPSQFLEEKRKAFVPRDLDGAGILCGTMTGKKKKKMMYLTAKNAE--FDRHELQIYEEVARMPPFQRKTLILIGAQGVGRRSLKNRLVVLHPTRFGTTVPHTSRRPRNDERDGQSYRFVTRLEMETDIKLGRYLEHGEYDGNLYGTKIDSIHEVVNTGRTCILDVNPQALKLLKTPEFMPYVVFIAAPEFDTLKDMHKAVVDAGLTTKQLADVDLKKTVDESARILRAYRHYFDLIIVNDNLDCAFEKLQSSVEELCTEPQWVPVSWVY 539          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: mpp6b (membrane protein, palmitoylated 6b (MAGUK p55 subfamily member 6) [Source:ZFIN;Acc:ZDB-GENE-040426-775])

HSP 1 Score: 238.424 bits (607), Expect = 4.857e-67
Identity = 153/437 (35.01%), Postives = 227/437 (51.95%), Query Frame = 3
Query: 3657 NNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            NN        ++I I+K+  + LG+T        D   L    I RIL   ++D+QGLL VGD+I EVN K V  NP EL  +L +C G IT KIL S +    ++    +VY++  FDY+P+ D L+P  + G+AFK GDI +++NR D N+WQA  L   E    LIPSQ L+E+  A        +         KK KK     AK+A       +L  YEEV + PP +   ++LIG  G+G++++K+ LV   P RF   +  TS   +N  R    +  V R  M  D K   Y+   E  G LYG K  SI E++N G+T +LD   + +  LKTP F PYV+ IAAP    L+ M K  +   LT  + +  +L++ + +S    + Y+H  +L IVN++++     + S + +      W+P SW +
Sbjct:  119 NNALMQADAVRMIGIRKKAGEPLGVTF-----RMDKGDL---VIARILHGGLIDRQGLLHVGDIIKEVNGKDVGTNPTELQEMLKECSGGITLKILPSYR----DAPAPPQVYVKPHFDYNPASDNLIPCREAGLAFKRGDILQIVNREDPNWWQACHL--AEGGTGLIPSQFLEEKRKAFVPRDLDGAGILCGTMTGKKKKKMMYLTAKNAE--FDRHELQIYEEVARMPPFQRKTLILIGAQGVGRRSLKNRLVVLHPTRFGTTVPHTSRRPRNDERDGQSYRFVTRLEMETDIKLGRYLEHGEYDGNLYGTKIDSIHEVVNTGRTCILDVNPQALKLLKTPEFMPYVVFIAAPEFDTLKDMHKAVVDAGLTTKQLADVDLKKTVDESARILRAYRHYFDLIIVNDNLDCAFEKLQSSVEELCTEPQWVPVSWVY 539          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: mpp2a (membrane protein, palmitoylated 2a (MAGUK p55 subfamily member 2) [Source:ZFIN;Acc:ZDB-GENE-071004-82])

HSP 1 Score: 228.409 bits (581), Expect = 3.307e-65
Identity = 134/395 (33.92%), Postives = 220/395 (55.70%), Query Frame = 3
Query: 3786 IERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK--NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            I RIL   ++D+QGLL VGD+I EVN + V ++P  L  +L +  G I  KIL S + P        +V+++   DYDP+ D L+P ++ G+ F +GDI +++N+ D+N+WQA  ++     A LIPSQ L+E+  A ++ ++      NL    + K KK  ++     AD     +L  YEEV K PP R   ++LIG  G+G++++K+ L+  +P  +   I  TS   K  +R   ++    R+ M  D KA  Y+   E  G LYGIK  SI E++  G+  +LD   + +  L+T  F PYV+ I AP   +L+AM + G++  +   +++ +EL++ I +S   +++Y H  +LTIVN+D+ +  + + S L   +    W+P  W F
Sbjct:   14 IARILHGGMIDQQGLLHVGDIIKEVNGREVGDDPRVLQEVLQETSGNIVLKILPSYQEPHPP----RQVFVKCHCDYDPANDNLIPCKEAGLMFSSGDILQIVNQEDVNWWQARHVEG--GSAGLIPSQLLEEKRKAFVKRDVELSPAANLCSGMVGKKKKKMMYLTTKNADF-DRHELLIYEEVAKVPPFRRKTLILIGAPGVGRRSLKNKLLVSDPQHYGVTIPYTSRKAKSADRENMMYAFTSRSKMEADIKAGRYLEHGEYDGNLYGIKIDSIHEVVEAGRICILDVNPQTLKVLRTSEFLPYVVFIKAPEFEVLKAMNRSGIEAGVATKRKTDAELKKTIEESAKIQRVYGHYFDLTIVNDDLEEAYSTLKSSLEKLKGVQQWVPVGWVF 401          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: mpp2a (membrane protein, palmitoylated 2a (MAGUK p55 subfamily member 2) [Source:ZFIN;Acc:ZDB-GENE-071004-82])

HSP 1 Score: 232.646 bits (592), Expect = 6.057e-65
Identity = 140/429 (32.63%), Postives = 233/429 (54.31%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK--NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +++ I+K P ++LG+T                 I RIL   ++D+QGLL VGD+I EVN + V ++P  L  +L +  G I  KIL S + P        +V+++   DYDP+ D L+P ++ G+ F +GDI +++N+ D+N+WQA  ++     A LIPSQ L+E+  A ++ ++      NL    + K KK  ++     AD     +L  YEEV K PP R   ++LIG  G+G++++K+ L+  +P  +   I  TS   K  +R   ++    R+ M  D KA  Y+   E  G LYGIK  SI E++  G+  +LD   + +  L+T  F PYV+ I AP   +L+AM + G++  +   +++ +EL++ I +S   +++Y H  +LTIVN+D+ +  + + S L   +    W+P  W F
Sbjct:  134 IRMVGIRKVPGEHLGVTFRIEN--------GELVIARILHGGMIDQQGLLHVGDIIKEVNGREVGDDPRVLQEVLQETSGNIVLKILPSYQEPHPP----RQVFVKCHCDYDPANDNLIPCKEAGLMFSSGDILQIVNQEDVNWWQARHVEG--GSAGLIPSQLLEEKRKAFVKRDVELSPAANLCSGMVGKKKKKMMYLTTKNADF-DRHELLIYEEVAKVPPFRRKTLILIGAPGVGRRSLKNKLLVSDPQHYGVTIPYTSRKAKSADRENMMYAFTSRSKMEADIKAGRYLEHGEYDGNLYGIKIDSIHEVVEAGRICILDVNPQTLKVLRTSEFLPYVVFIKAPEFEVLKAMNRSGIEAGVATKRKTDAELKKTIEESAKIQRVYGHYFDLTIVNDDLEEAYSTLKSSLEKLKGVQQWVPVGWVF 547          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Match: mpp6a (membrane protein, palmitoylated 6a (MAGUK p55 subfamily member 6) [Source:ZFIN;Acc:ZDB-GENE-050506-35])

HSP 1 Score: 223.016 bits (567), Expect = 7.643e-62
Identity = 140/428 (32.71%), Postives = 228/428 (53.27%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            ++ISIQK+  + LG+T                 I R+L  S++D+QG+L  GDVI EVN + V ++P  L  +L  C G+IT KIL S K    ++    +VY++  F+Y+P+ D L+P  + G+AF  GDI  ++N+ D N+WQA  ++       LIPSQ L+E+  A ++ +L          +  KK KK     AK+A       +L  YEEV K PP +   ++LIG  G+G++++K+ L+   P R+   +  TS   ++  +    +  V R  M  D KAS Y+   E  G LYG K  SI E++  G+T +LD   + +  LKT  F P+V+ IAAP L  L AM K  +   +T    + ++L++ + +S   ++ Y H  +LTIVN+++++    + + +        W+P +W +
Sbjct:  128 RMISIQKKAGEPLGVTFRVEEGDL--------VIARVLHGSMIDRQGMLHAGDVIREVNGREVGKDPMALQHMLRDCNGSITLKILPSYK----DTPPPAQVYLKPHFNYNPNTDNLIPCREAGLAFSKGDILHIVNKEDPNWWQACNING--GHTGLIPSQFLEEKRKAFVRRDLDGSGILCGTLTGKKKKKKMMYLTAKNAE--FDRHELQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRLIVLNPLRYGTTVPFTSRRPRDDEKDGQSYCFVSREEMEMDIKASRYLEHGEYDGNLYGTKMDSIHEVVRAGRTCILDVNPQALKVLKTSEFMPFVVFIAAPELDTLRAMHKAVVDAGITTKLLTETDLKKTVDESARIKRAYNHYFDLTIVNDNLDKAFEKLQAAVEQLTTQPQWVPVNWVY 539          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: atf5.2 (activating transcription factor 5, gene 2 [Source:Xenbase;Acc:XB-GENE-5902427])

HSP 1 Score: 230.72 bits (587), Expect = 2.285e-64
Identity = 144/430 (33.49%), Postives = 226/430 (52.56%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN + V  +P  L  +L +  G++  KIL S          L +V+++  F YDPS D L+P ++ G+ FKAGD+ +++N+ D N+WQA  +      A LIPSQ L+E+    +       P S+        KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   I  TS  +K        ++ V R  M  D KA  Y+   E  G LYG K SSI+E++  GK  VLD   + V  L+T  F PYV+ + AP    L++     ++  +T  + + +EL  I+ +SE  +Q Y H  +LT+VN D++QT   +   L    +   W+P SW +
Sbjct:  121 RMVGIRKSAGEHLGVTF-----RVEGGEL---VIARILHGGVIDQQGLLHVGDVIREVNGREVGSDPQALQEMLREASGSVVLKILPS----YQEQHPLRQVFVKCHFSYDPSSDSLIPCKEAGLPFKAGDLLQIVNQEDPNWWQACLVKG--GTAGLIPSQLLEEKRKAFVKRDGEFTPNSSALCGSIGGKKKKRIMYVTTKNAE--FDRHELLIYEEVARMPPFRRKTLILIGAQGVGRRSLKNKLLTSDPSRYGTTIPYTSRKRKEGEWDGQSYSFVTRAEMEQDIKAGRYLEHGEYEGNLYGTKISSIQEVVASGKMCVLDVNPQAVKVLRTAEFVPYVVFVGAPDFQTLKSNNLSAVEVGITNKQLTDAELLRIVEESERLQQAYGHYFDLTLVNYDLDQTFQELQVALEKLNSEPQWVPVSWVY 534          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: atf5.2 (activating transcription factor 5, gene 2 [Source:Xenbase;Acc:XB-GENE-5902427])

HSP 1 Score: 231.491 bits (589), Expect = 2.635e-64
Identity = 144/430 (33.49%), Postives = 226/430 (52.56%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN + V  +P  L  +L +  G++  KIL S          L +V+++  F YDPS D L+P ++ G+ FKAGD+ +++N+ D N+WQA  +      A LIPSQ L+E+    +       P S+        KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   I  TS  +K        ++ V R  M  D KA  Y+   E  G LYG K SSI+E++  GK  VLD   + V  L+T  F PYV+ + AP    L++     ++  +T  + + +EL  I+ +SE  +Q Y H  +LT+VN D++QT   +   L    +   W+P SW +
Sbjct:  146 RMVGIRKSAGEHLGVTF-----RVEGGEL---VIARILHGGVIDQQGLLHVGDVIREVNGREVGSDPQALQEMLREASGSVVLKILPS----YQEQHPLRQVFVKCHFSYDPSSDSLIPCKEAGLPFKAGDLLQIVNQEDPNWWQACLVKG--GTAGLIPSQLLEEKRKAFVKRDGEFTPNSSALCGSIGGKKKKRIMYVTTKNAE--FDRHELLIYEEVARMPPFRRKTLILIGAQGVGRRSLKNKLLTSDPSRYGTTIPYTSRKRKEGEWDGQSYSFVTRAEMEQDIKAGRYLEHGEYEGNLYGTKISSIQEVVASGKMCVLDVNPQAVKVLRTAEFVPYVVFVGAPDFQTLKSNNLSAVEVGITNKQLTDAELLRIVEESERLQQAYGHYFDLTLVNYDLDQTFQELQVALEKLNSEPQWVPVSWVY 559          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: atf5.2 (activating transcription factor 5, gene 2 [Source:Xenbase;Acc:XB-GENE-5902427])

HSP 1 Score: 230.72 bits (587), Expect = 3.038e-64
Identity = 144/430 (33.49%), Postives = 226/430 (52.56%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN + V  +P  L  +L +  G++  KIL S          L +V+++  F YDPS D L+P ++ G+ FKAGD+ +++N+ D N+WQA  +      A LIPSQ L+E+    +       P S+        KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   I  TS  +K        ++ V R  M  D KA  Y+   E  G LYG K SSI+E++  GK  VLD   + V  L+T  F PYV+ + AP    L++     ++  +T  + + +EL  I+ +SE  +Q Y H  +LT+VN D++QT   +   L    +   W+P SW +
Sbjct:  132 RMVGIRKSAGEHLGVTF-----RVEGGEL---VIARILHGGVIDQQGLLHVGDVIREVNGREVGSDPQALQEMLREASGSVVLKILPS----YQEQHPLRQVFVKCHFSYDPSSDSLIPCKEAGLPFKAGDLLQIVNQEDPNWWQACLVKG--GTAGLIPSQLLEEKRKAFVKRDGEFTPNSSALCGSIGGKKKKRIMYVTTKNAE--FDRHELLIYEEVARMPPFRRKTLILIGAQGVGRRSLKNKLLTSDPSRYGTTIPYTSRKRKEGEWDGQSYSFVTRAEMEQDIKAGRYLEHGEYEGNLYGTKISSIQEVVASGKMCVLDVNPQAVKVLRTAEFVPYVVFVGAPDFQTLKSNNLSAVEVGITNKQLTDAELLRIVEESERLQQAYGHYFDLTLVNYDLDQTFQELQVALEKLNSEPQWVPVSWVY 545          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: atf5.2 (activating transcription factor 5, gene 2 [Source:Xenbase;Acc:XB-GENE-5902427])

HSP 1 Score: 230.72 bits (587), Expect = 3.314e-64
Identity = 144/430 (33.49%), Postives = 226/430 (52.56%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN + V  +P  L  +L +  G++  KIL S          L +V+++  F YDPS D L+P ++ G+ FKAGD+ +++N+ D N+WQA  +      A LIPSQ L+E+    +       P S+        KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   I  TS  +K        ++ V R  M  D KA  Y+   E  G LYG K SSI+E++  GK  VLD   + V  L+T  F PYV+ + AP    L++     ++  +T  + + +EL  I+ +SE  +Q Y H  +LT+VN D++QT   +   L    +   W+P SW +
Sbjct:  128 RMVGIRKSAGEHLGVTF-----RVEGGEL---VIARILHGGVIDQQGLLHVGDVIREVNGREVGSDPQALQEMLREASGSVVLKILPS----YQEQHPLRQVFVKCHFSYDPSSDSLIPCKEAGLPFKAGDLLQIVNQEDPNWWQACLVKG--GTAGLIPSQLLEEKRKAFVKRDGEFTPNSSALCGSIGGKKKKRIMYVTTKNAE--FDRHELLIYEEVARMPPFRRKTLILIGAQGVGRRSLKNKLLTSDPSRYGTTIPYTSRKRKEGEWDGQSYSFVTRAEMEQDIKAGRYLEHGEYEGNLYGTKISSIQEVVASGKMCVLDVNPQAVKVLRTAEFVPYVVFVGAPDFQTLKSNNLSAVEVGITNKQLTDAELLRIVEESERLQQAYGHYFDLTLVNYDLDQTFQELQVALEKLNSEPQWVPVSWVY 541          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Match: atf5.2 (activating transcription factor 5, gene 2 [Source:Xenbase;Acc:XB-GENE-5902427])

HSP 1 Score: 230.335 bits (586), Expect = 4.406e-64
Identity = 144/430 (33.49%), Postives = 226/430 (52.56%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN + V  +P  L  +L +  G++  KIL S          L +V+++  F YDPS D L+P ++ G+ FKAGD+ +++N+ D N+WQA  +      A LIPSQ L+E+    +       P S+        KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   I  TS  +K        ++ V R  M  D KA  Y+   E  G LYG K SSI+E++  GK  VLD   + V  L+T  F PYV+ + AP    L++     ++  +T  + + +EL  I+ +SE  +Q Y H  +LT+VN D++QT   +   L    +   W+P SW +
Sbjct:  135 RMVGIRKSAGEHLGVTF-----RVEGGEL---VIARILHGGVIDQQGLLHVGDVIREVNGREVGSDPQALQEMLREASGSVVLKILPS----YQEQHPLRQVFVKCHFSYDPSSDSLIPCKEAGLPFKAGDLLQIVNQEDPNWWQACLVKG--GTAGLIPSQLLEEKRKAFVKRDGEFTPNSSALCGSIGGKKKKRIMYVTTKNAE--FDRHELLIYEEVARMPPFRRKTLILIGAQGVGRRSLKNKLLTSDPSRYGTTIPYTSRKRKEGEWDGQSYSFVTRAEMEQDIKAGRYLEHGEYEGNLYGTKISSIQEVVASGKMCVLDVNPQAVKVLRTAEFVPYVVFVGAPDFQTLKSNNLSAVEVGITNKQLTDAELLRIVEESERLQQAYGHYFDLTLVNYDLDQTFQELQVALEKLNSEPQWVPVSWVY 548          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Mpp2 (membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) [Source:MGI Symbol;Acc:MGI:1858257])

HSP 1 Score: 226.483 bits (576), Expect = 8.567e-63
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEK-VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L + V+++  FDYDP++D L P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L++VN ++ +T   + + +        W+P SW +
Sbjct:  139 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 552          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Mpp2 (membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) [Source:MGI Symbol;Acc:MGI:1858257])

HSP 1 Score: 226.483 bits (576), Expect = 1.286e-62
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEK-VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L + V+++  FDYDP++D L P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L++VN ++ +T   + + +        W+P SW +
Sbjct:  156 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 569          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Mpp6 (membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) [Source:MGI Symbol;Acc:MGI:1927340])

HSP 1 Score: 216.083 bits (549), Expect = 2.061e-59
Identity = 137/428 (32.01%), Postives = 219/428 (51.17%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +I+ I K+  + LG+T             N   I RIL   ++D+QGLL VGD+I EVN   V  NP EL  LL    G++T KIL S +    +++  ++V+++  FDY+P  D L+P ++ G+ F  G+I +++NR D N+WQA  +      A LIPSQ L+E+  A        S         KK KK      ++A       ++  YEEV K PP +   ++LIG  G+G++++K+  +   P RF   +  TS   +   +    +  V R+ M  D KA  Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F PYV+ IAAP L  L AM K  +   +T    + S+L++ + +S   ++ Y H  +L IVN+++++    + + +        W+P SW +
Sbjct:  127 IRILGIHKKAGEPLGVTFRVEN--------NDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYR----DTITPQQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEG-GSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAE--FDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY 539          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Mpp6 (membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) [Source:MGI Symbol;Acc:MGI:1927340])

HSP 1 Score: 216.083 bits (549), Expect = 2.061e-59
Identity = 137/428 (32.01%), Postives = 219/428 (51.17%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +I+ I K+  + LG+T             N   I RIL   ++D+QGLL VGD+I EVN   V  NP EL  LL    G++T KIL S +    +++  ++V+++  FDY+P  D L+P ++ G+ F  G+I +++NR D N+WQA  +      A LIPSQ L+E+  A        S         KK KK      ++A       ++  YEEV K PP +   ++LIG  G+G++++K+  +   P RF   +  TS   +   +    +  V R+ M  D KA  Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F PYV+ IAAP L  L AM K  +   +T    + S+L++ + +S   ++ Y H  +L IVN+++++    + + +        W+P SW +
Sbjct:  127 IRILGIHKKAGEPLGVTFRVEN--------NDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYR----DTITPQQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEG-GSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAE--FDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY 539          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Match: Mpp6 (membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) [Source:MGI Symbol;Acc:MGI:1927340])

HSP 1 Score: 216.468 bits (550), Expect = 2.431e-59
Identity = 141/438 (32.19%), Postives = 221/438 (50.46%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPK---RPISNSVNLEK-------VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +I+ I K+  + LG+T             N   I RIL   ++D+QGLL VGD+I EVN   V  NP EL  LL    G++T KIL S +    P  + VN+E+       V+++  FDY+P  D L+P ++ G+ F  G+I +++NR D N+WQA  +      A LIPSQ L+E+  A        S         KK KK      ++A       ++  YEEV K PP +   ++LIG  G+G++++K+  +   P RF   +  TS   +   +    +  V R+ M  D KA  Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F PYV+ IAAP L  L AM K  +   +T    + S+L++ + +S   ++ Y H  +L IVN+++++    + + +        W+P SW +
Sbjct:  127 IRILGIHKKAGEPLGVTFRVEN--------NDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSYVNMERHPAHVRQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEG-GSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAE--FDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY 553          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|D3ZAA9|MPP2_RAT (MAGUK p55 subfamily member 2 OS=Rattus norvegicus OX=10116 GN=Mpp2 PE=1 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 1.554e-62
Identity = 138/431 (32.02%), Postives = 229/431 (53.13%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEK-VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L + V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L++VN ++ +T   + + +        W+P SW +
Sbjct:  139 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 552          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q14168|MPP2_HUMAN (MAGUK p55 subfamily member 2 OS=Homo sapiens OX=9606 GN=MPP2 PE=1 SV=3)

HSP 1 Score: 227.639 bits (579), Expect = 4.284e-62
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEK-VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L + V+++  FDYDP++D L+P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L +VN ++ +T   + + +        W+P SW +
Sbjct:  163 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 576          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q9WV34|MPP2_MOUSE (MAGUK p55 subfamily member 2 OS=Mus musculus OX=10090 GN=Mpp2 PE=1 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 5.993e-62
Identity = 138/431 (32.02%), Postives = 228/431 (52.90%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEK-VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   +V +QGLL VGD+I EVN +PV  +P  L  LL    G++  KIL S + P     +L + V+++  FDYDP++D L P ++ G+ F AGD+ +++N++D N+WQA  ++     A LIPSQ L+E+    +     L P S         KK K+      K+A       +L  YEEV + PP R   ++LIG  G+G++++K+ L+  +P+R+   +  TS   K+  R    ++ V R  M  D +A  Y+   E  G LYG +  SIR ++  GK  VLD   + V  L+T  F PYV+ I AP    L AM +  L+  ++  + + ++L+  + +S   ++ Y H  +L++VN ++ +T   + + +        W+P SW +
Sbjct:  139 RMVGIRKTAGEHLGVTF-----RVEGGEL---VIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP-----HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEG--GSAGLIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAE--FDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY 552          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q9JLB0|MPP6_MOUSE (MAGUK p55 subfamily member 6 OS=Mus musculus OX=10090 GN=Mpp6 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.700e-58
Identity = 141/438 (32.19%), Postives = 221/438 (50.46%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPK---RPISNSVNLEK-------VYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +I+ I K+  + LG+T             N   I RIL   ++D+QGLL VGD+I EVN   V  NP EL  LL    G++T KIL S +    P  + VN+E+       V+++  FDY+P  D L+P ++ G+ F  G+I +++NR D N+WQA  +      A LIPSQ L+E+  A        S         KK KK      ++A       ++  YEEV K PP +   ++LIG  G+G++++K+  +   P RF   +  TS   +   +    +  V R+ M  D KA  Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F PYV+ IAAP L  L AM K  +   +T    + S+L++ + +S   ++ Y H  +L IVN+++++    + + +        W+P SW +
Sbjct:  127 IRILGIHKKAGEPLGVTFRVEN--------NDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSYVNMERHPAHVRQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEG-GSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAE--FDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY 553          
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Match: sp|Q9NZW5|MPP6_HUMAN (MAGUK p55 subfamily member 6 OS=Homo sapiens OX=9606 GN=MPP6 PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 1.848e-58
Identity = 139/439 (31.66%), Postives = 222/439 (50.57%), Query Frame = 3
Query: 3651 SDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            S NN+       +I+ I K   + LG+T             N   I RIL   ++D+QGLL VGD+I EVN   V  NP EL  LL    G++T KIL S +    +++  ++V+++  FDY+P  D L+P ++ G+ F  G+I +++NR D N+WQA  +      A LIPSQ L+E+  A        S         KK KK      ++A       ++  YEEV K PP +   ++LIG  G+G++++K+  +   P RF   +  TS   +   +    +  V R+ M  D KA  Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F PYV+ IAAP L  L AM K  +   +T    + S+L++ + +S   ++ Y H  +L I+N+++++    + + +        W+P SW +
Sbjct:  117 SINNQLLPVDAIRILGIHKRAGEPLGVTFRVEN--------NDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYR----DTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEG-GSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAE--FDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY 540          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A3R7GR54 (MAGUK p55 subfamily member 2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Mpp2 PE=4 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 8.826e-83
Identity = 158/445 (35.51%), Postives = 257/445 (57.75%), Query Frame = 3
Query: 3711 PNQNLGITVV--------------KSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLE------------KVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIA 4967
            P +++GITV               ++  S DGKPL   +I+R+L  S+ D+ G +  GD++LE N  PV + DE+  L+ +    +  ++L   + P SN   L             K Y+R  FDYD +KD LLP+  +G++FKAGD+ E+++  D N+WQ  PL+ +  Q  L+PSQ+L+ER  A      P       +  +K       FRA D++ +   +D+ +YEEVV +P S VPC+LL+G TG+G++ +K LL   EP RF++P+ DT++   + +Q  F+ + +  M  D ++  YV   +  G  YGI+FS+IR++I  G+T VLDCQ + V+ L  P FNP  I IAAP+  + + M K+GL+  +TKN RS  EL+ +I +S+ + + ++HL   ++ N D+ ++   +S ++S  E + SWIP+ W +E++
Sbjct:  441 PGESIGITVAVRTPSPPPSPTTQFRTAKSADGKPL--LAIQRVLAGSLADRNGSIFPGDILLEFNGYPVHSLDEIYTLMQQTSSALECELLV--QTPESNGSLLRPGLQHKQNSTGTKRYIRTFFDYDSTKDSLLPTGDVGLSFKAGDVLELVDDQDPNWWQVRPLNDSHGQVRLVPSQTLEERRTAFNQEKIPGGTLKKTRRTIKM-----FFRAADSSGLRLRSDIWSYEEVVPWPQSMVPCLLLLGVTGVGRRNLKVLLASSEPKRFAYPLSDTTDPTASTSQ--FHILPKAQMEADVRSGAYVEWGKVGGNYYGIRFSAIRKIIASGRTAVLDCQPQTVHLLHQPEFNPCTIFIAAPTFEVAKRMMKDGLENGVTKNNRSDEELRCLIEESQTFARAHRHLYFHSLTNSDMRESVARLSRLISRLERHPSWIPSGWAYELS 874          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: G7YIH1 (MAGUK p55 subfamily member 2 OS=Clonorchis sinensis OX=79923 GN=CLF_108766 PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 6.385e-82
Identity = 158/445 (35.51%), Postives = 257/445 (57.75%), Query Frame = 3
Query: 3711 PNQNLGITVV--------------KSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLE------------KVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIA 4967
            P +++GITV               ++  S DGKPL   +I+R+L  S+ D+ G +  GD++LE N  PV + DE+  L+ +    +  ++L   + P SN   L             K Y+R  FDYD +KD LLP+  +G++FKAGD+ E+++  D N+WQ  PL+ +  Q  L+PSQ+L+ER  A      P       +  +K       FRA D++ +   +D+ +YEEVV +P S VPC+LL+G TG+G++ +K LL   EP RF++P+ DT++   + +Q  F+ + +  M  D ++  YV   +  G  YGI+FS+IR++I  G+T VLDCQ + V+ L  P FNP  I IAAP+  + + M K+GL+  +TKN RS  EL+ +I +S+ + + ++HL   ++ N D+ ++   +S ++S  E + SWIP+ W +E++
Sbjct:  441 PGESIGITVAVRTPSPPPSPTTQFRTAKSADGKPL--LAIQRVLAGSLADRNGSIFPGDILLEFNGYPVHSLDEIYTLMQQTSSALECELLV--QTPESNGSLLRPGLQHKQNSTGTKRYIRTFFDYDSTKDSLLPTGDVGLSFKAGDVLELVDDQDPNWWQVRPLNDSHGQVRLVPSQTLEERRTAFNQEKIPGGTLKKTRRTIKM-----FFRAADSSGLRLRSDIWSYEEVVPWPQSMVPCLLLLGVTGVGRRNLKVLLASSEPKRFAYPLSDTTDPTASTSQ--FHILPKAQMEADVRSGAYVEWGKVGGNYYGIRFSAIRKIIASGRTAVLDCQPQTVHLLHQPEFNPCTIFIAAPTFEVAKRMMKDGLENGVTKNNRSDEELRCLIEESQTFARAHRHLYFHSLTNSDMRESVARLSRLISRLERHPSWIPSGWAYELS 874          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A3Q0KVH5 (ATP-dependent RNA helicase, putative OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 5.069e-81
Identity = 174/492 (35.37%), Postives = 282/492 (57.32%), Query Frame = 3
Query: 3591 GTEDISIDNSILPTYQEIGYSDNNRFANELDF------QIISIQKE-PNQNLGITVV----------KSTVSFDGKPLNRC-----SIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKIL-KSPKRPI-------SNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAM-QNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQP--LFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIA 4967
            GT+ +  ++   P   +  ++ ++R +  L F      +++ ++++ P +NLGITV               SF+G  +        SI+R+L  S+ D+QG L  GD++LE+N   V   +++   + +    I  K+L ++PK  I       SNS +  K Y+R LFDYD +KD LLP+  +G++FK+GD+ E++N  D N+WQ   L    ++A LIPSQ+L+ER  A  Q  L+         S+    K    FRA DA+ +   +D+ +YEEVV +P S+VPC+LLIGP G+G++ +K LL + EP RF++P+ DT+++    T P  LF  + ++ M +D K+  YV   + +G  YGI+FS +R++I  G+T VLDCQ + ++ L  P FNP V+ +AAPS  + + M +EGLQ N+T N RS  EL  II  S     +Y+HL +  +VN+++ ++   +S ++S  E    WIP  W +E++
Sbjct:  446 GTQSLPRNHGQTPKELKDNHNYHHRESIHLKFPQPGVPRVVHLRRDHPGENLGITVALCTPSPTTSSSPPTSFNGITIKSVTEPIISIQRVLAGSLADRQGCLFPGDILLEINGLRVHTLEQVFSQIQQTSSLIDCKLLVQAPKEGILRSSIQCSNSNSKTKRYVRCLFDYDATKDSLLPTGDVGLSFKSGDVLELVNDQDPNWWQVRSLKEPNSKARLIPSQTLEERRQAFNQEKLQ------ANTSRKPWKKVKTFFRAADASGLRLRSDIWSYEEVVPWPQSKVPCLLLIGPNGVGRRNLKVLLAKYEPKRFAYPMTDTTDS----TLPTNLFKVLSKDQMESDVKSGAYVEWGKVNGHYYGIRFSELRKIIANGRTAVLDCQPQSLHLLHQPEFNPCVVFVAAPSFEVAKTMLQEGLQANVTSNMRSDEELHSIIKDSMSMSVIYRHLYSHILVNKNMKESVEKLSRLVSKLERQPCWIPCGWAYELS 927          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A4Z2D3L9 (MAGUK p55 subfamily member 6 isoform 1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_004909 PE=4 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 5.304e-79
Identity = 169/470 (35.96%), Postives = 268/470 (57.02%), Query Frame = 3
Query: 3708 EPNQNLGITVV---------KSTVSFDGKPLNRC-----SIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKIL-KSPKRPISNSVNLE-------KVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAM-QNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIA-PLAINKSTNNKNIPKQNDRSTINSVG 5045
             P +NLGITV            T SF+G  +        SI+R+L  S+ D+QG L  GD++LE+N   V   +++   + +   +I  K+L ++PK  I  S  L+       K Y+R LFDYD +KD LLP+  +G++FK+GD+ E++N  D N+WQ   L    ++A LIPSQ+L+ER  A  Q  L+         ++    K    FRA DA+ +   +D+ +YEEVV +P S++PC+LLIGP G+G++ +K LL   EP RF++P+ DT+++       LF  + +  M  D K   YV   + +G  YGI+FS +R++I  G+T VLDCQ + ++ L  P FNP V+ +A+PS  + + M +EGL+ N+T N RS  EL+ II  S     +Y+HL + T+VN+++ ++   +S ++S  E    WIP  W +E++ P    +   +  IP     ST++++G
Sbjct:  481 HPGENLGITVALGTPSPVSSSPTTSFNGVTIQSVTEPVISIQRVLAGSLADRQGCLFPGDILLEINGLRVHTLEQVFSQIQQTSSSIDCKLLVQAPKEGILRSGILQHSNSSKNKRYIRCLFDYDATKDSLLPTGDVGLSFKSGDVLELVNDQDPNWWQVRSLKEPNSKARLIPSQTLEERRQAFNQEKLQ------SNTNRKPWKKVKTFFRAADASGLRLRSDIWSYEEVVPWPQSKIPCLLLIGPNGVGRRNLKVLLANHEPRRFAYPMTDTTDSSLPTN--LFKVLSKEQMEADVKFGAYVEWGKVNGHYYGIRFSELRKIIANGQTAVLDCQPQSLHLLHQPEFNPCVVFVASPSFEVAKTMLQEGLEANVTSNIRSDEELRSIIKDSMSMAVIYRHLYSHTLVNKNMKESVEKLSRLVSKLERQPCWIPCGWAYELSIPYRSARKDGSPFIPGS---STLSALG 939          
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Match: A0A0R3SGR0 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4104 PE=3 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 6.167e-79
Identity = 150/405 (37.04%), Postives = 247/405 (60.99%), Query Frame = 3
Query: 3777 RCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFK-ILKSPKRP------ISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAM-QNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIA 4967
            R  I+R+LV+S+ D+ G L  GD I+E N   V + D +  ++     + T + I+K+P R       +S +    KVY+R LF YDP KD LLP+  +G+AFK+GD+ E+++  D+N+WQ   +D+  +   L+PSQ+L+ER  A  Q   R         +  +  K   +FRA D+++++  +DL  YEEVV +PPS V  +LLIGP G+G++ +K LL  + P+RFSFPI DT++ K + +  LF    +  M +D +  +YV      G  YGI FS+IRE+IN G+T ++DCQ + V+ L  P FNP+V+ ++AP   I +AM ++G+++NLT NKR+  E++EI+ +S+ +    +HL   T+VN ++ +    ++ +++  E +  W+PA W +E++
Sbjct:  206 RIIIQRVLVDSLADRDGKLFPGDEIIEFNGVVVNSLDSVRTVMANSASSNTIQLIVKTPGRGQLKSHLLSRNRPEHKVYIRCLFKYDPVKDTLLPNTTLGVAFKSGDVLELVDAQDLNWWQVRRIDAPNSPVGLVPSQTLEERRQAFNQQAFR-------MGTGKRNKKVKSLFRAADSSNLLVRSDLWVYEEVVPWPPSTVHTLLLIGPNGVGRRTLKFLLCTQYPSRFSFPISDTTDPKASPS--LFRIRSKEDMESDIRQGIYVEWGTVDGHHYGISFSAIREIINSGRTALVDCQCQSVHLLHQPEFNPHVVFVSAPKFEIAKAMMEKGIRENLTMNKRTDEEIKEIVEESKVFAIRNQHLYTHTLVNSNMAEGVEKLARLVTRLEQHPGWMPAGWAYEMS 601          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: mpp2b (MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc:103028270])

HSP 1 Score: 223.402 bits (568), Expect = 5.683e-62
Identity = 140/428 (32.71%), Postives = 228/428 (53.27%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVEN-PDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK--NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN K V N P  L  +L +  G++  KIL S + P +      + +++  FDYDP+ D L+P ++ G+ F +GDI ++ N+ D N+WQA  L+     A LIPSQ L+E+  A ++ +L   +   L      K KK  ++     A+     +L  YEEV K PP R   ++LIG  G+G++++K+ L+  EP+R+      TS   K   +   ++  + R+ M  D K   ++   E  G LYG K +SI E+++ GK  +LD   + +  L+T  F PYV+ I AP   +L+ M +  ++  +     + SEL+  + +SE  ++ Y H  +LTIVN++++     +   L     N  W+P SW F
Sbjct:  135 RMVGIRKVSGEHLGVTF-----RVEGGEL---VIARILHGGMIDQQGLLHVGDVIKEVNGKEVGNDPKVLQDMLKEASGSVVLKILPSYQEPHTP----RQAFVKCHFDYDPAHDNLIPCKEAGLRFSSGDILQIFNQEDPNWWQACHLEG--GSAGLIPSQLLEEKRKAFVKRDLELSTAGPLCAGMGGKKKKKMMYLTTKNAEF-DRHELRIYEEVAKVPPFRRKTLVLIGAQGVGRRSLKNKLLVSEPHRYGTTTPYTSRKPKVDEKEGQMYLFMSRSEMEADIKNGRFLEHGEYDGNLYGTKINSIHEVVDSGKICILDVNPQALKVLRTSEFLPYVVFIEAPDFEVLKDMNRSAIEAGVITKNLTDSELKRTVDESERIQRAYGHYFDLTIVNDNLDGAYRSLKGALERLSTNQQWVPVSWVF 547          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: mpp2b (MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc:103028270])

HSP 1 Score: 223.787 bits (569), Expect = 7.612e-62
Identity = 140/428 (32.71%), Postives = 228/428 (53.27%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVEN-PDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK--NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T        +G  L    I RIL   ++D+QGLL VGDVI EVN K V N P  L  +L +  G++  KIL S + P +      + +++  FDYDP+ D L+P ++ G+ F +GDI ++ N+ D N+WQA  L+     A LIPSQ L+E+  A ++ +L   +   L      K KK  ++     A+     +L  YEEV K PP R   ++LIG  G+G++++K+ L+  EP+R+      TS   K   +   ++  + R+ M  D K   ++   E  G LYG K +SI E+++ GK  +LD   + +  L+T  F PYV+ I AP   +L+ M +  ++  +     + SEL+  + +SE  ++ Y H  +LTIVN++++     +   L     N  W+P SW F
Sbjct:  149 RMVGIRKVSGEHLGVTF-----RVEGGEL---VIARILHGGMIDQQGLLHVGDVIKEVNGKEVGNDPKVLQDMLKEASGSVVLKILPSYQEPHTP----RQAFVKCHFDYDPAHDNLIPCKEAGLRFSSGDILQIFNQEDPNWWQACHLEG--GSAGLIPSQLLEEKRKAFVKRDLELSTAGPLCAGMGGKKKKKMMYLTTKNAEF-DRHELRIYEEVAKVPPFRRKTLVLIGAQGVGRRSLKNKLLVSEPHRYGTTTPYTSRKPKVDEKEGQMYLFMSRSEMEADIKNGRFLEHGEYDGNLYGTKINSIHEVVDSGKICILDVNPQALKVLRTSEFLPYVVFIEAPDFEVLKDMNRSAIEAGVITKNLTDSELKRTVDESERIQRAYGHYFDLTIVNDNLDGAYRSLKGALERLSTNQQWVPVSWVF 561          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: mpp2a (MAGUK p55 subfamily member 2-like [Source:NCBI gene;Acc:107196972])

HSP 1 Score: 217.624 bits (553), Expect = 6.975e-60
Identity = 132/429 (30.77%), Postives = 226/429 (52.68%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAM--QNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T                 I RIL   ++D+QGLL VGD+I E N K V ++P  L  +L +  G++  KIL S + P        +V+++  FDYDP+ D L+P ++ G+ F  GDI +++N++D+N+WQA  ++     A LIPSQ L+E+  A   ++   P +         KK KK      ++A       +L  YEEV + PP R   ++LIG  G+G++++K+ ++  +P+ +   I  TS   K+  R   ++    R+ M  D KA  Y+   E  G LYG K  SI E++  G+  +LD   + +  L+T  F PYV+ I AP   +L+AM + G++  +   + + +EL+ I+  S   +    H  +LTIVN+++++T   + + +        W+P +W F
Sbjct:  135 RMVGIRKVAGEHLGVTFRVEN--------GELVIARILHGGMIDQQGLLHVGDIIKEANGKDVGDDPRVLQEMLQEASGSVVLKILPSYQEPQPP----RQVFVKCHFDYDPANDNLVPCKEAGLQFSTGDILQIVNQDDVNWWQARHVEG--GSAGLIPSQLLEEKRKAFVKRDVELPPAGTLCSGIGGKKKKKMMYLTTRNAE--FDRHELLIYEEVARVPPFRRKTLVLIGAQGVGRRSLKNKMLVSDPHHYGTTIPYTSRKPKSGERENMMYAFTSRSKMEADIKAGRYLEHGEYDGNLYGTKIDSIHEVVEAGRICILDVNPQALKVLRTSEFLPYVVFIEAPEFEVLKAMNRSGIEAGVVTKQLTDAELKRIVEDSGRIKSTCGHYFDLTIVNDNLDETYRSLKAGMKKLNGMQQWVPVTWVF 547          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: mpp6a (membrane palmitoylated protein 6 [Source:NCBI gene;Acc:103030373])

HSP 1 Score: 214.542 bits (545), Expect = 6.155e-59
Identity = 136/430 (31.63%), Postives = 224/430 (52.09%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVE-NPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTS----EAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            ++ISIQK+  + LG+T                 I RIL  S++D+QG+L  GDVI E+N + V  +P  L  +L    G+IT KI  S +    ++    +VY+R  F+Y+P  D L+P ++ G+AF  G+I  ++NR D N+WQA  +     +  LIPSQ L+E+  A ++ +L          +  +K KK     AK+A       +L  YEEV + PP +   ++LIG  G+G++++K+ L+   P RF   +  TS    E +K+     F  V R  M  D K   Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F P+V+ IAAP L  L AM K  +   +T    + ++L++ + +S   ++ Y H  + TIVN+++++    + + +    +   W+P +W +
Sbjct:  127 RMISIQKKAGEPLGVTFRVEN--------GDLVIARILHGSMIDRQGMLHAGDVIREMNGREVGGDPKALQQMLKDSSGSITLKIFPSYR----DTPPPAQVYLRPHFNYNPDTDNLIPCKEAGLAFSKGEILHIVNREDPNWWQACGV--VGGKTGLIPSQYLEEKRKAFVRRDLDGSGILCGTIAGKRKKKKMMYLTAKNAE--FDRHELQIYEEVARMPPFQRKTLVLIGAQGVGRRSLKNRLIVLNPLRFGTTVPFTSRRPREEEKDGQSYCF--VSRTEMETDVKGGRYLEHGEYDGNLYGTKIDSIHEVVRAGRTCILDVNPQALKVLRTSEFMPFVVFIAAPELDTLRAMHKAVVDAGITTKLLTETDLKKTVDESARIKRAYSHYFDFTIVNDNLDKAFEKLQAAVEQLSSEPQWVPVNWVY 538          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Match: mpp6a (membrane palmitoylated protein 6 [Source:NCBI gene;Acc:103030373])

HSP 1 Score: 214.542 bits (545), Expect = 7.534e-59
Identity = 136/430 (31.63%), Postives = 224/430 (52.09%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVE-NPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTS----EAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            ++ISIQK+  + LG+T                 I RIL  S++D+QG+L  GDVI E+N + V  +P  L  +L    G+IT KI  S +    ++    +VY+R  F+Y+P  D L+P ++ G+AF  G+I  ++NR D N+WQA  +     +  LIPSQ L+E+  A ++ +L          +  +K KK     AK+A       +L  YEEV + PP +   ++LIG  G+G++++K+ L+   P RF   +  TS    E +K+     F  V R  M  D K   Y+   E  G LYG K  SI E++  G+T +LD   + +  L+T  F P+V+ IAAP L  L AM K  +   +T    + ++L++ + +S   ++ Y H  + TIVN+++++    + + +    +   W+P +W +
Sbjct:  138 RMISIQKKAGEPLGVTFRVEN--------GDLVIARILHGSMIDRQGMLHAGDVIREMNGREVGGDPKALQQMLKDSSGSITLKIFPSYR----DTPPPAQVYLRPHFNYNPDTDNLIPCKEAGLAFSKGEILHIVNREDPNWWQACGV--VGGKTGLIPSQYLEEKRKAFVRRDLDGSGILCGTIAGKRKKKKMMYLTAKNAE--FDRHELQIYEEVARMPPFQRKTLVLIGAQGVGRRSLKNRLIVLNPLRFGTTVPFTSRRPREEEKDGQSYCF--VSRTEMETDVKGGRYLEHGEYDGNLYGTKIDSIHEVVRAGRTCILDVNPQALKVLRTSEFMPFVVFIAAPELDTLRAMHKAVVDAGITTKLLTETDLKKTVDESARIKRAYSHYFDFTIVNDNLDKAFEKLQAAVEQLSSEPQWVPVNWVY 549          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004699.1 (pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1 gene:ENSPMAG00000004247.1 transcript:ENSPMAT00000004699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 3.861e-58
Identity = 130/431 (30.16%), Postives = 221/431 (51.28%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITV-VKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVEN-PDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLH---TYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   Q LG+T  V+S+            I RIL   ++D+QGLL VGDVI EVN + V N P  L   L +  G++  KIL S  R    S    +V+++  FDY+P  D+L+P ++ G+ F  GDI +++++ D ++WQAL +      A LIPSQ+L+E+  A   +    +  + ++         +  +    +   +E D H    YEEV K PP +   ++LIG  G+G++++K+ L+   P+R+   +  TS   ++  +    +  V R  M  D +A  Y+   E  G LYG K  SI  ++  GK  +LD   + +  L+T  F P+V+ +AAP+L  L AM +  L    T    + ++L++ + +S   ++ Y H  +L IVN +++     + + L        W+P SW +
Sbjct:   47 RMVGIRKVEGQPLGVTFRVESS---------ELVIARILRGGMIDQQGLLHVGDVIREVNGRDVTNDPAGLQRFLREATGSVVLKILPSYTR----SSPPAQVFVKCYFDYNPEDDQLIPCKEAGLRFNRGDILQIVSQEDPDWWQALKVKDG-GSAGLIPSQTLEEKRKAYVRHEWDYTGVSGERGFCGVLGGKKKKKMMYMSTKNAEFDRHEILIYEEVAKMPPFQRKTLMLIGAQGVGRRSLKNRLLVANPSRYGMIVPFTSRPPRDDEKEGQGYYFVSRADMEADIRAGRYLESGEYEGNLYGTKIESIHGVVRTGKMCILDVNPQALKVLRTAEFMPFVVFVAAPTLETLRAMHRAALDAGATSKHLTDTDLKKTVDESVRIQRAYSHFFDLKIVNNNMDVAFAKLRAALEGLGKGPQWVPISWVY 463          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008487.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.445 bits (511), Expect = 3.727e-55
Identity = 131/431 (30.39%), Postives = 225/431 (52.20%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITV-VKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +++ I+K   + LG+T  V+S         N   I RIL   ++D+QGLL VGDVI EVN   V N      +L +  G++  KIL S   P     N   ++++  FDY+P+ D+L+P ++ G+ F  GD+ ++++++D ++WQA         A L+PSQ+L+E+    +  + N    S   L      K KK  ++ +   A+     ++  YEE+ K PP +   ++LIG  G+G++++K+ L+  EP+R+   I  TS   ++  +    ++ V R  M  D K+  Y+   E  G LYG K  S   ++  GK  +LD   + +  L+T  F PYV+ IAAPS+ IL +M K  L   LT    + ++L++ + +S   ++ Y H  +LTIVN+++++    + + L        W+P  W +
Sbjct:  132 IRMVGIRKMEGEPLGVTFRVES---------NELVIARILRGGMIDQQGLLHVGDVIREVNGCDVSNDP----VLREATGSVVLKILPSYTLP----QNPAPLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQACKAQDG-GSAGLVPSQTLEEKRKAYVRQEMNFTSASGGALCGVLGGKKKKKLMYMSTKNAEF-DRHEILIYEEMAKMPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIES-HGVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWVY 542          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008482.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008482.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.445 bits (511), Expect = 5.244e-55
Identity = 132/441 (29.93%), Postives = 229/441 (51.93%), Query Frame = 3
Query: 3684 FQIISIQKEPNQNLGITV-VKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKS---PKRPISNSVN-------LEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQER---IIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
             +++ I+K   + LG+T  V+S         N   I RIL   ++D+QGLL VGDVI EVN   V N       L +  G++  KIL S   P+ P     +        ++++++  FDY+P+ D+L+P ++ G+ F  GD+ ++++++D ++WQA         A L+PSQ+L+E+    +  + N    S   L      K KK  ++ +   A+     ++  YEE+ K PP +   ++LIG  G+G++++K+ L+  EP+R+   I  TS   ++  +    ++ V R  M  D K+  Y+   E  G LYG K  SI  ++  GK  +LD   + +  L+T  F PYV+ IAAPS+ IL +M K  L   LT    + ++L++ + +S   ++ Y H  +LTIVN+++++    + + L        W+P  W +
Sbjct:  132 IRMVGIRKMEGEPLGVTFRVES---------NELVIARILRGGMIDQQGLLHVGDVIREVNGCDVSNDP----YLREATGSVVLKILPSYTLPQNPAPVRTDRYPLHHVCQQLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQACKAQDG-GSAGLVPSQTLEEKRKAYVRQEMNFTSASGGALCGVLGGKKKKKLMYMSTKNAEF-DRHEILIYEEMAKMPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIESI-GVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWVY 556          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 177.178 bits (448), Expect = 1.024e-46
Identity = 112/411 (27.25%), Postives = 205/411 (49.88%), Query Frame = 3
Query: 3786 IERILVNSIVDKQGLLQVGDVILEVNEKPVEN--PDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXX------------XXXXXXXXIFRAKDAADIISEADLHTYEEVVKF---PPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKN--RTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTIL---EAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            + RI+     D+ GL+ VGD + EVN   V+N  P+E++ +L + +  ITFKI+  P     +     K+Y+R  FDY+P  D  +P ++ G+ F  G++ +V++++D  +WQA   + +  +A LIPS+   ER +A +    P   +   KS+              +     ++ +K +A+    +++ TYEEV+++   P  +   ++L+GP G+G   +K  L+  +P+ +S  +  T+  KK+  +    +  V R+    D   + +V   E  G LYG    +IR ++N GK  +LD     +  ++TP F P+VI +  PSL  L       K    KN  +N  +  + QE++  +   E  + +L + T+VN+++      + +     E  + W+P SW
Sbjct:  164 VARIMRGGAADRSGLINVGDELKEVNGVRVDNKEPEEVIQILAQSQSAITFKIV--PAFKDESQSKDTKIYLRTFFDYNPRGDVAIPCKEAGLPFLRGEVLQVVSQDDSMWWQAKRTEQSNMRAGLIPSKHYMERRLAARQPASPPIVQKSSKSRLSGLRRSFRLSRQSRKTSKLMYESKRSAEY-DASEVSTYEEVLQYQHQPGDKYRVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFVSRHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPPSLERLRQTRGAAKSSGDKNPARN-FTDEDFQEMLGTAARMEAQFGYLFDKTVVNDELAAAYRELRAAADSLERETMWVPLSW 570          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 87.0409 bits (214), Expect = 3.778e-19
Identity = 55/193 (28.50%), Postives = 95/193 (49.22%), Query Frame = 3
Query: 4320 TYEEVVKF--PPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPL--FNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQT 4886
            TYEE+  +  P +R   ++LIGP   G+  ++  L++ + +RF+     T+   ++       ++ V R A   D     ++   E    LYG    S+R++IN GK  VL+  T+ +  LK     PY+I +A PS   L AM  +  +      +    EL+E+I ++ + EQ Y H  +  IVN D+++ 
Sbjct:   27 TYEEMALYHQPANRKRPIVLIGPPNCGRNELRTRLMESDADRFAAATPHTTRGMRDNEVDGRDYHFVSRQAFEADIGVHKFIEHGEFEKNLYGTSIDSVRQVINSGKICVLNLHTQSLKLLKNSDLKPYIIFVAPPSQERLRAMMAKESKNPKVSARFLPEELREVIEKAREMEQGYGHYFDGIIVNADLDKA 219          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Match: GUK1 (Guanylate kinase; converts GMP to GDP; required for growth and mannose outer chain elongation of cell wall N-linked glycoproteins [Source:SGD;Acc:S000002862])

HSP 1 Score: 56.9954 bits (136), Expect = 2.527e-9
Identity = 43/178 (24.16%), Postives = 84/178 (47.19%), Query Frame = 3
Query: 4365 VLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNR--TQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKT-PLFNPYVILIAAPSLTILEA-MQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQT 4886
            +++ GP+G GK  +   L  + P+ F F +  T+   +        +N V  +   +  K + ++   + SG  YG   +S++++   GKT +LD   + V  +K  P  N   + IA PS+  L+  ++  G +   + NKR ++   E+      Y +   H  +  IVN+D+++ 
Sbjct:    5 IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELA-----YAETGAH--DKVIVNDDLDKA 175          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 243.817 bits (621), Expect = 1.108e-69
Identity = 149/458 (32.53%), Postives = 235/458 (51.31%), Query Frame = 3
Query: 3594 TEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVE-NPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNH--VDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            T D     + +PT    G    N FA     +++ + K  N++LG+T+            N+  I RI+   ++D+QGLL VGD+I EVN K +  NP EL   L K  G IT K+L S       S  L +V++RA FDYDPSKD  +P +  G+AFK G++ +++++ D N+WQA  +D +   A +IPSQ  +ER  A     +P S       K +K     ++++    D   + +L  YEEV K PP +   +++IG  G+G++ +K+ L+  +  RF   I  TS   +   Q    +  V R  M  D +A  Y+   E  G +YG K  +IRE++  GK  V+D     +  LKTP F PY++ IA+PS   L+  Q + L + +   KRS  EL++ +  SE     Y H  +LTI N+++ +    + + +     +  W+P SW +
Sbjct:   72 THDAVAFKTYMPTPPSPGVDSFNGFAAGEPIRMVGLHKHANEHLGVTLKVED--------NQLIISRIIHGGMIDRQGLLHVGDIIKEVNGKDMSGNPSELQDYLAKSTGKITLKVLPS----YYESPALCQVFVRAHFDYDPSKDDQIPCQDAGLAFKQGEVLQIVDQEDANWWQAKKVDDS-RAAGIIPSQICEERRRAGVKKDKPGSKFLCGSKKKQKV----MYKSSKNFDF-EKHELPIYEEVAKMPPFQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWVPVSWVY 511          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 179.104 bits (453), Expect = 8.243e-47
Identity = 122/406 (30.05%), Postives = 207/406 (50.99%), Query Frame = 3
Query: 3786 IERILVNSIVDKQGLLQVGDVILEVNEKPVENPD--ELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPL-DSTENQAFLIPSQSLQERIIAMQ-----NNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEV-VKFP-PSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNR--TQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGL-----QKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            I RI+     +K GLL  GD ILE+N   ++     E+  LL    GT+TF +L    R I        V++RA FDYDP  D+ +P  ++G+AF+ GDI  V+++ D N+WQA    +  +  A LIPS+  Q++  +M+     +N +            +K +K  ++ A+   ++     + TY+EV +  P PSR   ++LIGP  IG+K ++  L+Q +P+RF+  I  TS   K        ++ V R+  + D  A  +V   E     YG  F +I+ +IN GKT +L+   + +  L+     PYVI I++PS   + A+++  +     + N+    R   E+ E++ ++ + E+ Y H  + TI N D  +T   +  +++  E+   W+P SW
Sbjct:  220 IGRIVKGGAAEKSGLLHEGDEILEINGVHMKGKSVSEVCELLADMNGTLTF-LLVPKTRSIGTLSRDRAVHVRANFDYDPYDDEFIPCRELGLAFRRGDILHVVDQEDQNWWQAWRAGEEGKKLAGLIPSKHFQQQRESMKHTVPADNEKTTEKSKKCLCIKRKRRKKVLYNAQQ-NEVFEVDQVLTYDEVDLLHPNPSRKRPIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVPRHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSPSYERVRALRRGKIDPFNPKLNVALTDR---EIHEMVAKAREMEEAYGHYFDHTITNTDFERTFDELRQVIARLEDEPQWVPVSW 620          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO39364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAA1])

HSP 1 Score: 163.31 bits (412), Expect = 1.168e-40
Identity = 117/393 (29.77%), Postives = 184/393 (46.82%), Query Frame = 3
Query: 3792 RILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAM--QNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQ--PLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
             I+   ++ +QG L  GD I E+N   V +   + L  +L    G +TFKI+ S +   +N+     V++RALFDYDP  D L+P ++ GMAF   +I +V+N+ D  +WQA   D+ E  A LIPS  LQE  +A       + ++  +      KK    + + AK  A +    DL TYEEVVK    +   ++L+G  G+G++ IK+ L+ K  ++F++PI  T+   +   +    +  V    MM+D +++ Y+      G +YG K  +I ++I   K  +LD +                              Q E L K L K             +S+   Q Y HL +LTIVN DI++T   +   L        W+P SW
Sbjct:  563 HIMYGGMIHRQGTLHPGDEIREINGSNVADKSIEALQSMLRDASGNVTFKIVPSSRGLGTNT----DVFVRALFDYDPRSDDLIPCQRAGMAFHCSEILQVVNKADCYWWQAKKPDANEEFAGLIPSPELQEWRVACIAAEKSKKQNGASCIWFSRKKKTYRDRYVAKHNA-VFDRLDLVTYEEVVKMEKFKRKTLVLLGAHGVGRRHIKNTLINKFADKFAYPIPHTTRDPRAGEEDGKHYYFVSAEVMMSDIESNRYLEYGTHEGAMYGTKLDTITDIIENHKVAILDVEP-----------------------------QGESL-KRLAK-------------ESDQLRQTYGHLFDLTIVNNDIDETIAQLEEALERLGTTPQWVPISW 907          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO37539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE1])

HSP 1 Score: 117.472 bits (293), Expect = 1.006e-29
Identity = 60/196 (30.61%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 4377 GPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPL--FNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            G  G+G++ +K+ L+  +  RF   I  TS   +   Q    +  V R  M  D +A  Y+   E  G +YG K  +IRE++  GK  V+D     +  LKTP F PY++ IA+PS   L+  Q + L + +   KRS  EL++ +  SE     Y H  +LTI N+++ +    + + +     +  W+P SW +
Sbjct:    1 GAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWVPVSWVY 196          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Match: EDO47352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMI8])

HSP 1 Score: 122.865 bits (307), Expect = 2.055e-28
Identity = 108/373 (28.95%), Postives = 169/373 (45.31%), Query Frame = 3
Query: 3675 ELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV--ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLE-KVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQE------RIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLH-TYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPL------FNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQ 4742
            EL  + + + K   + LG TV     + D        + RIL   +VD+ G L VGDVI E+N + V  +  +E++ ++ +  G++ FK++  P + +      + KV +RALF+YDP+ D L+P ++ G+    GDI +V++R D N+WQA   D   N   L+PS+  QE      R+ A  +N+       N  K+   + +K +  +  DA    ++ D   TYEEV  F P                   KH LV          + DTS     R +P       +  V R  M N  + S ++   E    LYG    SI+ +I  GK  +L  Q K    L+   + PY + I  PSL  L + +
Sbjct:  141 ELAVKYVRLIKSGKEPLGATVKCDEDTGD------IVVARILRGGMVDRSGTLGVGDVIQEINNQSVIGKTTNEVVEIMERLSGSVLFKVI--PMKAVDRKSTADTKVRLRALFNYDPANDDLIPCKEAGLPLVKGDILQVVSREDPNWWQARKEDDVNNTIGLVPSKQFQEKRFLFDRLFAETENHKHSSGGVNHVKNFRWRKRKKKEHKLSDAQKDETDGDKALTYEEVTMFSPVN----------------DKHRLV---------ILIDTSR----RMRPYEANGREYYFVSRTTMENYAQNSKFIEYGEFRKCLYGTSVDSIKRVIRTGKMCILKVQPKAAKILRRKEYKPYFVYIKPPSLETLRSTR 476          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: ENSORLT00000026977.1 (MAGUK p55 subfamily member 6 [Source:NCBI gene;Acc:101155860])

HSP 1 Score: 236.884 bits (603), Expect = 3.595e-66
Identity = 150/429 (34.97%), Postives = 226/429 (52.68%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPL----FNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            ++I I+K+  + LG+T             +   I RIL   ++D+QGLL VGD+I EVN K V  NP EL  +L  C G IT KIL S +    ++    +VY+R  FDYDP+ D L+P  + GMAFK GDI +++NR D N+WQA  +        LIPSQ L+E+  A        S         KK KK     AK+A       +L  YEEV K PP +   ++LIG  G+G++++K+ L+   P RF   I  TS  ++ R   L    ++   R  M  D KA  ++   E  G LYG K  SI E++  G+T +LD   + +  LKT  F PYV+ IAAP    L+AM K  +   LT  + +  +L++ + +S   ++ Y H  +LTIVN+++++    + + +    + S W+P +W +
Sbjct:  166 RMIGIRKKAGEPLGVTFRVEK--------DELVIARILHGGMIDRQGLLHVGDIIKEVNGKDVGNNPTELQEMLKDCSGGITLKILPSYR----DAPAPPQVYVRPYFDYDPANDNLIPCREAGMAFKKGDILQIVNREDPNWWQACHV--VGGATGLIPSQFLEEKRKAFVPRDLDGSGILCGTLAGKKKKKMMYLTAKNAE--FDRHELQIYEEVAKVPPFQRKTLVLIGAQGVGRRSLKNRLMVLHPTRFGTTIPYTS--RRPRDDELDGNSYHFTSRTEMEADVKAGRFLEHGEYDGNLYGTKIDSIHEVVATGRTCILDVNPQALKVLKTAEFMPYVVFIAAPDFDTLKAMHKAVVDAGLTTKQLTDVDLRKTVDESARIQRAYAHYFDLTIVNDNLDKAFETLQAAVDKLCSESQWVPVNWVY 576          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: ENSORLT00000005844.2 (MAGUK p55 subfamily member 6 [Source:NCBI gene;Acc:101155860])

HSP 1 Score: 236.884 bits (603), Expect = 3.595e-66
Identity = 150/429 (34.97%), Postives = 226/429 (52.68%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV-ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPL----FNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            ++I I+K+  + LG+T             +   I RIL   ++D+QGLL VGD+I EVN K V  NP EL  +L  C G IT KIL S +    ++    +VY+R  FDYDP+ D L+P  + GMAFK GDI +++NR D N+WQA  +        LIPSQ L+E+  A        S         KK KK     AK+A       +L  YEEV K PP +   ++LIG  G+G++++K+ L+   P RF   I  TS  ++ R   L    ++   R  M  D KA  ++   E  G LYG K  SI E++  G+T +LD   + +  LKT  F PYV+ IAAP    L+AM K  +   LT  + +  +L++ + +S   ++ Y H  +LTIVN+++++    + + +    + S W+P +W +
Sbjct:  166 RMIGIRKKAGEPLGVTFRVEK--------DELVIARILHGGMIDRQGLLHVGDIIKEVNGKDVGNNPTELQEMLKDCSGGITLKILPSYR----DAPAPPQVYVRPYFDYDPANDNLIPCREAGMAFKKGDILQIVNREDPNWWQACHV--VGGATGLIPSQFLEEKRKAFVPRDLDGSGILCGTLAGKKKKKMMYLTAKNAE--FDRHELQIYEEVAKVPPFQRKTLVLIGAQGVGRRSLKNRLMVLHPTRFGTTIPYTS--RRPRDDELDGNSYHFTSRTEMEADVKAGRFLEHGEYDGNLYGTKIDSIHEVVATGRTCILDVNPQALKVLKTAEFMPYVVFIAAPDFDTLKAMHKAVVDAGLTTKQLTDVDLRKTVDESARIQRAYAHYFDLTIVNDNLDKAFETLQAAVDKLCSESQWVPVNWVY 576          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: mpp2b (MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc:101158236])

HSP 1 Score: 217.624 bits (553), Expect = 8.112e-60
Identity = 138/428 (32.24%), Postives = 225/428 (52.57%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVEN-PDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK--NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T                 I RIL   ++D+QGLL VGD+I EVN K V N P  L  +L +  G++  KIL S + P +      + +++  FDYDPS D L+P ++ G++F +GDI ++ N+ D N+WQA  L+     A LIPSQ L+E+  A ++ +L   ++  L      K KK  ++     A+     +L  YEEV K PP R   ++LIG  G+G++++K+ L+  +  R+   I  TS   K   R   +++ + R+ M  D +   ++   E  G LYG K +SI E+I  GK  +LD   + +  L+T  F PYV+ I AP   +L+AM +  ++  +   + + SEL+  + +SE  ++ Y H  +L IVN+ +      + S L        W+P SW F
Sbjct:  147 RMVGIRKVSGEHLGVTFRVEN--------GELVIARILHGGMIDQQGLLHVGDIIKEVNGKEVGNDPKVLQEMLKEASGSVVLKILPSYQEPHTP----RQAFVKCHFDYDPSHDNLIPCKEAGLSFSSGDILQIFNQEDPNWWQACHLEG--GSAGLIPSQLLEEKRKAFVKRDLELATSGPLCAGMGGKKKKKMMYLTTKNAEF-DRHELRIYEEVAKVPPFRRKTLVLIGAQGVGRRSLKNKLLVSDTLRYGTTIPFTSRKPKVDERDGQMYSFMTRSEMECDIRNGRFLEHGEYDGNLYGTKINSIHEVIETGKICILDVNPQALKILRTSEFLPYVVFIEAPDFEVLKAMNRSAIESGVITKQLTDSELKRTVDESERIKRAYGHYFDLCIVNDGLETAFRGLRSALEKLTMEHQWVPVSWVF 559          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: mpp2b (MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc:101158236])

HSP 1 Score: 218.009 bits (554), Expect = 9.612e-60
Identity = 138/428 (32.24%), Postives = 225/428 (52.57%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVEN-PDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK--NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++ I+K   ++LG+T                 I RIL   ++D+QGLL VGD+I EVN K V N P  L  +L +  G++  KIL S + P +      + +++  FDYDPS D L+P ++ G++F +GDI ++ N+ D N+WQA  L+     A LIPSQ L+E+  A ++ +L   ++  L      K KK  ++     A+     +L  YEEV K PP R   ++LIG  G+G++++K+ L+  +  R+   I  TS   K   R   +++ + R+ M  D +   ++   E  G LYG K +SI E+I  GK  +LD   + +  L+T  F PYV+ I AP   +L+AM +  ++  +   + + SEL+  + +SE  ++ Y H  +L IVN+ +      + S L        W+P SW F
Sbjct:  167 RMVGIRKVSGEHLGVTFRVEN--------GELVIARILHGGMIDQQGLLHVGDIIKEVNGKEVGNDPKVLQEMLKEASGSVVLKILPSYQEPHTP----RQAFVKCHFDYDPSHDNLIPCKEAGLSFSSGDILQIFNQEDPNWWQACHLEG--GSAGLIPSQLLEEKRKAFVKRDLELATSGPLCAGMGGKKKKKMMYLTTKNAEF-DRHELRIYEEVAKVPPFRRKTLVLIGAQGVGRRSLKNKLLVSDTLRYGTTIPFTSRKPKVDERDGQMYSFMTRSEMECDIRNGRFLEHGEYDGNLYGTKINSIHEVIETGKICILDVNPQALKILRTSEFLPYVVFIEAPDFEVLKAMNRSAIESGVITKQLTDSELKRTVDESERIKRAYGHYFDLCIVNDGLETAFRGLRSALEKLTMEHQWVPVSWVF 579          
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 214.157 bits (544), Expect = 1.750e-56
Identity = 138/434 (31.80%), Postives = 240/434 (55.30%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENP--DELLFLLGKCKGTITFKILKSPKRPISNS-VNLE-KVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTEN-QAFLIPSQSLQE---RIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNH--VDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++  QK  ++ +GIT+  +        LN C + RI+   ++ +QG L VGD I E+N   V N   ++L  +L + +G+ITFKI+ S +   S+   +L  ++Y+RA F+YDPSKD+L+P ++ G+ F+ GDI ++++++D N+WQ   L++T+N  A LIPS  LQE     +AM+   + +        K KK  K++     +A  +  + DL TYEEVVK P  +   ++L+G  G+G++ IK+ L+ K P+RF++PI  T+   K   +   N+  V  + MM D   + Y+        +YG +  +IR++  QG   +LD + + +  L+T  F PYV+ IAAP++T        G+ ++          LQ +  +SE  ++ Y H  ++TI+N +I++T  ++   +      S W+P SW +
Sbjct:  483 RLVQFQKNTDEPMGITLKLNE-------LNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEFSLSTQIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQG-KLENTKNGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNA--VFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAPTIT-------PGISED--------ESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSTTSQWVPVSWVY 891          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000056880.1 (SMESG000056880.1)

HSP 1 Score: 1577.38 bits (4083), Expect = 0.000e+0
Identity = 884/885 (99.89%), Postives = 885/885 (100.00%), Query Frame = 1
Query:   22 MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLDINKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPPQSSSEMEIKXXXXXXXXXXXXXXXXXXXXXXXXXDYRITFEEKCNSNLNRKTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNSTTWRQLKDNASNKVISWNKLKNATKMPXXXXXXXXXXXXSRSRSVIKPNIIKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQEFFELCENKLHNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNYPGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDSGFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHHRSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRSISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPMSPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLKYSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKAPFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNNAEYMNDIMKAVKKIPITNEKNRFKFFISHLINAKLLQRWFNDLVNNENLLKNNYSKESFLRQVNTNLKGLYADLDTNLQLLDRLPYGNXXXXXXXXXXEKVMNLKPTPSVKXXXXXXXXXXXXXXXXXXFQDSCRLKSSSQIDTEPKPVRTMXXXXXXXXXXXXXXXXXXXXXXXLKKPIIYYPKFTVGKGKL 2676
            MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLDINKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPPQSSSEMEIKESMTRSSFSQSSLLLKELLTKQLSRDYRITFEEKCNSNLNRKTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNSTTWRQLKDNASNKVISWNKLKNATKMPDDNLLNKTKDNNSRSRSVIKPNIIKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQEFFELCENK+HNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNYPGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDSGFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHHRSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRSISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPMSPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLKYSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKAPFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNNAEYMNDIMKAVKKIPITNEKNRFKFFISHLINAKLLQRWFNDLVNNENLLKNNYSKESFLRQVNTNLKGLYADLDTNLQLLDRLPYGNSTKTKSSQTKEKVMNLKPTPSVKSLKKSTMNQSSSSNSSNKFQDSCRLKSSSQIDTEPKPVRTMIPTKTKIPITSSSSSSNSSAAPSLKKPIIYYPKFTVGKGKL
Sbjct:    1 MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLDINKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPPQSSSEMEIKESMTRSSFSQSSLLLKELLTKQLSRDYRITFEEKCNSNLNRKTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNSTTWRQLKDNASNKVISWNKLKNATKMPDDNLLNKTKDNNSRSRSVIKPNIIKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQEFFELCENKVHNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNYPGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDSGFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHHRSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRSISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPMSPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLKYSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKAPFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNNAEYMNDIMKAVKKIPITNEKNRFKFFISHLINAKLLQRWFNDLVNNENLLKNNYSKESFLRQVNTNLKGLYADLDTNLQLLDRLPYGNSTKTKSSQTKEKVMNLKPTPSVKSLKKSTMNQSSSSNSSNKFQDSCRLKSSSQIDTEPKPVRTMIPTKTKIPITSSSSSSNSSAAPSLKKPIIYYPKFTVGKGKL 885          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000056881.1 (SMESG000056881.1)

HSP 1 Score: 1424.45 bits (3686), Expect = 0.000e+0
Identity = 752/757 (99.34%), Postives = 755/757 (99.74%), Query Frame = 3
Query: 3144 MTTNDNINVILHGLSKLEDKYDFIDDTDVTFLNEFFRRFQTLILMKETLEEGDSIQYSNTIDTDTLEAVTNIIRRNSKKNRDAGKLYHILKKIHFKTLFNCMKELNNEEHIPISYNGSLEEIEIDVKNQDYHDGYXXXXXXXXXXXXXXGTEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIAPLAINKSTNNKNIPKQNDRSTINSVGGRRYEKRSEKPSVSLNSSRMPIDNRXXXXXXXXXXXXXXXXNVVNAKPINLSNSRKSDDNIPKDVNKSIKFSNKPEEIINKTEEKPLRSSVSKISEVDGKPMKHSNSKAGDKQIKHSNSKTDD 5414
            MTTNDNINVILHGLSKLEDKYDFIDDTDVTFLNEFFRRFQTLILMKETLEE DSIQYSNTIDTDTLEAVTNIIRRNSKKNRDAGKLYHILKKIHFKTLFNCMKELNNEE+IPISYNGSLEEIEIDVKNQDYHDGYSDSENRSSYESESEGTEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERIL NSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPKSNENLKKSKLKKSKKNEIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEA+QKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIAPLAINKSTNNKNIPKQNDRSTINSVGGRRYEKRSEKPSVSLNSSRMPIDNRSESSQSENESESDSEENVVNAKPINLSNSRKSDDNIPKDVNKSIKFSNKPEEIINKTEEKPLRSSVSKISEVDGKPMKHS+SKAGDKQIKHSNSKTDD
Sbjct:    1 MTTNDNINVILHGLSKLEDKYDFIDDTDVTFLNEFFRRFQTLILMKETLEEADSIQYSNTIDTDTLEAVTNIIRRNSKKNRDAGKLYHILKKIHFKTLFNCMKELNNEEYIPISYNGSLEEIEIDVKNQDYHDGYSDSENRSSYESESEGTEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILFNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPKSNENLKKSKLKKSKKNEIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAIQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEFEIAPLAINKSTNNKNIPKQNDRSTINSVGGRRYEKRSEKPSVSLNSSRMPIDNRSESSQSENESESDSEENVVNAKPINLSNSRKSDDNIPKDVNKSIKFSNKPEEIINKTEEKPLRSSVSKISEVDGKPMKHSDSKAGDKQIKHSNSKTDD 757          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000056880.1 (SMESG000056880.1)

HSP 1 Score: 1306.2 bits (3379), Expect = 0.000e+0
Identity = 691/693 (99.71%), Postives = 692/693 (99.86%), Query Frame = 1
Query:   22 MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLDINKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPPQSSSEMEIKXXXXXXXXXXXXXXXXXXXXXXXXXDYRITFEEKCNSNLNRKTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNSTTWRQLKDNASNKVISWNKLKNATKMPXXXXXXXXXXXXSRSRSVIKPNIIKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQEFFELCENKLHNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNYPGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDSGFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHHRSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRSISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPMSPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLKYSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKAPFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNNA 2100
            MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLDINKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPPQSSSEMEIKESMTRSSFSQSSLLLKELLTKQLSRDYRITFEEKCNSNLNRKTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNSTTWRQLKDNASNKVISWNKLKNATKMPDDNLLNKTKDNNSRSRSVIKPNIIKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQEFFELCENK+HNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNYPGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDSGFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHHRSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRSISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPMSPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLKYSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKAPFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNN 
Sbjct:    1 MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLDINKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPPQSSSEMEIKESMTRSSFSQSSLLLKELLTKQLSRDYRITFEEKCNSNLNRKTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNSTTWRQLKDNASNKVISWNKLKNATKMPDDNLLNKTKDNNSRSRSVIKPNIIKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQEFFELCENKVHNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNYPGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDSGFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHHRSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRSISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPMSPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLKYSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKAPFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNNG 693          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000007837.1 (SMESG000007837.1)

HSP 1 Score: 243.432 bits (620), Expect = 4.024e-68
Identity = 140/429 (32.63%), Postives = 242/429 (56.41%), Query Frame = 3
Query: 3690 IISIQKEPNQNLGITVVKSTVSFDGK-PLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDELLFLLGKCKGTITFKILKSPK-RPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA-MQNNLRPXXXXXXXXXXXXXXXXXXI---FRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQP--LFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASW 4952
            ++ I KE  ++LGITV    +  DG  P+ R  +ERI+  S ++ Q LL  GD+I E N   V++P+ L  L+    G +T K++   + +PI     + ++Y+RA F YDPS D L+P ++ G++F  GDI +VLN++DI +WQA  L + +++A LIP++ L+ER  A M N   P   +          KK ++   F AK A D   ++D+  YEEV + P  + P + LI   G+G+  I+  L+++ P++F+ P++DTS  K+ + +P   ++ VDR+ M  +   + Y+   E +   YG+   ++RE++  G+T ++DC  +   +LKT  F P+V+ +A PS+  + AM + G Q NLT+  ++  +    I +S + E+ ++H+ +  IV +++  T   I   + D E    W+P  W
Sbjct:  199 MVGIPKEKGEHLGITVGIRHIELDGTGPMQRIVVERIMAGSKIESQNLLAPGDIITECNGTIVDSPELLQKLMKDAIGMVTLKVIPVIRTKPI-----VTQLYLRAFFAYDPSFDTLIPCKEAGLSFLPGDILQVLNQDDIYWWQA-RLANVKDRAGLIPTEYLEERRRAYMLNAKDPNEVKYKILGFGVGKKKKQVKVDFSAKFAHDY-EKSDIVMYEEVSRIPAFKRPVICLIAAPGVGRTTIRDELLRRFPDKFACPLRDTSRPKR-QGEPDNKYHFVDRDIMQVEHMGNRYLDFGEYNNNFYGVHLKTVREIVKSGRTCLMDCSAEAARRLKTEEFMPWVLFLAGPSIDCMRAMYEYGFQTNLTEKYKNDEDFHNTIEESINLERTFRHIFDDIIVVDNMQATFEKILEKIEDLEKKPQWVPVKW 619          
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 192.971 bits (489), Expect = 5.003e-50
Identity = 125/430 (29.07%), Postives = 219/430 (50.93%), Query Frame = 3
Query: 3687 QIISIQKEPNQNLGITVVKSTVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPV--ENPDELLFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPSEQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIAMQNNLRPXXXXXXXXXXXXXXXXXXIFRAKDAADIISEADLHTYEEVVKFPPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKK----NRTQPLFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLDCQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSELQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIPASWEF 4958
            +++  QK  ++ +GIT+    ++ +GK    C + RI+   ++ +QG L VGD I E+N + V     + L  LL   +G++T KI+ S +    N +  E +Y++A+F+Y+P  D L+P  Q G+ FK GDI ++++++D N+WQA    +    A L   +S QE         + + +++              +RAK +  +  + DL TYEEVV+ P  +   ++L+G  G+G++ IK+ L+Q  P+RF++PI  T+   +    N     F  V    MM D   + Y+        +YG K  +IR + + G   +LD + + +  L+T  F+PYV+ IAAP L  +  +       NL         L+ +  +SE  E  Y H  +L IVN DI  T   +   + + ++++ W+P +W +
Sbjct:  438 RLVQFQKNTDEPMGITL---KMNDEGK----CIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRH---NPMQCE-IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAEWRSASLAIERSKQETANCAWFGKKKRQSKDK-------------YRAKHSG-VFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFF--VSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVH------NLNDGS-----LERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 829          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPP23.709e-6532.09membrane palmitoylated protein 2 [Source:HGNC Symb... [more]
MPP22.333e-6332.02membrane palmitoylated protein 2 [Source:HGNC Symb... [more]
MPP22.333e-6332.02membrane palmitoylated protein 2 [Source:HGNC Symb... [more]
MPP22.333e-6332.02membrane palmitoylated protein 2 [Source:HGNC Symb... [more]
MPP22.861e-6332.02membrane palmitoylated protein 2 [Source:HGNC Symb... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-24.955e-5128.92pep chromosome:WBcel235:X:12399517:12406131:-1 gen... [more]
lin-24.797e-5028.92pep chromosome:WBcel235:X:12399517:12414037:-1 gen... [more]
magu-21.215e-3829.98MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.215e-3829.98MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-22.587e-3829.98MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vari2.275e-5828.75gene:FBgn0250785 transcript:FBtr0335146[more]
CASK4.010e-5831.59gene:FBgn0013759 transcript:FBtr0112873[more]
vari1.917e-5727.99gene:FBgn0250785 transcript:FBtr0089945[more]
vari3.201e-5729.09gene:FBgn0250785 transcript:FBtr0335501[more]
vari3.201e-5729.09gene:FBgn0250785 transcript:FBtr0089946[more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp6b4.857e-6735.01membrane protein, palmitoylated 6b (MAGUK p55 subf... [more]
mpp6b4.857e-6735.01membrane protein, palmitoylated 6b (MAGUK p55 subf... [more]
mpp2a3.307e-6533.92membrane protein, palmitoylated 2a (MAGUK p55 subf... [more]
mpp2a6.057e-6532.63membrane protein, palmitoylated 2a (MAGUK p55 subf... [more]
mpp6a7.643e-6232.71membrane protein, palmitoylated 6a (MAGUK p55 subf... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atf5.22.285e-6433.49activating transcription factor 5, gene 2 [Source:... [more]
atf5.22.635e-6433.49activating transcription factor 5, gene 2 [Source:... [more]
atf5.23.038e-6433.49activating transcription factor 5, gene 2 [Source:... [more]
atf5.23.314e-6433.49activating transcription factor 5, gene 2 [Source:... [more]
atf5.24.406e-6433.49activating transcription factor 5, gene 2 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpp28.567e-6332.02membrane protein, palmitoylated 2 (MAGUK p55 subfa... [more]
Mpp21.286e-6232.02membrane protein, palmitoylated 2 (MAGUK p55 subfa... [more]
Mpp62.061e-5932.01membrane protein, palmitoylated 6 (MAGUK p55 subfa... [more]
Mpp62.061e-5932.01membrane protein, palmitoylated 6 (MAGUK p55 subfa... [more]
Mpp62.431e-5932.19membrane protein, palmitoylated 6 (MAGUK p55 subfa... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZAA9|MPP2_RAT1.554e-6232.02MAGUK p55 subfamily member 2 OS=Rattus norvegicus ... [more]
sp|Q14168|MPP2_HUMAN4.284e-6232.02MAGUK p55 subfamily member 2 OS=Homo sapiens OX=96... [more]
sp|Q9WV34|MPP2_MOUSE5.993e-6232.02MAGUK p55 subfamily member 2 OS=Mus musculus OX=10... [more]
sp|Q9JLB0|MPP6_MOUSE1.700e-5832.19MAGUK p55 subfamily member 6 OS=Mus musculus OX=10... [more]
sp|Q9NZW5|MPP6_HUMAN1.848e-5831.66MAGUK p55 subfamily member 6 OS=Homo sapiens OX=96... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7GR548.826e-8335.51MAGUK p55 subfamily member 2 (Fragment) OS=Clonorc... [more]
G7YIH16.385e-8235.51MAGUK p55 subfamily member 2 OS=Clonorchis sinensi... [more]
A0A3Q0KVH55.069e-8135.37ATP-dependent RNA helicase, putative OS=Schistosom... [more]
A0A4Z2D3L95.304e-7935.96MAGUK p55 subfamily member 6 isoform 1 (Fragment) ... [more]
A0A0R3SGR06.167e-7937.04Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp2b5.683e-6232.71MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc... [more]
mpp2b7.612e-6232.71MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc... [more]
mpp2a6.975e-6030.77MAGUK p55 subfamily member 2-like [Source:NCBI gen... [more]
mpp6a6.155e-5931.63membrane palmitoylated protein 6 [Source:NCBI gene... [more]
mpp6a7.534e-5931.63membrane palmitoylated protein 6 [Source:NCBI gene... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004699.13.861e-5830.16pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1... [more]
ENSPMAT00000008487.13.727e-5530.39pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
ENSPMAT00000008482.15.244e-5529.93pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
mpp7a1.024e-4627.25membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
MPP53.778e-1928.50membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUK12.527e-924.16Guanylate kinase; converts GMP to GDP; required fo... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375381.108e-6932.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335778.243e-4730.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393641.168e-4029.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375391.006e-2930.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473522.055e-2828.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000026977.13.595e-6634.97MAGUK p55 subfamily member 6 [Source:NCBI gene;Acc... [more]
ENSORLT00000005844.23.595e-6634.97MAGUK p55 subfamily member 6 [Source:NCBI gene;Acc... [more]
mpp2b8.112e-6032.24MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc... [more]
mpp2b9.612e-6032.24MAGUK p55 subfamily member 2 [Source:NCBI gene;Acc... [more]
CASK1.750e-5631.80calcium/calmodulin dependent serine protein kinase... [more]
back to top
BLAST of ATP-dependent RNA helicase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056880.10.000e+099.89SMESG000056880.1[more]
SMESG000056881.10.000e+099.34SMESG000056881.1[more]
SMESG000056880.10.000e+099.71SMESG000056880.1[more]
SMESG000007837.14.024e-6832.63SMESG000007837.1[more]
SMESG000060582.15.003e-5029.07SMESG000060582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024997 ID=SMED30024997|Name=ATP-dependent RNA helicase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=5430bp
ATATAAATCTTATATGATGTTATGAATAAAATAAAAGCACAAAATAAAAT
CATTACCGATTTATCTATAGAATCGGAATCGGAATATTTTTTTGATGATC
AGTTTAGTATACCATTTGATGCTAACTTAAAAGAAGAAAATAATAATATA
TCTAATGATTTGTCATTAGATATTAATAAAAATATGTCACAATTATGTCA
ATCGTTTTCTGAGTCTTGTATTTATTCGGATTTAGATAGTTCTTATCAGG
CATTTCCAGATATTTTAGATGATGTAAGCTACAGAAAAATTTTGAATAAA
GAAATTTTATTTACACCACCACAAAGTAGTTCAGAAATGGAAATTAAAGA
GTCCATGACTAGAAGTAGTTTTAGTCAATCATCATTATTATTAAAAGAGT
TGCTTACTAAGCAATTGAGTAGAGATTATAGAATAACATTTGAAGAAAAA
TGCAATTCCAATTTAAATAGAAAAACACATTCAATGTTAAATTGTTCAAA
TTCATGCAATGAAAATGGAAATTTAGGTTCTAATAAAGTTACTTGGAATC
AAATAAGTAATAAAAACCATAATTCATTATTAAAAACAAAAAATGATGAA
AACAATATCGAAGGAAATTCTACAACTTGGCGGCAATTAAAAGATAACGC
CAGTAATAAAGTAATTTCTTGGAATAAATTAAAAAATGCAACTAAAATGC
CTGATGATAATTTATTGAATAAAACGAAAGATAATAATTCAAGGAGTAGA
TCAGTTATAAAACCTAATATTATAAAAATGGATGATTCATTAAGATTTAC
GTCAAATGAAAATGTAAAATACAGAGCTCATTCAGAACCGAGAAAGTCTC
ATCGATTTTCCGGGACTCTTCTGGAAATATATTCTAGAACTCGTGGATTA
AATCAAAGTAAAAATTCCCAAGAATTTTTTGAACTATGTGAAAATAAACT
TCACAATGAAAGCACTAAAACTTTAGTTAATTTCGGAGCTCAATTTCCAC
CAACAGCTGCTACAGATTTTCCTCCTCGTCAACGTTCAAACAGTTTATTA
GAAAAGAAAGCTCAAAATTATCCCGGATTGGGATTGATCAAGACTCCTAA
ATCGACGCGTTTGACAAATTCAGCTTTTCTAAGCAGGACTTTGCCGGATT
TGTCATTTTTAGCGAACATGGAATCAACTGACACAAAACGATTGAAATCA
AGCAACTACACGAAAGATTCTGGTTTCGACAGCGGAACGAGCAATAATGA
CAAATTAAAGGATTCAAATCAGTTCTGCATGAAATGTCAATCGATATTCT
ACGATCCTCCAGTGACAGATGATTTAATCAAATTAGACGAAAAATCCAAT
TCGTTTAAATTTAATCACCATCGCAGCGTTCCGAATTTTCAATCGATAGA
TTTATTAACCGGTTCTCCAATCAGAAAAAAAGACAATTCCAGCAATTCAA
AAGACCCTCCTCTTTCTAATGAAAATGAAACTCCATTAAAATCATGCCTG
CGGCAATCTCTCGATCGATCGATATCGGAGCCGGATTTTGGCAACTCGAA
AAACAATCCCGATTATACTACTGAATCCGTTAGCAGTAGTGTGTCTGATC
TCGAAGGCAACAAAACTAACAAAGCGAAAAAAAGTGTGAGTTTCAGTGAG
AAAATCATCAAGAAACCGATGTCACCGATTAAATACTATGGCTCGTCATT
GACTCTGTGGAAAAACGATTTAGAAATGTCTCTCAAACCACAAGAAATTC
CAAGAGATTGGGGTCTCTATGGCAACGGCAGTGTGATGATTTCGGAATTT
GTTCTGGGCGCCCAATTGAAATACAGCAAAGAAAATGAGTTGTCAAATGA
GGACCTGAAATATAAAGTGATGGTGCGAGACATTATCAAGGCCGTCCAGG
AAACCATTGCAAATTGTTCCGATCAGGCACAGGAAAATAAAACATTGCCG
GAATCAAAAACGATCAAAGCCCCGTTTATGATTGTTGATCCACTGTATGT
CCTGCTTACAGATGGAATCCTTCCTTATCAGAAGAATGTCATCACAATCA
AAAGTCGATATCGATTGTGGAATGTTCTCGAAACGAATTCTAACAATGCT
GAATACATGAATGACATAATGAAAGCTGTGAAAAAAATTCCAATTACAAA
TGAAAAGAACCGATTCAAGTTTTTCATATCTCATTTAATTAATGCTAAAT
TATTACAAAGATGGTTTAATGATCTTGTTAACAATGAAAATCTCTTAAAA
AATAATTATTCCAAAGAATCATTCTTGCGACAAGTCAACACGAATCTCAA
AGGTTTGTATGCCGATCTAGACACGAACCTCCAGTTATTAGACAGATTAC
CTTACGGTAATTCCACAAAAACCAAATCTAGTCAAACTAAAGAAAAGGTA
ATGAATCTCAAACCGACTCCATCAGTGAAATCTCTGAAAAAATCTACCAT
GAATCAATCATCATCATCTAATTCGTCCAACAAATTCCAAGACTCTTGTC
GACTAAAATCGAGTTCTCAAATCGACACAGAACCGAAACCTGTGCGAACT
ATGATTCCAACCAAAACTAAAATCCCAATCACATCATCATCATCATCGTC
CAATAGTTCTGCAGCTCCATCTCTCAAGAAACCAATCATTTATTATCCAA
AATTCACAGTGGGAAAAGGGAAATTATAATCTGTAATCTAACCAATTATA
AGCGACTATTGACGTAATTCCAACGATTTATCGATATAATTATATATATA
ATATCGTTCGATTCTATGATCTCTTTTTACAATTATCGATTTTCACATTT
ACCTTTATTTGAGTTTTTCAGTATTCATTTTCGGTTTAATTTCAATATTT
ATTGATTTGAATTTCAAGATTGTATAAAATTGTTGATAATATGGAAACTT
ACAGCAACTACAACAATAAAAAGCAAACAATTTTACAAGATAGTTATTGG
ATATTTTAAATCTGTCGTCATTGCTTTTATTAAATTGAATTTCAATTGAT
TTTTTGTCTTTTGGTTTTGATTGAAAATTTTCGAATTGAGATAATTTTTT
GTTTAGAATATTATTTTGATGAATAAATTTTTCAATTTCAATAAAAATTT
TTCTCCATATTTTAGATAGCCAATCAGACATATCAGAATTAAGATGACAA
CCAATGATAATATCAATGTAATCTTGCACGGTCTTTCGAAATTGGAAGAT
AAATATGATTTCATCGATGATACTGATGTTACGTTTTTGAATGAATTCTT
TCGGCGGTTTCAAACTTTAATTTTGATGAAAGAGACTTTGGAAGAAGGAG
ATTCAATTCAATATAGTAACACTATCGACACTGATACGCTAGAGGCAGTA
ACTAATATCATAAGGAGAAATTCAAAGAAAAATCGAGATGCTGGAAAATT
ATATCACATTTTGAAAAAAATTCATTTCAAGACTTTATTTAACTGTATGA
AAGAATTAAATAACGAAGAACACATTCCTATATCGTATAATGGAAGTTTG
GAAGAAATAGAAATTGATGTTAAAAACCAAGATTATCATGATGGTTATTC
AGATTCTGAAAATCGATCATCCTATGAGTCTGAATCGGAAGGCACGGAAG
ATATTTCCATTGATAATTCCATTCTTCCTACGTACCAAGAGATCGGATAC
AGTGATAATAATAGATTCGCGAATGAATTGGATTTTCAAATTATTAGTAT
ACAAAAAGAACCAAATCAAAACTTGGGAATTACTGTTGTAAAATCAACTG
TCTCTTTTGATGGTAAGCCGTTAAATCGCTGCAGCATCGAAAGAATTTTA
GTTAATTCTATAGTAGATAAACAAGGTCTTTTGCAAGTTGGCGACGTCAT
TTTAGAGGTAAATGAGAAACCGGTTGAAAATCCGGATGAGTTACTATTTC
TATTGGGAAAATGTAAGGGTACGATTACTTTCAAAATTCTCAAATCTCCA
AAACGTCCGATTTCAAATTCAGTTAATCTTGAAAAGGTTTATATGAGAGC
ACTGTTTGATTACGATCCGTCTAAAGATAAATTACTTCCATCTGAACAAA
TTGGAATGGCATTTAAGGCTGGCGATATATTTGAAGTATTAAATAGAAAC
GATATTAACTTTTGGCAGGCACTTCCTTTGGATTCTACGGAAAATCAAGC
ATTCCTAATACCTTCCCAATCTCTCCAGGAACGAATTATTGCAATGCAAA
ATAATTTAAGACCAAAATCAAATGAAAATCTTAAAAAATCTAAACTAAAA
AAATCAAAGAAAAACGAAATTTTCAGAGCCAAAGATGCTGCAGACATTAT
TAGTGAAGCTGACTTACACACATATGAAGAAGTTGTAAAATTTCCCCCTT
CAAGAGTTCCATGTGTTTTATTAATCGGACCTACTGGAATTGGAAAGAAA
GCTATTAAACATCTTCTCGTTCAAAAAGAGCCTAATCGGTTTTCATTTCC
TATACAAGATACGTCAGAAGCGAAGAAAAACCGTACTCAACCACTATTCA
ATCATGTTGACAGAAATGCAATGATGAATGACACTAAGGCCTCTTTATAT
GTTTGTTTGGAAGAAAAATCTGGAGAATTATACGGAATTAAGTTTTCCTC
AATACGAGAGTTAATTAATCAAGGGAAAACTGTCGTTTTAGATTGCCAAA
CTAAAGAAGTTTACAAACTTAAAACGCCACTCTTTAATCCGTATGTTATT
TTAATTGCTGCTCCATCACTGACCATTCTTGAGGCAATGCAAAAAGAAGG
TTTACAAAAGAATCTTACAAAAAACAAGCGAAGTACTTCCGAACTGCAAG
AGATAATTTTTCAATCTGAAGACTATGAACAAATGTATAAGCATCTCATA
AATTTAACCATTGTCAATGAAGATATAAATCAAACTGCAACCTACATATC
ATCAATGCTTTCTGATTTTGAAAATAATAGTTCTTGGATTCCTGCCTCTT
GGGAATTTGAAATCGCTCCTTTAGCGATAAATAAATCCACAAATAATAAA
AACATCCCAAAGCAAAATGACCGGTCAACAATCAACTCAGTCGGTGGGAG
AAGATATGAGAAAAGATCAGAAAAGCCTTCAGTTTCGTTGAATTCCAGCC
GTATGCCTATTGATAATCGGAGTGAAAGTTCCCAATCTGAAAATGAATCC
GAGTCGGATTCCGAAGAAAATGTAGTTAATGCGAAACCGATCAATTTATC
AAATTCTCGGAAATCTGATGACAATATTCCTAAAGATGTCAACAAATCAA
TCAAATTTTCCAATAAACCAGAAGAGATCATTAATAAAACCGAAGAAAAG
CCATTGAGATCGTCAGTTTCTAAGATTTCGGAAGTTGACGGCAAGCCAAT
GAAACATTCTAATTCTAAAGCCGGCGATAAACAAATCAAGCATTCAAATT
CTAAGACCGATGATAAATCTTTGAAACATT
back to top

protein sequence of SMED30024997-orf-1

>SMED30024997-orf-1 ID=SMED30024997-orf-1|Name=SMED30024997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MSDWLSKIWRKIFIEIEKFIHQNNILNKKLSQFENFQSKPKDKKSIEIQF
NKSNDDRFKISNNYLVKLFAFYCCSCCKFPYYQQFYTILKFKSINIEIKP
KMNTEKLK*
back to top

protein sequence of SMED30024997-orf-2

>SMED30024997-orf-2 ID=SMED30024997-orf-2|Name=SMED30024997-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=886bp
MNKIKAQNKIITDLSIESESEYFFDDQFSIPFDANLKEENNNISNDLSLD
INKNMSQLCQSFSESCIYSDLDSSYQAFPDILDDVSYRKILNKEILFTPP
QSSSEMEIKESMTRSSFSQSSLLLKELLTKQLSRDYRITFEEKCNSNLNR
KTHSMLNCSNSCNENGNLGSNKVTWNQISNKNHNSLLKTKNDENNIEGNS
TTWRQLKDNASNKVISWNKLKNATKMPDDNLLNKTKDNNSRSRSVIKPNI
IKMDDSLRFTSNENVKYRAHSEPRKSHRFSGTLLEIYSRTRGLNQSKNSQ
EFFELCENKLHNESTKTLVNFGAQFPPTAATDFPPRQRSNSLLEKKAQNY
PGLGLIKTPKSTRLTNSAFLSRTLPDLSFLANMESTDTKRLKSSNYTKDS
GFDSGTSNNDKLKDSNQFCMKCQSIFYDPPVTDDLIKLDEKSNSFKFNHH
RSVPNFQSIDLLTGSPIRKKDNSSNSKDPPLSNENETPLKSCLRQSLDRS
ISEPDFGNSKNNPDYTTESVSSSVSDLEGNKTNKAKKSVSFSEKIIKKPM
SPIKYYGSSLTLWKNDLEMSLKPQEIPRDWGLYGNGSVMISEFVLGAQLK
YSKENELSNEDLKYKVMVRDIIKAVQETIANCSDQAQENKTLPESKTIKA
PFMIVDPLYVLLTDGILPYQKNVITIKSRYRLWNVLETNSNNAEYMNDIM
KAVKKIPITNEKNRFKFFISHLINAKLLQRWFNDLVNNENLLKNNYSKES
FLRQVNTNLKGLYADLDTNLQLLDRLPYGNSTKTKSSQTKEKVMNLKPTP
SVKSLKKSTMNQSSSSNSSNKFQDSCRLKSSSQIDTEPKPVRTMIPTKTK
IPITSSSSSSNSSAAPSLKKPIIYYPKFTVGKGKL*
back to top

protein sequence of SMED30024997-orf-3

>SMED30024997-orf-3 ID=SMED30024997-orf-3|Name=SMED30024997-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=762bp
MTTNDNINVILHGLSKLEDKYDFIDDTDVTFLNEFFRRFQTLILMKETLE
EGDSIQYSNTIDTDTLEAVTNIIRRNSKKNRDAGKLYHILKKIHFKTLFN
CMKELNNEEHIPISYNGSLEEIEIDVKNQDYHDGYSDSENRSSYESESEG
TEDISIDNSILPTYQEIGYSDNNRFANELDFQIISIQKEPNQNLGITVVK
STVSFDGKPLNRCSIERILVNSIVDKQGLLQVGDVILEVNEKPVENPDEL
LFLLGKCKGTITFKILKSPKRPISNSVNLEKVYMRALFDYDPSKDKLLPS
EQIGMAFKAGDIFEVLNRNDINFWQALPLDSTENQAFLIPSQSLQERIIA
MQNNLRPKSNENLKKSKLKKSKKNEIFRAKDAADIISEADLHTYEEVVKF
PPSRVPCVLLIGPTGIGKKAIKHLLVQKEPNRFSFPIQDTSEAKKNRTQP
LFNHVDRNAMMNDTKASLYVCLEEKSGELYGIKFSSIRELINQGKTVVLD
CQTKEVYKLKTPLFNPYVILIAAPSLTILEAMQKEGLQKNLTKNKRSTSE
LQEIIFQSEDYEQMYKHLINLTIVNEDINQTATYISSMLSDFENNSSWIP
ASWEFEIAPLAINKSTNNKNIPKQNDRSTINSVGGRRYEKRSEKPSVSLN
SSRMPIDNRSESSQSENESESDSEENVVNAKPINLSNSRKSDDNIPKDVN
KSIKFSNKPEEIINKTEEKPLRSSVSKISEVDGKPMKHSNSKAGDKQIKH
SNSKTDDKSLKH
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0005515protein binding
GO:0004385guanylate kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR037213Run_dom_sf
IPR004012Run_dom
IPR001478PDZ
IPR008145GK/Ca_channel_bsu
IPR027417P-loop_NTPase
IPR011511SH3_2
IPR001452SH3_domain
IPR008144Guanylate_kin-like_dom
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0005887integral component of plasma membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0032590dendrite membrane
GO:0043197dendritic spine
GO:0043198dendritic shaft
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0046037GMP metabolic process
GO:0046710GDP metabolic process
GO:0051260protein homooligomerization
GO:0060079excitatory postsynaptic potential
GO:0060291long-term synaptic potentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR037213RUN domain superfamilyGENE3DG3DSA:1.20.58.900coord: 613..790
e-value: 7.2E-24
score: 86.2
IPR037213RUN domain superfamilySUPERFAMILYSSF140741RUN domain-likecoord: 671..755
IPR004012RUN domainPFAMPF02759RUNcoord: 663..759
e-value: 5.2E-8
score: 32.9
IPR004012RUN domainPROSITEPS50826RUNcoord: 646..786
score: 14.296
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..534
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 782..839
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 782..867
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..530
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 849..867
NoneNo IPR availablePANTHERPTHR15591RUN AND SH3 DOMAIN CONTAININGcoord: 660..802