Fzd-4-2

Overview
NameFzd-4-2
Smed IDSMED30024996
Length (bp)2134
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fzd-4-2 (SMED30024996) t-SNE clustered cells

Violin plots show distribution of expression levels for Fzd-4-2 (SMED30024996) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fzd-4-2 (SMED30024996) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fzd-4-2 (SMED30024996) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024996

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30024996SMESG000038967.1 dd_Smed_v4_13186_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30024996SMESG000038967.1 dd_Smed_v4_13186_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30024996SMESG000038967.1 dd_Smed_v4_16926_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30024996SMESG000038967.1 dd_Smed_v4_16926_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30024996SMESG000038967.1 SmedASXL_014505SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
posterior muscle cellSMED30024996SMESG000038967.1 dd_Smed_v4_13186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30024996SMESG000038967.1 dd_Smed_v4_13186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fzd-4-2 vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 300.827 bits (769), Expect = 1.544e-92
Identity = 177/538 (32.90%), Postives = 281/538 (52.23%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
             +C  I   +C+ + Y+ TRMPN +G  NQ ++A +++++ PL+   C  + RFFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ F  KWP  L+C+K P   +   +C+   N           NG D   +    +  +F      +  R  + +       L      +   DN  K     KS SC P C    ++++S  DK  A +W  IW +LC  SS   + TF+ D   RF YPERPIIF+ +CY    V  L  L    + + C         + +++EG ES  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+LIP     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L   AA    +C  K   +     CL    +P VE+ +++IF  LV+GITSGMW+W +K
Sbjct:   32 GKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPN-----------NGSDEPTRGSGLFPPLF------RPQRPHSAQEHP----LKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLID-PARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACD---RDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKIL---AAQ--HKC--KMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526          
BLAST of Fzd-4-2 vs. Ensembl Human
Match: FZD9 (frizzled class receptor 9 [Source:HGNC Symbol;Acc:HGNC:4047])

HSP 1 Score: 281.567 bits (719), Expect = 4.254e-85
Identity = 169/533 (31.71%), Postives = 268/533 (50.28%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIR-PTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNI--WYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            C  +   +C+G+ Y+ TRMPN +G T+Q ++A  + ++ PL+   C  + RFFLC+ Y PMCTD   +  T +P CR MCE+ ++RC P M+ F   WP  L+C + P   +   +C+  P N            G+  +     +        G   +   EN E                    +   KS SC P+C   +  ++S  DK+ A +W  +W+ LC  S+   + TF+ +   RF YPERPIIF+ +CY    +  L       + + C         + +++EG E+  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E   +  H+ +W LPA+ T ++L L K+  DEL G CYV   ++ +   F+L+P     +LGS  L+  F +L  +R+        ++     N + LEK + K G+F  +Y VP TC I C +Y  L++D W           + C    G        L G  +P V V +L+IF +LV+GITSG+W+W +K
Sbjct:   39 CQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTD---QVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLG-PGAGGSGTCENPE------------------KFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPH-RFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACD---QEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRK--------IMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATE-----QPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 532          
BLAST of Fzd-4-2 vs. Ensembl Human
Match: FZD4 (frizzled class receptor 4 [Source:HGNC Symbol;Acc:HGNC:4042])

HSP 1 Score: 275.018 bits (702), Expect = 3.373e-83
Identity = 170/532 (31.95%), Postives = 257/532 (48.31%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRN-LSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKC--DSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWN--KLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            RCD I   +CQ L Y+ T+MPN VG   Q D+  ++  + PLI   CS   +FFLC+ Y PMCT+ +     + PC  MC  V+ RCEP +K F   WP  LNC KFP        P N   D N +     G + +   +           +V TN              D ++ VK         +S +CV KC  D+ + YS S K    IW  +W  LC IS+   + TF+ D   RF YPERPIIF+ +CY    +  +  L + R+R+ C        + +L++EG ++  C + FL MY+F M +++WW++L ++ +LA+  KW  E +E  S+  HI +W +PA+ T ++LI+  +D DEL G CYVG QN  +   F++ P     ++G++ +     +L  +R N+  +              LE+ + K G+F  +Y VP TC I C   Y+  I  W   +     +N+  E +                           IF +L++GITSGMW+W  K
Sbjct:   44 RCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKI--NIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFP--------PQN---DHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNS-------------DQYIWVK---------RSLNCVLKCGYDAGL-YSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSS-RFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDF--EEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDG--------TKTDKLERLMVKIGVFSVLYTVPATCVIAC---YFYEISNWALFRYSADDSNMAVEMLK--------------------------IFMSLLVGITSGMWIWSAK 499          
BLAST of Fzd-4-2 vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 253.832 bits (647), Expect = 7.953e-75
Identity = 158/554 (28.52%), Postives = 265/554 (47.83%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPM---NTEI-CIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIW---YSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKEN 1831
            C +I   +C+G+ Y+ T MPN      Q+++   ++ ++PL+  QCS   RFFLC+ Y P+C  +    K L PCR +CE+ +  C P M+ +   WP  ++C + P+   + E+ C+     D +R+ +  A       + +P   ++    G   +            KC +  V +               VP C    +   +S+ ++  A  W  +W++LC IS+   +ATF+ D + RF YPERPIIF+  CY C+ +  L  L +    + C   H H     +  E     +CT+ FL +Y+F M +++WW++L+++ +LA+  KW  E +   +   H+ +W +P++ +   L L  +D D + G CYVG QN  S   F+L P +L  L+G++ L+  F SL  +R        ++I         LEK + + GIF  +Y VP +  + C LY   + + W       A L   C      +   K            V +L+ F  LV+GITSG+W+W + KT+ +  R+  S   CR +  
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPIC--LPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCM-----DYNRSEATTAP-----PRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDME-RFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHNH-----IHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIR--------SVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWE------AALTCACPGHDTGQPRAKP--------EYWVLMLKYFMCLVVGITSGVWIW-SGKTVESWRRF-TSRCCCRPRRG 544          
BLAST of Fzd-4-2 vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 254.603 bits (649), Expect = 1.860e-74
Identity = 159/560 (28.39%), Postives = 262/560 (46.79%), Query Frame = 2
Query:  182 YNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNT--EICI--------RPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVP-KCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIF-----STLVIGITSGMWMWCNKKTLLNLHRYLVSEIT 1813
            +  C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   +FFLC+ Y P+CT +    + L PCR +CE+ +  CE  M  F  +WP  L C+KFP++   E+C+         PT   L    + N        +      +     G     R     + +N   L              K     C P K    +++   +   +R W  IW++LC  S++  + T++ D + RF YPERPIIF+  CY  + V  +    L+  R+VC       +    + +G +   CT+ F+ +Y+F M +++WW++L+++ +LA+  KW  E +E  S   H+ +W +PAI T  +L L ++D D L G C+VG  N  +   F+L P  +   +G+  L+  F SL  +R  + H+            + LEK + + G+F  +Y VP T  I C  Y     D+W +     + + + C   + +         G P          +F      TL++GITSG W+W  K   LN  R   + +T
Sbjct:  113 HGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL---EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGE------------KDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMR-RFSYPERPIIFLSGCYTAVAVAYIAGFLLE-DRVVCNDKFAE-DGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWER-----SWVAQSC-KSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKT--LNSWRKFYTRLT 638          
BLAST of Fzd-4-2 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 219.55 bits (558), Expect = 8.549e-63
Identity = 132/475 (27.79%), Postives = 232/475 (48.84%), Query Frame = 2
Query:  173 EDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEG-YESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKL 1594
            + V  +C  I+ ++C+ L Y+ T  PN++   +Q         + PL+  +C  +  FF+C+ + PMC   +G  + +  C+ +CE+V+  C   ++ F + WP  LNC +FP   E+C++PT  ++    S             P+  +      + K     +     +L  +D H             KS+ C   C SN+ +S+ +K + R W   +       ++ +  TF  D+K RF +PER + ++ LC     +  L  L +D     C   H   N    +  G +++  C  +FL  Y+F   AALWWLM + + YL+  RKW  EG+E  S+ +H V+W L +++T IVLI +K+D  EL   C VG  NS + L+F+++PR +C ++G+  ++  F S+   R+ I+            +   LEK + K G FC ++ +P    + CQ Y ++ + +W ++
Sbjct:   22 QAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCP--IGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFS------------APRLPTKGSSSSSSKPTGCPS-----DLVDVDPH-----------DPKSH-CAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRK-RFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSC---HALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASM--CRERISFRTRG------TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM 453          
BLAST of Fzd-4-2 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 219.55 bits (558), Expect = 8.549e-63
Identity = 132/475 (27.79%), Postives = 232/475 (48.84%), Query Frame = 2
Query:  173 EDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEG-YESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKL 1594
            + V  +C  I+ ++C+ L Y+ T  PN++   +Q         + PL+  +C  +  FF+C+ + PMC   +G  + +  C+ +CE+V+  C   ++ F + WP  LNC +FP   E+C++PT  ++    S             P+  +      + K     +     +L  +D H             KS+ C   C SN+ +S+ +K + R W   +       ++ +  TF  D+K RF +PER + ++ LC     +  L  L +D     C   H   N    +  G +++  C  +FL  Y+F   AALWWLM + + YL+  RKW  EG+E  S+ +H V+W L +++T IVLI +K+D  EL   C VG  NS + L+F+++PR +C ++G+  ++  F S+   R+ I+            +   LEK + K G FC ++ +P    + CQ Y ++ + +W ++
Sbjct:   22 QAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCP--IGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFS------------APRLPTKGSSSSSSKPTGCPS-----DLVDVDPH-----------DPKSH-CAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRK-RFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSC---HALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASM--CRERISFRTRG------TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM 453          
BLAST of Fzd-4-2 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 219.55 bits (558), Expect = 8.549e-63
Identity = 132/475 (27.79%), Postives = 232/475 (48.84%), Query Frame = 2
Query:  173 EDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEG-YESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKL 1594
            + V  +C  I+ ++C+ L Y+ T  PN++   +Q         + PL+  +C  +  FF+C+ + PMC   +G  + +  C+ +CE+V+  C   ++ F + WP  LNC +FP   E+C++PT  ++    S             P+  +      + K     +     +L  +D H             KS+ C   C SN+ +S+ +K + R W   +       ++ +  TF  D+K RF +PER + ++ LC     +  L  L +D     C   H   N    +  G +++  C  +FL  Y+F   AALWWLM + + YL+  RKW  EG+E  S+ +H V+W L +++T IVLI +K+D  EL   C VG  NS + L+F+++PR +C ++G+  ++  F S+   R+ I+            +   LEK + K G FC ++ +P    + CQ Y ++ + +W ++
Sbjct:   22 QAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCP--IGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFS------------APRLPTKGSSSSSSKPTGCPS-----DLVDVDPH-----------DPKSH-CAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRK-RFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSC---HALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASM--CRERISFRTRG------TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM 453          
BLAST of Fzd-4-2 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 219.55 bits (558), Expect = 1.017e-62
Identity = 132/475 (27.79%), Postives = 232/475 (48.84%), Query Frame = 2
Query:  173 EDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEG-YESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKL 1594
            + V  +C  I+ ++C+ L Y+ T  PN++   +Q         + PL+  +C  +  FF+C+ + PMC   +G  + +  C+ +CE+V+  C   ++ F + WP  LNC +FP   E+C++PT  ++    S             P+  +      + K     +     +L  +D H             KS+ C   C SN+ +S+ +K + R W   +       ++ +  TF  D+K RF +PER + ++ LC     +  L  L +D     C   H   N    +  G +++  C  +FL  Y+F   AALWWLM + + YL+  RKW  EG+E  S+ +H V+W L +++T IVLI +K+D  EL   C VG  NS + L+F+++PR +C ++G+  ++  F S+   R+ I+            +   LEK + K G FC ++ +P    + CQ Y ++ + +W ++
Sbjct:   22 QAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCP--IGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFS------------APRLPTKGSSSSSSKPTGCPS-----DLVDVDPH-----------DPKSH-CAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRK-RFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSC---HALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASM--CRERISFRTRG------TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM 453          
BLAST of Fzd-4-2 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 219.55 bits (558), Expect = 1.017e-62
Identity = 132/475 (27.79%), Postives = 232/475 (48.84%), Query Frame = 2
Query:  173 EDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEG-YESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKL 1594
            + V  +C  I+ ++C+ L Y+ T  PN++   +Q         + PL+  +C  +  FF+C+ + PMC   +G  + +  C+ +CE+V+  C   ++ F + WP  LNC +FP   E+C++PT  ++    S             P+  +      + K     +     +L  +D H             KS+ C   C SN+ +S+ +K + R W   +       ++ +  TF  D+K RF +PER + ++ LC     +  L  L +D     C   H   N    +  G +++  C  +FL  Y+F   AALWWLM + + YL+  RKW  EG+E  S+ +H V+W L +++T IVLI +K+D  EL   C VG  NS + L+F+++PR +C ++G+  ++  F S+   R+ I+            +   LEK + K G FC ++ +P    + CQ Y ++ + +W ++
Sbjct:   22 QAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCP--IGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFS------------APRLPTKGSSSSSSKPTGCPS-----DLVDVDPH-----------DPKSH-CAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRK-RFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSC---HALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASM--CRERISFRTRG------TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM 453          
BLAST of Fzd-4-2 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0330102)

HSP 1 Score: 220.705 bits (561), Expect = 1.223e-62
Identity = 145/587 (24.70%), Postives = 272/587 (46.34%), Query Frame = 2
Query:  182 YNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKC-LDSHVSVKSAVDNRTKSKS-YSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLD-----RKRLVCQILHTHPNDMILMKEGY-ESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEW--NKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYL--VSEITCRNKENPIMNYSIPLKDAHPLSPINPQIESS 1906
            +NRC+ I   IC+ + Y+ T MPN +G T QE++   ++ + PL+   CS   + FLC+ Y P+CT +    + + PCR +CE  ++ CE  MK +   WP  L C KFP++              +L    N            +S+  V        +E+    I   C +     +    + +   K  + C   C + +++   ++ + R W   W  +C+ S +  + TF+ D   RF YPER I+F+ +CY  +    +  LG       R+     +       M  + +G+ ++  CT+ F+ +Y+  M A  WW  LA + +LA+  KW  E +E  S+  H+V+W +PA+ T  VL L K++ D L G C+VG+ ++ S   F+++P  +   +G++ L+  F SL  +R  +  +         +    LE+ + + G F G++ +P    +GC  Y Y + DEW      DI       C        + ++       P+ ++ +++   ++++G+TS +W++ + KT+++   ++  +     R +    + Y          +P+ P  E++
Sbjct:   50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTIL---ERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHG-----------GEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSS-RFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKTDG--------KRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCP-------AARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLY-SSKTMVSWRNFVERLQGKEPRTRAQAYVXYETGPAGGAKSTPLTPDPEAA 603          
BLAST of Fzd-4-2 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0075743)

HSP 1 Score: 219.55 bits (558), Expect = 1.947e-62
Identity = 130/476 (27.31%), Postives = 227/476 (47.69%), Query Frame = 2
Query:  182 YNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKC-LDSHVSVKSAVDNRTKSKS-YSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLD-----RKRLVCQILHTHPNDMILMKEGY-ESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEW 1585
            +NRC+ I   IC+ + Y+ T MPN +G T QE++   ++ + PL+   CS   + FLC+ Y P+CT +    + + PCR +CE  ++ CE  MK +   WP  L C KFP++              +L    N            +S+  V        +E+    I   C +     +    + +   K  + C   C + +++   ++ + R W   W  +C+ S +  + TF+ D   RF YPER I+F+ +CY  +    +  LG       R+     +       M  + +G+ ++  CT+ F+ +Y+  M A  WW  LA + +LA+  KW  E +E  S+  H+V+W +PA+ T  VL L K++ D L G C+VG+ ++ S   F+++P  +   +G++ L+  F SL  +R  +  +         +    LE+ + + G F G++ +P    +GC  Y Y + DEW
Sbjct:   50 HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTIL---ERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHG-----------GEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHA-MFFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSS-RFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISLFRIRTVMKTDG--------KRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFDEW 500          
BLAST of Fzd-4-2 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071017)

HSP 1 Score: 183.726 bits (465), Expect = 7.119e-49
Identity = 132/508 (25.98%), Postives = 218/508 (42.91%), Query Frame = 2
Query:  179 VYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKC---LDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPE--RPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASER-------------------------KWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSF----RSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGD 1600
             + +C+ I  ++C+ + Y++T MPN VG   Q D    +  + PLI   CS   + FLC  Y PMCT        + PCR +CE V+IRC P ++ F   WP  L+C KFP       R  N++    +     G    + H P+ +   Y  G            ++ + C     SH+ V+     R       C P C+++I ++ ++K+LA IW   W    L  ++VA    +     R    +  R +  ++ C+  + +       + R    C      PN+ +L  +G  +  C   FL  YYF M A  WW +L +  +    R                         K + + L + +N +  V+W LPA  T+ V++   +D DELLG+C+VG Q+ ++    +  P    ++ GS+ LI  +    R+  +LR +   N L++     Q        I   GIF  +YG+     +   +Y + +ID W   GD
Sbjct:   42 AFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPK-APVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFP-------RENNHE---TMCMEGPG----ELHQPQQEQDLY--GLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGR-------CAPLCEADILFTPAEKHLAEIWVSTWAYAALGLALVATVCLLASDGSRLASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTACGTDPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQ-NNFVCFVAWGLPAFQTSAVIVARFVDADELLGACFVGNQSDKALQILVATPVFCYWIFGSMNLISGYLVHCRTKEILRNS---NALSVQQQLQQLSAHSSSGI---GIFLFIYGLACAMLLLAVIYEFANIDVWLGSGD 518          
BLAST of Fzd-4-2 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071018)

HSP 1 Score: 183.726 bits (465), Expect = 7.119e-49
Identity = 132/508 (25.98%), Postives = 218/508 (42.91%), Query Frame = 2
Query:  179 VYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKC---LDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPE--RPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASER-------------------------KWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSF----RSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGD 1600
             + +C+ I  ++C+ + Y++T MPN VG   Q D    +  + PLI   CS   + FLC  Y PMCT        + PCR +CE V+IRC P ++ F   WP  L+C KFP       R  N++    +     G    + H P+ +   Y  G            ++ + C     SH+ V+     R       C P C+++I ++ ++K+LA IW   W    L  ++VA    +     R    +  R +  ++ C+  + +       + R    C      PN+ +L  +G  +  C   FL  YYF M A  WW +L +  +    R                         K + + L + +N +  V+W LPA  T+ V++   +D DELLG+C+VG Q+ ++    +  P    ++ GS+ LI  +    R+  +LR +   N L++     Q        I   GIF  +YG+     +   +Y + +ID W   GD
Sbjct:   42 AFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPK-APVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFP-------RENNHE---TMCMEGPG----ELHQPQQEQDLY--GLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGR-------CAPLCEADILFTPAEKHLAEIWVSTWAYAALGLALVATVCLLASDGSRLASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTACGTDPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQ-NNFVCFVAWGLPAFQTSAVIVARFVDADELLGACFVGNQSDKALQILVATPVFCYWIFGSMNLISGYLVHCRTKEILRNS---NALSVQQQLQQLSAHSSSGI---GIFLFIYGLACAMLLLAVIYEFANIDVWLGSGD 518          
BLAST of Fzd-4-2 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 178.333 bits (451), Expect = 4.679e-47
Identity = 112/349 (32.09%), Postives = 179/349 (51.29%), Query Frame = 2
Query:  761 VPKCD---SNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESP-MCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRY 1795
            VP C       ++S+ +K+ A +W  +W+ LC  S+++ + TF+ D + RF YPERPI+F+  CY  + V  L    L  + + C        D +L++E    P  CTL FL  Y+F M +++WW++L+ + +LA+  KW  E + + S   H+ +W +P + +  VL+L  +D D +LG CYVG  N      F+L P  +  ++G+  L+  F SL  +R  I   K    + +      LEK + + GIF  +Y VP T  IGC LY   + ++W K       L   C     ++   K  L         V +L+ F  L +GITSG+W+W + KTL +  R+
Sbjct:  297 VPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTE-RFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC--------DGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVI---KQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIK------ALACPCAQ---VKGPGKKPL-------YSVLMLKYFMALAVGITSGVWIW-SGKTLESWRRF 616          

HSP 2 Score: 87.4261 bits (215), Expect = 1.758e-17
Identity = 37/128 (28.91%), Postives = 72/128 (56.25%), Query Frame = 2
Query:  173 EDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNY 547
            +D   RC++I   +C+G+ Y+ T  PN +    Q+++   ++ ++PL+  +CS   +FFLC+ Y P+C +     K L  CR +CE+ +  C P M+ +  +WP  + C+  P++ +   +C+   +Y
Sbjct:   58 KDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLE--DYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSY 183          
BLAST of Fzd-4-2 vs. Ensembl Zebrafish
Match: BX322606.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_52:56018527:56021879:1 gene:ENSDARG00000102815.2 transcript:ENSDART00000169635.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX322606.1)

HSP 1 Score: 306.22 bits (783), Expect = 1.196e-94
Identity = 180/592 (30.41%), Postives = 298/592 (50.34%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMW-----------CNKKTLLNLHRYLVSEITCRNK----ENPIMNYSIPLKDAHPLSPIN 1888
             +C+ I   +CQG+ Y+ TRMPN +   +QE+++ ++N++ PL+   C  + +FFLC+ Y PMC + +  + ++  CR MCE+ + RC P M+ F   WP  L+C K P N +   +CI     D           L       P+ +    V G +                     S+  + +N  K     KS SC P+C    ++++S  DK+ A IW  +W+ LC +S+   + TF+ D + RF YPERPIIF+ +CY    V  +       + + C        ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ RKW  E +E  S+  H+ +W +PA+ T ++L + K+  DEL G CYVG  +S +   F+LIP     ++G+  ++  F +L  +R+        ++     N + LEK + K G+F  +Y VP T  I C  Y  L+++ W         L  +CV+  G R  D  C     +P V V +L+IF +LV+GITSG+W+W           CN++  +       S ++C N     + P +   +   DA+  SP +
Sbjct:   47 GKCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQV--SASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVP----PRSRQPTTVSGRIS--------------------SISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQ-RFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACD---RENGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRK--------IMKTGGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWKFRA-----LENKCVSFPGRRSDD--CSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCNRRLGVQTSHKPCSSVSCSNSHCHYKAPAVTVHMNKTDAYTDSPTH 593          
BLAST of Fzd-4-2 vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 303.138 bits (775), Expect = 1.350e-93
Identity = 177/570 (31.05%), Postives = 293/570 (51.40%), Query Frame = 2
Query:  110 LFCFLKLH-KLSAILFKSNNAHEDVYN-------RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            +FCF+ +   L  I+  ++      Y+       +C+ I   +CQG+ Y+ TRMPN +   +QE+++ ++N++ PL+   C  + +FFLC+ Y PMC + +  + ++  CR MCE+ + RC P M+ F   WP  L+C K P N +   +CI     D           L       P+ +    V G +                     S+  + +N  K     KS SC P+C    ++++S  DK+ A IW  +W+ LC +S+   + TF+ D + RF YPERPIIF+ +CY    V  +       + + C        ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ RKW  E +E  S+  H+ +W +PA+ T ++L + K+  DEL G CYVG  +S +   F+LIP     ++G+  ++  F +L  +R+        ++     N + LEK + K G+F  +Y VP T  I C  Y  L+++ W         L  +CV+  G R  D  C     +P V V +L+IF +LV+GITSG+W+W +K
Sbjct:    2 IFCFIFIGIGLFQIMIAASTLEIGAYDLEHGRPGKCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQV--SASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVP----PRSRQPTTVSGRIS--------------------SISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQ-RFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACD---RENGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRK--------IMKTGGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWKFRA-----LENKCVSFPGRRSDD--CSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 526          
BLAST of Fzd-4-2 vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 302.753 bits (774), Expect = 1.881e-93
Identity = 171/537 (31.84%), Postives = 280/537 (52.14%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
             +C+ I   +CQG+ Y+ TRMPN +   +QE+++ ++N++ PL+   C  + +FFLC+ Y PMC + +  + ++  CR MCE+ + RC P M+ F   WP  L+C K P N +   +CI     D           L       P+ +    V G +                     S+  + +N  K     KS SC P+C    ++++S  DK+ A IW  +W+ LC +S+   + TF+ D + RF YPERPIIF+ +CY    V  +       + + C        ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ RKW  E +E  S+  H+ +W +PA+ T ++L + K+  DEL G CYVG  +S +   F+LIP     ++G+  ++  F +L  +R+        ++     N + LEK + K G+F  +Y VP T  I C  Y  L+++ W         L  +CV+  G R  D  C     +P V V +L+IF +LV+GITSG+W+W +K
Sbjct:   34 GKCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQV--SASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVP----PRSRQPTTVSGRIS--------------------SISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQ-RFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACD---RENGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRK--------IMKTGGTNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWKFRA-----LENKCVSFPGRRSDD--CSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 525          
BLAST of Fzd-4-2 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 299.671 bits (766), Expect = 2.983e-92
Identity = 173/552 (31.34%), Postives = 287/552 (51.99%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK--KTLLNLHRYLVSEITCRN 1822
            +C+ I   +CQG+ Y+ TRMPN +   NQ ++A ++N++ PL+   C  + RFFLC+ Y PMCTD +  + ++  CR MCE+ + +C P M+ F   WP  LNC K P   +   +C+     D               K    K + +  V    +     N  +   +   ++    +         KS +C P+C S  ++++S  DK+ A IW  +W+ LC +S+   + TF+ D   RF YPERPIIF+ +CY    V  +       + + C        ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L + K+  DEL G CYVG  +  +   F+L+P     ++G+  ++  F +L  +R+        ++     N + LEK + K GI+  +Y VP TC I C  Y  L++D W   G     L  +C    G R  ++ C     +P V V +L+IF +LV+GITSG+W+W +K  +T   L    +++ TCR 
Sbjct:   37 KCEPIVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQV--STSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDT--------------KTETKKGEGMLPVPPRPRQPGAGNARSGGTMGVCENPEKFQYV------EKSETCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPH-RFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACD---RENGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVALFHIRK--------VMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIICYFYERLNMDYWKFRG-----LQSKCTTFPGRR--NEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLTDRTCRK 547          
BLAST of Fzd-4-2 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 299.671 bits (766), Expect = 2.983e-92
Identity = 173/552 (31.34%), Postives = 287/552 (51.99%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK--KTLLNLHRYLVSEITCRN 1822
            +C+ I   +CQG+ Y+ TRMPN +   NQ ++A ++N++ PL+   C  + RFFLC+ Y PMCTD +  + ++  CR MCE+ + +C P M+ F   WP  LNC K P   +   +C+     D               K    K + +  V    +     N  +   +   ++    +         KS +C P+C S  ++++S  DK+ A IW  +W+ LC +S+   + TF+ D   RF YPERPIIF+ +CY    V  +       + + C        ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L + K+  DEL G CYVG  +  +   F+L+P     ++G+  ++  F +L  +R+        ++     N + LEK + K GI+  +Y VP TC I C  Y  L++D W   G     L  +C    G R  ++ C     +P V V +L+IF +LV+GITSG+W+W +K  +T   L    +++ TCR 
Sbjct:   37 KCEPIVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQV--STSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDT--------------KTETKKGEGMLPVPPRPRQPGAGNARSGGTMGVCENPEKFQYV------EKSETCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPH-RFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACD---RENGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVALFHIRK--------VMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIICYFYERLNMDYWKFRG-----LQSKCTTFPGRR--NEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLTDRTCRK 547          
BLAST of Fzd-4-2 vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 292.352 bits (747), Expect = 2.049e-89
Identity = 175/563 (31.08%), Postives = 281/563 (49.91%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKC--DSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTL-----LNLHRYLVSEITCRNKENP 1834
            +C+ I   +CQG+ Y+ TRMPN VG  +QE++A ++ ++ PL+   C  + RFFLC+ Y PMCT+ +  + ++  C+ MCE  + +C P M++F+  WP  L+C + P   +   +C+       + +   N +G+  +    P+                             S + + S   N  K     +S  C P+C    ++++SS DK+ A +W   W+ LC IS+   + TF+   + RF YPE+PIIF+ +CY       L         + C      P    L++EG ES  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E   +  H+ +W +PAI T I+L + K+  DEL G CYVG  +  +   F+L+P     + G+  L+  F +L  +R+        ++     N + LEK + K G+F  +Y VP TC I C  Y  L++  W+          E C    G    D  C     +P V V +L+IF +L +GITSG+W+W + KTL     +   R LV E+  R +  P
Sbjct:   27 KCEPIQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQV--STSIPACKPMCEAARQKCAPIMESFQYVWPESLDCDRLPSKNDPHALCMEAPENATNGDPPTNGHGMLPVAPRPPRPSG--------------------------SGIGISSRCANPDKFMYVERSGVCAPRCIPGVDVYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQ-RFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDREGGAP---YLIREGLESSGCTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRR--------VMKTGGTNTEKLEKLMVKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAR-----EESCRTVPGSARPD--CNLPHSIPSVAVFMLKIFMSLAVGITSGVWVW-SSKTLQAWQGILCQRRLV-EVGARTRGKP 540          
BLAST of Fzd-4-2 vs. Ensembl Xenopus
Match: FZD4 (frizzled class receptor 4 [Source:NCBI gene;Acc:100497693])

HSP 1 Score: 283.108 bits (723), Expect = 1.745e-86
Identity = 175/532 (32.89%), Postives = 257/532 (48.31%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRN-LSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKC--DSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIA--ANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            RCD I   +CQ L Y+ T+MPN VG   Q D+  ++  + PLI   CS   +FFLC+ Y PMCT+ +     + PC  MC  V+ RCEP +K F   WP  LNC KFP        P N   D N +     G D +  H              KT  L   +        D +  VK         +S +CV KC  DS + YS   K    IW  +W  LC IS+   + TF+ D   RF YPERPIIF+ +CY    +  +  L + R+R+ C        + +L++EG ++  C + FL MY+F M +++WW++L ++ +LA+  KW  E +E  S+  HI +W +PA+ T ++LI+  +D DEL G CYVG QN  +   F++ P     ++G++ +     +L  +R N+  +              LE+ + K G+F  +Y VP TC I C   Y+  I  WN     A  +N+  E +N                          IF +L++GITSGMW+W  K
Sbjct:   30 RCDPIRISMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKI--NIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFP--------PQN---DHNHMCMEGPGDDEVPVHS-------------KTPVLPGEDCNSFGPNSDQYTWVK---------RSMNCVLKCGYDSGL-YSRLSKEFTDIWMAVWASLCFISTAFTVLTFLIDSS-RFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDF--EEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDG--------TKTDKLERLMVKIGVFSVLYTVPATCVIAC---YFYEISNWNVFRYTADDSNMAVEMLN--------------------------IFMSLLVGITSGMWIWSAK 485          
BLAST of Fzd-4-2 vs. Ensembl Xenopus
Match: bdh2 (3-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-985755])

HSP 1 Score: 254.218 bits (648), Expect = 2.743e-75
Identity = 166/573 (28.97%), Postives = 274/573 (47.82%), Query Frame = 2
Query:  107 VLFCFLKLHKLSAILFKSNNA-HEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNT--EICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNR---TKSKSYSCVP-KCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNK--LGDIAANLGEECVN-KFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRY 1795
            +LFC L     SA  +          +  C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   RFFLC+ Y P+CT +    + + PCR +CE+ +  CE  M  F  +WP  L C+ FP++   EIC+        +N S N+          P  +   Y+  ++  +   N     +  C    + V   +  R    K     C P K +  +++   +   AR+W  IW ILC IS++  + T++ D + RF YPERPIIF+  CY  + V       L+ +R VC +     +    + +G +   CT+ F+ +Y+F M +++WW++L+++ +LA+  KW  E +E  S   H+ +W +PA+ T  +L + ++D D L G CYVG  +  S   F+L P  +   +G+  L+  F SL  +R  + H+            + LEK + + G+F  +Y VP T  + C  Y     D W K  L          C N  F     D +             +++   T+++GITS  W+W + KTL +  R+
Sbjct:    7 LLFCLLLQPSPSAQQYHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVL---EQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICV-------GQNTSDNS-------PSGPTARPTPYLPDSITFHPHPN----RDFTC-PRQLKVPPYLGYRFLGEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCGISTLFTVLTYLVDMR-RFSYPERPIIFLSGCYFMVAVAYTAGFLLE-ERGVC-VERFSEDSYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSPDFTVF-----------MIKYLMTMIVGITSSFWIW-SGKTLQSWRRF 534          
BLAST of Fzd-4-2 vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 251.136 bits (640), Expect = 4.037e-74
Identity = 153/531 (28.81%), Postives = 259/531 (48.78%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMN--TEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVP-KCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNK--LGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   RFFLC+ Y P+CT +    + + PCR +CE+ +  CE  M  F  +WP  L C+ FP +   +IC+   N+  D   +       +     P   +   +D      R+    + +N + L              K  +  C P K D  +++S  +   AR+W  IW++LC  S+   + T++ D + RF YPERPIIF+  CY  + V  +    L  K +VC    +      ++ +G +   CT+ F+ +Y+F M +++WW++L+++ +LA+  KW  E +E  S   H+ +W +PA+ T  +L + +ID D L G C+VG  N      F+L P  +   +G+  L+  F SL  +R  + H+            + LE+ + + G+F  +Y VP T  I C  Y     + W +  +     +L   C  ++  R +              V +++   TL++GITSG W+W  K
Sbjct:   40 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVCTVL---EQAIPPCRSICERARHGCEALMNKFGFQWPERLRCENFPRHGAEQICVG-QNHSEDGGPTLLTTSPPHHGTPGPPIYAT--LDHPFHCPRVLKVPSYLNYRFLGE------------KDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQ-RFRYPERPIIFLSGCYTMVSVAYIAGFVLGDK-VVCNENFSEDGYKTVV-QGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQNCKSLAIPCPLQYTPRMTPD----------FTVYMIKYLMTLIVGITSGFWIWSGK 531          
BLAST of Fzd-4-2 vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 247.284 bits (630), Expect = 1.311e-72
Identity = 156/554 (28.16%), Postives = 261/554 (47.11%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEIN--LKCLDSHVSV---KSAVDNRTKSKSYSCVPKCDS---NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKE 1828
            C +I   +C+G+ Y+ T MPN      Q+++   ++ ++PL+  QCS   +FFLC+ Y P+C  +    K L PCR +CE+ +  C P M+ +   WP  +NC + P + +    P    +D N                 W             +++   ++ +   KC +  +S+      + NR K+     VP C       +++  +K  A  W  +W+ILC IS+   +ATF+ D + RF YPERPIIF+  CY  + +  +  L +  + + C   H H        E     +CT+ FL +Y+F M +++WW++L  + +LA+  KW  E +   S   H+ +W +P++ +  VL L  +D D + G C+VG QN  +   F+L P ++    G++ L+  F SL  +R  I                 LEK + + GIF  +Y VP T  + C +Y   + + W K  + +                DK   +    P   V +L+ F  LV+GITSG+W+W + KTL +  R+  +   CRN +
Sbjct:   33 CQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPIC--LPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGD----PDTLCMDYN-----------------WTETTTTPPPTHPPKVKTPSSDCDGVCKCREPFLSITRESHPLYNRIKTGQ---VPNCAMPCFQPYFTQDEKTFATFWIGLWSILCFISTFTTVATFLIDME-RFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVACNKDHIH-------YETTGPALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSLFRIRSVIKQGG--------TKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKAHNCSCP-------------GDKKRYR----PDYAVFMLKYFMCLVVGITSGVWIW-SGKTLESWKRF--TGRCCRNSK 524          
BLAST of Fzd-4-2 vs. Ensembl Mouse
Match: Fzd10 (frizzled class receptor 10 [Source:MGI Symbol;Acc:MGI:2136761])

HSP 1 Score: 299.286 bits (765), Expect = 4.274e-92
Identity = 178/579 (30.74%), Postives = 294/579 (50.78%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENP---IMNYSIPLKDAHPLSP 1882
             +C  +   +C+ + Y+ TRMPN +G  NQ ++A +++++ PL+   C  + RFFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ FK +WP  L+C K P   +   +C+   N           NG D   +    +  +F      +  R  + +       L      ++  DN  K     KS SC P C    ++++S  DK  A +W  IW++LC  SS   + TF+ D   RF YPERPIIF+ +CY    V  +  L    + + C         + +++EG ES  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+L+P     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L         +C  K   +     CL    +P VEV ++++   LV+GITSG+W+W   KTL +        +  +++  P   + +  I  K  HP  P
Sbjct:   33 GKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPN-----------NGSDEPSRGSGMFPPLF------RPQRPHSAQEHP----LKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPS-RFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACD---RDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLAT-----QHKC--KMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVW-TSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQKP 567          
BLAST of Fzd-4-2 vs. Ensembl Mouse
Match: Fzd9 (frizzled class receptor 9 [Source:MGI Symbol;Acc:MGI:1313278])

HSP 1 Score: 285.034 bits (728), Expect = 1.355e-86
Identity = 166/530 (31.32%), Postives = 269/530 (50.75%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNI--WYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSC-LKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            C  +   +C+G+ Y+ TRMPN +G T+Q ++A ++ ++ PL+   C  + RFFLC+ Y PMCTD   +  T +P CR MCE+ ++RC P M+ F   WP  L+C + P   +    P    ++   +  A   +  K             G +            +     S  +  +    +   KS SC P+C   +  ++S  DK+ A +W  +W+ LC  S+   + TF+ +   RF YPERPIIF+ +CY    +  L       + + C         + +++EG E+  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E   +  H+ +W LPA+ T +VL L K+  DEL G CYV   +  +   F+L+P     +LG+  L+  F +L  +R+        ++     N + LEK + K G+F  +Y VP TC I C +Y  L++D W           E+      +    + C L G  +P V V +L+IF +LV+GITSG+W+W +K
Sbjct:   40 CQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTD---QVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRND----PHALCMEAPENATAGPTEPHKGL-----------GMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPH-RFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACD---QEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRK--------IMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRAT------EQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 533          
BLAST of Fzd-4-2 vs. Ensembl Mouse
Match: Fzd4 (frizzled class receptor 4 [Source:MGI Symbol;Acc:MGI:108520])

HSP 1 Score: 273.478 bits (698), Expect = 7.635e-83
Identity = 169/532 (31.77%), Postives = 256/532 (48.12%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRN-LSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKC--DSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWN--KLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            RCD I   +CQ L Y+ T+MPN VG   Q D+  ++  + PLI   CS   +FFLC+ Y PMCT+ +     + PC  MC  V+ RCEP ++ F   WP  LNC KFP        P N   D N +     G + +   +             KT      E        D ++ VK         +S +CV KC  D+ + YS S K    IW  +W  LC IS+   + TF+ D   RF YPERPIIF+ +CY    +  +  L + R+R+ C        + +L++EG ++  C + FL MY+F M +++WW++L ++ +LA+  KW  E +E  S+  HI +W +PA+ T ++LI+  +D DEL G CYVG QN  +   F++ P     ++G++ +     +L  +R N+  +              LE+ + K G+F  +Y VP TC I C   Y+  I  W   +     +N+  E +                           IF +L++GITSGMW+W  K
Sbjct:   44 RCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKI--NIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFP--------PQN---DHNHMCMEGPGDEEVPLPH-------------KTPIQPGEECHSVGSNSDQYIWVK---------RSLNCVLKCGYDAGL-YSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSS-RFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDF--EEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDG--------TKTDKLERLMVKIGVFSVLYTVPATCVIAC---YFYEISNWALFRYSADDSNMAVEMLK--------------------------IFMSLLVGITSGMWIWSAK 499          
BLAST of Fzd-4-2 vs. Ensembl Mouse
Match: Fzd2 (frizzled class receptor 2 [Source:MGI Symbol;Acc:MGI:1888513])

HSP 1 Score: 253.062 bits (645), Expect = 8.725e-75
Identity = 160/558 (28.67%), Postives = 273/558 (48.92%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMN--TEICIRPTNYDLDRNLSF----NANGLDYLKKHYPKWKSIFYVDGNVKTNRLEN-FETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNK--LGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPI 1837
            C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   RFFLC+ Y P+CT +    + + PCR +CE+ +  CE  M  F  +WP  L C+ FP +   +IC+   N+  D   +       +GL       P             T  LE+ F     LK + S++S K   +    +      P  D ++++S  +   AR+W   W++LC  S+   + T++ D + RF YPERPIIF+  CY  + V  +    L ++R+VC    +      ++ +G +   CT+ F+ +Y+F M +++WW++L+++ +LA+  KW  E +E  S   H+ +W +PA+ T  +L + +ID D L G C+VG  +      F+L P  +   +G+  L+  F SL  +R  + H+            + LE+ + + G+F  +Y VP T  I C  Y     + W +  +     +L   C   +  R S              V +++   TL++GITSG W+W + KTL +  ++       R+ E  +
Sbjct:   44 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVL---EQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVG-QNHSEDGAPALLTTAPPSGLQPGAGGTPGGPGGGGSPPRYAT--LEHPFHCPRVLK-VPSYLSYKFLGERDCAAPCEPARP--DGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQ-RFRYPERPIIFLSGCYTMVSVAYIAGFVL-QERVVCNERFSEDGYRTVV-QGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPD----------FTVYMIKYLMTLIVGITSGFWIW-SGKTLHSWRKFYTRLTNSRHGETTV 570          
BLAST of Fzd-4-2 vs. Ensembl Mouse
Match: Fzd1 (frizzled class receptor 1 [Source:MGI Symbol;Acc:MGI:1196625])

HSP 1 Score: 253.062 bits (645), Expect = 3.944e-74
Identity = 159/555 (28.65%), Postives = 263/555 (47.39%), Query Frame = 2
Query:  182 YNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNT--EICI--------RPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVP-KCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEIT 1813
            +  C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   +FFLC+ Y P+CT +    + L PCR +CE+ +  CE  M  F  +WP  L C+KFP++   E+C+         PT   L    + N        +      +     G     R     + +N   L              K     C P K    +++   +   +R W  IW++LC  S++  + T++ D + RF YPERPIIF+  CY  + V  +    L+  R+VC       +    + +G +   CT+ F+ +Y+F M +++WW++L+++ +LA+  KW  E +E  S   H+ +W +PAI T  +L L ++D D L G C+VG  N  +   F+L P  +   +G+  L+  F SL  +R  + H+            + LEK + + G+F  +Y VP T  I C  Y     D+W +   +A +     +    L+            P   V +++   TL++GITSG W+W  K   LN  R   + +T
Sbjct:  108 HGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL---EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGE------------KDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMR-RFSYPERPIIFLSGCYTAVAVAYIAGFLLE-DRVVCNDKFAE-DGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWER-SWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKT--LNSWRKFYTRLT 633          
BLAST of Fzd-4-2 vs. UniProt/SwissProt
Match: sp|Q9DEB5|FZ10A_XENLA (Frizzled-10-A OS=Xenopus laevis OX=8355 GN=fzd10-a PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 3.515e-95
Identity = 190/593 (32.04%), Postives = 303/593 (51.10%), Query Frame = 2
Query:  158 SNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENP---IMNYSIPLKDAHPLSPINPQIESSI 1909
            S N       RC  I   +C+ + Y+ TRMPN +G  NQ+++A +++++ PL+   C  + +FFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ F  KWP  L+C K P   +   +C+   N           NG D   +       IF      +  R  +   EI  K   S  S +++       KS SC P C S  ++++S  DK  A IW  IW+ILC  SS   + TF+ D  +RF YPERPIIF+ +CY    V  +  L      + C         + +++EG ES  CT+ FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+LIP     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L        ++C  K   +     C     +P VE+ +++IF  LV+GITSGMW+W   KT+ +        +  RN+  P   I +  I  K  HP    + + ES++
Sbjct:   29 SINPDRSGDGRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPN-----------NGTDETPRGSSMLPPIF------RPQRPSSGH-EIYPKDPTSRSSCENSGKFHHVEKSASCAPLCSSSVDVYWSKDDKKFAFIWIAIWSILCFFSSAFTVLTFLVD-PLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACD---RDSGQLYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILAT-----QDKC--KMDSQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQSWQNVFSKRLKKRNRSKPASVITSAGIYKKPQHPPKVHHGKYESAL 580          
BLAST of Fzd-4-2 vs. UniProt/SwissProt
Match: sp|Q9W742|FZ10B_XENLA (Frizzled-10-B OS=Xenopus laevis OX=8355 GN=fzd10-b PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.003e-93
Identity = 180/565 (31.86%), Postives = 290/565 (51.33%), Query Frame = 2
Query:  158 SNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENP 1834
            S N       RC  I   +C+ + Y+ TRMPN +G  NQ+++A +++++ PL+   C  + +FFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ F  KWP  L+C K P   +   +C+   N           NG D   +       IF         +  N   E+  K      S +++       KS SC P C S  ++++S +DK  A IW  IW++LC  SS   + TF+ D  +RF YPERPIIF+ +CY    V  +  L      + C         + +++EG ES  CT+ FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+LIP     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L        ++C  K   +     C     +P VE+ +++IF  LV+GITSGMW+W   KT+ +        +  RN+  P
Sbjct:   23 SINPDRSGEGRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPN-----------NGTDEAPRSSSILPPIF-------RPQRPNSGHEMYPKDPKGRSSCENSGKFHHVEKSASCAPLCSSSVDVYWSKNDKKFAFIWIAIWSLLCFFSSAFTVLTFLVD-PLRFKYPERPIIFLSMCYCVYSVGYIIRLFAGADSIACD---RDSGQLYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDFWKILAT-----QDKC--KMDSQTKTLDCTMTSSIPAVEIFMVKIFMLLVVGITSGMWIW-TSKTVQSWQNVFSKSLKKRNRNKP 546          
BLAST of Fzd-4-2 vs. UniProt/SwissProt
Match: sp|Q9ULW2|FZD10_HUMAN (Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 7.416e-92
Identity = 177/538 (32.90%), Postives = 281/538 (52.23%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
             +C  I   +C+ + Y+ TRMPN +G  NQ ++A +++++ PL+   C  + RFFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ F  KWP  L+C+K P   +   +C+   N           NG D   +    +  +F      +  R  + +       L      +   DN  K     KS SC P C    ++++S  DK  A +W  IW +LC  SS   + TF+ D   RF YPERPIIF+ +CY    V  L  L    + + C         + +++EG ES  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+LIP     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L   AA    +C  K   +     CL    +P VE+ +++IF  LV+GITSGMW+W +K
Sbjct:   32 GKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPN-----------NGSDEPTRGSGLFPPLF------RPQRPHSAQEHP----LKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLID-PARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACD---RDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKIL---AAQ--HKC--KMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSK 526          
BLAST of Fzd-4-2 vs. UniProt/SwissProt
Match: sp|Q9PWH2|FZD10_CHICK (Frizzled-10 OS=Gallus gallus OX=9031 GN=FZD10 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 7.730e-92
Identity = 171/534 (32.02%), Postives = 281/534 (52.62%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
             RC  I   +C+ + Y+ TRMPN +G  NQ ++A +++++ PL+   C  + +FFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ F  KWP  L+C K P   +   +C+   N           NG D   +       +F        + L+  +  +      S  S ++        KS SC P C    ++++S  DK  A IW  IW+ILC  SS   + TF+ D + RF YPERPIIF+ +CY    V  +  L    + + C         + +++EG ES  CT+ FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+LIP     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  +        ++C  K   +  +  C+    +P VE+ +++IF  LV+GITSGMW+W +K
Sbjct:   36 GRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPN-----------NGSDEPPRGSSMLPPMFRPQRPSTGHDLQQHKDSL------SRTSCENPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQ-RFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACD---RDSGQLYVIQEGLESTGCTIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVAS-----QQKC--KMNNQTKNLDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSK 530          
BLAST of Fzd-4-2 vs. UniProt/SwissProt
Match: sp|Q8BKG4|FZD10_MOUSE (Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.989e-91
Identity = 178/579 (30.74%), Postives = 294/579 (50.78%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTK----SKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENP---IMNYSIPLKDAHPLSP 1882
             +C  +   +C+ + Y+ TRMPN +G  NQ ++A +++++ PL+   C  + RFFLC+ Y PMCT+   +  T +P CR MCE+ +++C P M+ FK +WP  L+C K P   +   +C+   N           NG D   +    +  +F      +  R  + +       L      ++  DN  K     KS SC P C    ++++S  DK  A +W  IW++LC  SS   + TF+ D   RF YPERPIIF+ +CY    V  +  L    + + C         + +++EG ES  CTL FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ ++  DEL G CYVG  +  +   F+L+P     ++G+  ++  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L         +C  K   +     CL    +P VEV ++++   LV+GITSG+W+W   KTL +        +  +++  P   + +  I  K  HP  P
Sbjct:   33 GKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTE---QVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPN-----------NGSDEPSRGSGMFPPLF------RPQRPHSAQEHP----LKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPS-RFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACD---RDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRR--------VMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLAT-----QHKC--KMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVW-TSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQKP 567          
BLAST of Fzd-4-2 vs. TrEMBL
Match: T1DF47 (Fzd-4-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 635/636 (99.84%), Postives = 635/636 (99.84%), Query Frame = 2
Query:   98 GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV 2005
            GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPI NYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV
Sbjct:    7 GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPITNYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV 642          
BLAST of Fzd-4-2 vs. TrEMBL
Match: A0A1S6KMG7 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 385/385 (100.00%), Postives = 385/385 (100.00%), Query Frame = 2
Query:   98 GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIV 1252
            GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIV
Sbjct:    7 GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIV 391          
BLAST of Fzd-4-2 vs. TrEMBL
Match: T1DBN2 (Fzd-4-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 320/587 (54.51%), Postives = 420/587 (71.55%), Query Frame = 2
Query:  152 FKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLS-FNANGLDYLKKHYPKWKSIFY---VDGNVKTNRLENFE-TEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCR--NKENPIMNYSIPLKDAHPLSPINP 1891
             + N  +ED+YN+C  I    CQG+QY KT+MPN  GITNQEDSAKR++DY PLINA+CS YFRFFLCT YFPMC+D LG    + PC+++C   + RCEP+++AF+L WP ELNC++FP N+ +CI P NYDLD +L  FN   +D++KK YP+W    +   VD  +   R +  E  E  +KC    VS    +    +S  +SCV +CD+N+ Y+SSDK LA++W  +W +  LISSIVAIATF+FD+K RF YPERPI+FIV+CYGC+CVF+L  L L ++R++CQ L+++P ++++M+E  E P+CTL FLG YYFE VA LWWLMLA+SC+LAS RKWS E LE ISN MH++SW +PA+  TI+LI+HKID DEL+G C+VGR N+ SNL FIL+PRI  F +G +LL+ SFRSL+++R+++    L L LD  QNQQSL+KFI KTGIFCGVYG+PM CYIGCQ+Y YL+ID WN +G     +   C++K GLRW+D SC   L LPL+EVRLLE FS+LVIGITS MWMWCNKKT +   +  + ++ CR  +K N  M   IP K       I P
Sbjct:   21 LQGNRVNEDLYNQCVIIKDPACQGIQYTKTKMPNLAGITNQEDSAKRLHDYHPLINAECSNYFRFFLCTVYFPMCSDALGSPSIVYPCKQLCLYAESRCEPYLRAFQLPWPNELNCQRFPTNSTMCIEPKNYDLDLHLRRFNPGDIDHIKKLYPQWNISLHSSIVDARLIKGRKDIVEMVETTVKCSPPFVSRPYYLHISNQSTKFSCVLRCDANLLYNSSDKYLAKVWLLVWALSGLISSIVAIATFLFDRKSRFKYPERPIVFIVICYGCVCVFHLIQLMLGKERMICQPLYSNPKELVIMRESAEGPLCTLMFLGSYYFETVATLWWLMLAVSCFLASSRKWSAEALEGISNIMHMISWMIPALKVTIILIIHKIDSDELMGMCFVGRHNALSNLLFILLPRITYFFIGVMLLLWSFRSLVLIRKDLTQPGLVLFLDGFQNQQSLDKFIVKTGIFCGVYGIPMICYIGCQIYNYLNIDNWNNIGKTLLPIESRCLSKSGLRWTDTSCTNHLSLPLIEVRLLETFSSLVIGITSAMWMWCNKKTFITFSQLCIKKMPCRTLSKTNTNMEMIIPNKPQLCYKSIQP 607          
BLAST of Fzd-4-2 vs. TrEMBL
Match: A0A159X4Q5 (Frizzled-4-2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=fz-4-2 PE=2 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 7.252e-124
Identity = 197/200 (98.50%), Postives = 197/200 (98.50%), Query Frame = 2
Query: 1268 IDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSIPLKDA 1867
            IDPDELLGSCYVGRQ  RSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPI NYSIPLKDA
Sbjct:    1 IDPDELLGSCYVGRQXXRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPITNYSIPLKDA 200          
BLAST of Fzd-4-2 vs. TrEMBL
Match: A0A074Z9D5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08477 PE=3 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.367e-122
Identity = 227/624 (36.38%), Postives = 332/624 (53.21%), Query Frame = 2
Query:  170 HEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGL----------------DYLKKHYPKWKSIF-----YVDGN--VKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVC------------------QILHTHPNDM---------------ILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHN------------------------------KLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEW-NKLGDIAANLGEECVNKFGLRWSDK-SCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTL 1777
             ED  N+C  I++ ICQGL+Y  TR PNSVG+T+QE+++KR+NDY  LI+ +CS+Y R FLCT YFPMCT      +TL PC+  C  VQ +CEP MK+F   WP ELNC   P+ +++CI+P +YD D+        L                ++L +H  K K +       + GN  +  + L       ++ C    V +     N     + +C  +C +NI+Y +++K  A IW   W+ILC IS ++ I TF+ D+  RF+YPERPI++I  CY    V  +  + + R+R+ C                   IL T   D                 L+  GYES  CTL F+ +YYF   +  WW+MLA++ +L++  KW  EG+ER+S+ +H+ +W +PAI+T I+LILH+ID DEL G CYVG Q+  S L F+LIP+I+C LLG  L ++ F SL+ +R N+  +                              +L    D +  ++ L+K +AK  IF  +Y +P  C IG   Y Y   D W   + ++A   G  CVN  G  W+    CL+GL  P +EV +L  F +LV+GIT+GMW+WCN+KT 
Sbjct:   69 EEDGLNQCVPIDEPICQGLEYTHTRFPNSVGLTSQEEASKRVNDYRALISVECSHYLRIFLCTVYFPMCTPTPNAFRTLQPCQSFCRHVQSKCEPIMKSFSFPWPKELNCNALPVASDMCIKPQSYDQDQATGSLTQKLPEVASNEIAKLLPGLNNFLHEHPDKMKDVGKSAYSSIGGNLPLTADTLLQIPQSKSVPCTIMEVPLVRGKSN----GNVTCARRCTANIFYRAAEKRFADIWLLGWSILCAISCLLTIVTFIIDRS-RFVYPERPIVYISACYLFYSVGCILRIIVGRERVSCYQRADDAAVVNSQNTIWANILPTLAADAGGFVHSFAPMLETNKFLIVSGYESTSCTLIFIIIYYFGQASYGWWVMLAVTWFLSTACKWGSEGVERVSSILHMFAWAVPAITTMIILILHRIDADELTGLCYVGYQDRASLLIFVLIPQIVCLLLGLGLFVIGFFSLISIRTNLKRSNVGGTKNQFLMTEQSPGNGLLLSSRTPNPERLQFASDKVSVRR-LDKLMAKICIFSVLYVIPCICVIGANWYSYSGQDTWLRSMRELATRSG--CVNLLGTNWNKADECLQGLTYPSIEVHMLHTFMSLVVGITAGMWVWCNRKTF 684          
BLAST of Fzd-4-2 vs. Ensembl Cavefish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 306.22 bits (783), Expect = 1.175e-94
Identity = 181/583 (31.05%), Postives = 295/583 (50.60%), Query Frame = 2
Query:  101 FVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENP 1834
            ++ L+C L +   S++   + +       +C+ I   +CQG+ Y+ TRMPN +   +QE+++ ++N++ PL+   C  + RFFLC+ Y PMCTD +  + T+  CR MC + + +C P M+ F   WP  L+C K P N +   +CI     D           L    +  P         G   +   EN E                    +   KS SC P+C    ++++S  DK+ A IW  +W+ LC +S+   + TF+ D + RF YPERPIIF+ +CY    V  +       + + C         + +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ RKW  E +E  S+  H+V+W +PA+ T ++L + K+  DEL G CYVG  ++ +   FI+IP     ++G+  ++  F +L  +R+        ++     N + LEK + K G+F  +Y VP TC I C  Y  L++D W      +     +CV+  G R  D  C     +P V V +L+IF +LV+GITSG+W+W + KTL         ++  R    P
Sbjct:   22 WIFLWCQL-VSDGSSLDIGAYDGERGRPAKCEPITIPMCQGIGYNMTRMPNFMKYESQEEASIKLNEFAPLVEYGCDVHLRFFLCSLYVPMCTDQV--STTIPACRAMCVQARQKCSPIMEQFSFGWPDSLDCSKLPTNNDPNALCIEAPENDTVPPTKKGEGMLPVPARPRPPGTGAGRPSGG--SGSCENHE------------------KFQYVEKSESCAPRCSPTVDVFWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQ-RFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACD---RENGQLYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMVAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDTNALTGFIIIPLSCYLIIGTSFILTGFVALFHIRK--------IMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIICYFYERLNMDYWKFRASES-----KCVSFPGRRTED--CTLDSSVPTVAVFMLKIFMSLVVGITSGVWVW-SSKTLQTWQGLCARKLAMRTTRKP 561          
BLAST of Fzd-4-2 vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 296.975 bits (759), Expect = 3.263e-91
Identity = 175/558 (31.36%), Postives = 287/558 (51.43%), Query Frame = 2
Query:  110 LFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            L+C L +  +S++   S +       +C+ I   +CQG+ Y+ TRMPN +   +Q+++A ++N++ PL+   C  + RFFLC+ Y PMCTD +  + ++  CR MCE+ + RC P M+ F   WP  L+C K P   +   +C+     D           L    +  P+                EN E                    +   KS SC P+C S  ++++S  DK+ A IW  +W+ LC +S+   + TF+ D   RF YPERPIIF+ +CY    V  +       + + C        ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L + K+  DEL G CYVG  +  +   F+L+P     ++G+  ++  F +L  +R+        ++     N + LEK + K GI+  +Y VP TC I C  Y  L++D W   G     L  +CV   G R  ++ C     +P V V +L+IF +LV+GITSG+W+W +K
Sbjct:   16 LWCQLVI-AVSSLEIGSYDFERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQV--STSIPACRPMCEQARQRCSPIMEKFNYAWPESLDCSKLPTRNDPNALCMEAPENDTKPEPKKGEGMLPVPPR--PRQPGSGGGRPGGSVGACENPE------------------KFQYVEKSESCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPH-RFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACD---RENGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVALFHIRK--------VMKTEGTNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKFRG-----LESKCVTFPGRR--NEDCSLDASMPAVAVFMLKIFMSLVVGITSGVWVWSSK 531          
BLAST of Fzd-4-2 vs. Ensembl Cavefish
Match: fzd10 (frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GENE-990415-220])

HSP 1 Score: 283.108 bits (723), Expect = 1.283e-86
Identity = 168/524 (32.06%), Postives = 265/524 (50.57%), Query Frame = 2
Query:  245 MPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLP-CREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRT---------KSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGD----IAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            MPN +G  +Q ++A +++++ PLI   C  + RFFLC+ Y PMCT+   +  T +P CR MCE+ + +C P M+ F   WP  L+C + P                    N N  ++L    P   S    D   K +  +  ++          + VK  +   T           KS SC PKC S  ++++S +DK  + +W  IW+ILC ISS   + TF+ D + RF YPERPIIF+ + Y    V  L  L +  + + C           +++EG ES  CT+ FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PAI T ++L++ ++  DEL G CYVG  + ++   F+LIP     ++G+  L+  F +L  +R+        ++    +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L      +    GEEC+ K  +   +   +K             IF  LV+GITSGMW+W +K
Sbjct:    1 MPNLMGHEDQGEAAIKLHEFAPLIEFGCHSHLRFFLCSLYAPMCTE---QVSTPIPACRVMCEQARQKCSPIMEQFNFHWPDSLDCSRLP--------------------NKNDPNFLCMEAPNNGS----DDTSKGSHTQPPDSRPPRSGNSQELPVKERMGKDTCGNPGKFHFVQKSESCAPKCYSKVDVYWSHADKRFSLVWIAIWSILCFISSAFTVLTFLIDPQ-RFKYPERPIIFLSMSYCVYSVGYLIRLFVGAENVACD---RDSGVQYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAIKTILILVMRRVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRK--------VMKTEGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKVLAGEQRCLEGGGGEECMMKSSIPAVEIFMVK-------------IFMLLVVGITSGMWIWTSK 472          
BLAST of Fzd-4-2 vs. Ensembl Cavefish
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:103039803])

HSP 1 Score: 261.536 bits (667), Expect = 1.581e-78
Identity = 164/541 (30.31%), Postives = 255/541 (47.13%), Query Frame = 2
Query:  176 DVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKC--DSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHR 1792
            D   RC+ I   +C  L Y++TRMPN VG   Q D+  ++  + PLI   CS   +FFLC  Y PMCT+ +    T+ PC  MC  V+ +C P ++ F   WP  LNC  FP        PTN   D+N         ++    P    +F+ +  V  +  E         C+   +            +S SCV +C  +S + Y    K    +W  +W +LC IS+   + TF+ D   RF YPERPI+F+ +CY    V  L  L   R+R+ C +        +L +EG ++  C + FL  Y+F M +++WW++L ++ +LA+  KW  E +E  S+  HI +W +PA+ T ++LI+  +D D+L G CYVG QN  +   F++ P     ++G++ +     +L  +R N+  +              LE+ + K G+F  +Y VP TC I C   Y+  I  W      A +                          +   +L IF +L++GIT GMW+W + KTL    R
Sbjct:   27 DEDARCEPIRMAMCLDLGYNQTRMPNLVGNVLQADAELQLQTFTPLIQYGCSSQLKFFLCAVYAPMCTEKV--PVTIGPCGSMCLAVKRKCLPVLQEFGFVWPELLNCSLFP--------PTN---DQN---------HMCMEGPAEDDLFHPNKPVAPHEEE---------CVT--MGGGGPEQYAWAKRSGSCVLQCGYESGL-YRRQAKMFTDVWMAVWAVLCFISTSFTVLTFLLD-SARFSYPERPIMFLSMCYNVYSVAFLVRLTAGRERISCDL--DEAAVPVLAQEGLKNTGCAVVFLLAYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADDLTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDG--------TKTDKLERLMVKIGVFSVLYTVPATCVIAC---YFYQISNWADFHQTARD------------------------SYMAAEMLRIFMSLLVGITCGMWVW-SAKTLHTWQR 494          
BLAST of Fzd-4-2 vs. Ensembl Cavefish
Match: ENSAMXT00000026985.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:27065879:27070162:-1 gene:ENSAMXG00000026259.2 transcript:ENSAMXT00000026985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.062 bits (645), Expect = 9.285e-75
Identity = 158/569 (27.77%), Postives = 275/569 (48.33%), Query Frame = 2
Query:  158 SNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKS---AVDNRTKSKSY-SCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSI 1852
            ++ A +D+   C+ I   +C+G+ Y+ T MPN      QE+    ++ ++PL+  +CS    FFLC+ Y P+C  +    K L PCR +CE+ +  C P M  +  +WP  ++C++ PM  +    P    +D+N S          K  P+  S           +    + +   +C +  V +K     + NR ++ S  +C   C    ++S  ++     W  +W++LC +S++  +ATF+ D + RF YPERPIIF+  CY  + +  +  L    +++ C       +   ++ +     +CTL FL +Y+F M +++WW++L+ + +LA+  KW  E +   S   H+ +W +P++ +  VL L  +D D + G CYVG Q+  S   F+L P ++    GS+ L+  F SL  +R  I                 LEK + + G+F  +Y VP T  + C +Y   +  EW +       LG  C ++           +    P   V +L+ F  LV+GITSG+W+W + KTL +  R++     CR ++ P    S+
Sbjct:   28 TSAASKDIV--CEPITVPMCKGIGYNLTYMPNQFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPIC--LPDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGD----PDRLCMDQNSSETTTLSPSFPKPTPRGSSRHRATSKSAVPQ----KCDRECRCREPLVPIKKESHPLYNRVQTGSLPNCALPCHQP-YFSQDERAFTTFWIGLWSVLCFVSTLTTVATFLIDME-RFKYPERPIIFLAACYLFVSLGYIVRLLAGHEKVACG---GSGDQRHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLESLRGFVLAPLVVYLFSGSLFLLAGFVSLFRIRSVIKQGG--------TKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPEWEQ------ALGCSCASERQ---------QQGLGPDYAVFMLKYFMCLVVGITSGVWIW-SGKTLESWRRFVARCFPCRARKPPASASSM 555          
BLAST of Fzd-4-2 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 249.595 bits (636), Expect = 1.360e-74
Identity = 156/540 (28.89%), Postives = 257/540 (47.59%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPM--NTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDK-NLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXX-----------XXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   +FFLC+ Y P+CT +    K + PCR +C++ +  CE  M  F  +WP  L C+ FP+  + EIC+   + D     +                         + T R            +       +A   R ++ +  C PK  + + Y S ++   +R+W  IW++LC  S++  + T++ D + RF YPERPIIF+  CY  + V  +    LD K +VC    +  +    + +G +   CT+ F+ +Y+F M +++WW++LA++ +LA+  KW  E +E  S   H+ +W +PA+ T  +L +  +D D L G C+VG  +  +   F+L P  +   LG+  L+  F SL  +R  + H+            + LEK + + GIF  +Y VP T  I C  Y     ++W K                   W  +SC KG              P   V +++   TL++GITSG W+W  K
Sbjct:   13 CQPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVL---EKAIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDEICVGQNHTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTHPFMCPRVLKVPPYLNAQLFRERNCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQ-RFRYPERPIIFLSGCYFMVAVAYVAGFLLDDK-VVCNEQFSE-DIYRTVTQGTKKEGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFREQWEK------------------TWVSQSC-KGFAIPCPLNHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGK 519          
BLAST of Fzd-4-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 6.560e-72
Identity = 151/542 (27.86%), Postives = 253/542 (46.68%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPM---NTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFET---------EINLKCLDSHVSVKS---AVDNRTKSKSY-SCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            C  I   +C+G+ Y+ T MPN     +Q+++   ++ ++PL+  +CS   RFFLC+ Y P+C +     + L PCR +CE+ +  C P M+ +   WP  + C + P+      +C       +D N S        +K   P     F    N  T R+              E    C    V++ S    + NR ++ S  +C   C  + +++  ++  A  W  +W+ILC +S+   + TF+ D + RF YPERPIIF+  CY  + +  +  L +    ++C   H H     +  E     +CT+ FL  Y+F M +++WW++L+++ ++A+  KWS E +   S   H+ +W LP++ +  VL    +D D L G C VG Q+  +   F+L+P  +   +G+V L+  F SL+ +R  I                 LEK + + GIF  +Y VP    + C  Y     D W +     +  G+E            S  +    P   + +L+ F  LV+GITSG+W+W  K
Sbjct:    9 CQNITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLE--DYKQPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNRLC-------MDYNKSDTTPQPPEVKPTAPVRS--FNPSKNRATTRVGGGGGGGGGSGEACESGCACRAPMVAIGSDRHPLYNRVRTGSVLNCAMPCH-DPYFTQDERTFASFWIGLWSILCFVSTFTTVVTFLIDME-RFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICNQEHRH-----VHYETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQGGT-------KTDKLEKLMVRIGIFSMLYTVPAIAVVACYFYEERSRDGWARALICPSCQGDE---------EPGSQQQQQQRPDYGIFMLKYFMCLVVGITSGVWIWSGK 516          
BLAST of Fzd-4-2 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 243.817 bits (621), Expect = 7.434e-72
Identity = 151/543 (27.81%), Postives = 257/543 (47.33%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE--ICIRPTNYDLDRNLSFNANGLDY-------LKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHV-SVKSAVDNRTKSK---SYSCVPKCDSNIWYSSSDKN-LARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFS---TLVIGITSGMWMWCNK 1768
            C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   +FFLC+ Y P+CT +    + + PCR +CE+ +  CE  M  F  +WP  L C+ FP+     IC+   + D         +           L  HY                   +     + +    HV  V S ++ +   K      C P   + + Y  +D+   AR+W  +W+ILC  S++  + T++ D + RF YPERPIIF+  CY  + +  +     + K +VC          ++  +G +   CT+ F+ +Y+F M +++WW++L+++ +L++  KW  E +E  S   H+ +W +PAI T  +L + ++D D L G C+VG  +  +   F+L P  +   +G+  L+  F SL  +R  + H+            + LEK + + GIF  +Y VP T  I C  Y      +W K     + +   C   F ++     C +G    +     + +     TL++GITSG W+W  K
Sbjct:   57 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVL---EEAIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGSENICVGQNHTDEKGGHPTPPDPHPIPHGDSFTLPPHYRPGGPSSGGGIGGGGGGGASGGDSSSYQLTCPHVLRVPSYLNYQFLGKKECGSPCEPSKSNGLMYFDADELWFARMWVGVWSILCCASTLFTVLTYLVDME-RFRYPERPIIFLSGCYAVVSIAYIVGFFFEEK-IVCNKFFEDSYSTVV--QGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRAQWEK-----SWVAHTC-KSFAVQ-----CPQGHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGK 573          
BLAST of Fzd-4-2 vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 148.288 bits (373), Expect = 2.528e-39
Identity = 96/350 (27.43%), Postives = 157/350 (44.86%), Query Frame = 2
Query:  728 DNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNK-LGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKT 1774
            D     +  +C   C S        +  A  W  +W+ LC  ++   ++TF+ D + RF YPERPIIF+ LC     +  +  +    + + C     H     ++       +CT  FL  Y+F M   +WW++L+++ ++A+  KW  E +   S   H+ +W LP+I     L ++ +D D + G C VG Q+  +   F+L P +   L+G+  L+    +L  +R  I+ N            + LE+ + + G+F  +Y VP    + C LY   H D W + L   A   G   + + G R            P   V +L+ F  LV GITSG W+W  K  
Sbjct:   23 DRVRTGQVRNCATPCHSPF-LGREQRTFASFWIGLWSSLCFAATFATVSTFLIDME-RFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACSADWHH-----VLYASSGPALCTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGG------AKTEKLERLMVRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGAR------------PDFAVFMLKYFVCLVGGITSGAWIWSGKTA 347          
BLAST of Fzd-4-2 vs. Ensembl Sea Lamprey
Match: fzd3b (frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GENE-070122-1])

HSP 1 Score: 137.117 bits (344), Expect = 7.646e-35
Identity = 108/373 (28.95%), Postives = 178/373 (47.72%), Query Frame = 2
Query:  758 CVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYES-PMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVN-KFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSIPLKDAH 1870
            C P C  N+++SS +  L R    + +++CL+++     TF+ D+K RF YPERPIIF   CY  + +  L    LD     C      P     + +G  +   CT  F+ +Y+  M  ALWW++L I+ +LA+  KW  E +E+ + A H ++W  PA  T  +L L+K++ D L G CY G  +  +  +F+L P   C   G  LL+    SL  +R  + H+         +NQ  L KF+ + G+F  +Y VP    + C +Y       W      A  L + C   +    +      +    P + + L++ F+TLV+GI    W+  ++KT L    +L      R+K+  +      L+++H
Sbjct:   30 CSPPCP-NMYFSSGELELTRYLVGVMSVVCLVATTFTFLTFLLDRK-RFRYPERPIIFYATCYVAVSLSFLVGFLLDDSAAACNAPGLAPGAAGTVTQGSRNNKACTAVFMLLYFSAMAGALWWVVLTITWFLAAGLKWGREAIEKRAAAFHALAWGPPAALTVALLALNKVEGDNLSGVCYAGLYDVTTLRYFVLAPLGACAAAGLSLLLAGIVSLNRVRLEMRHDG--------RNQTKLVKFMVRIGVFSVLYLVPQLALVACLVYEQASRAAWE-----ATWLRDRCTEYRIPCPYQAN---QPKQRPALVLFLVKYFTTLVVGIPPAFWV-GSRKTCLGWAAFLSGR---RHKQAVVNESRRVLEESH 380          
BLAST of Fzd-4-2 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 286.96 bits (733), Expect = 1.181e-87
Identity = 166/531 (31.26%), Postives = 265/531 (49.91%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGY---ESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            ++C  I   +C G+ Y+ TR PN +   +QE++AKR++++ PLI   C+   RFFLC+ + PMCT  +     +  CR MCE  +  C P M+ F   WP  L+C + P   +    P        L   A  +   K+  P  +S  + +        +       L+   ++V            K   CVP+C S++ +SS++K  A +W  +W++LC IS+ V + TFV D   RF YPERPIIF+ LCY    +  +  +   R  ++C        +  +++ G    +   C++ FL +YYF M +A+WW++L  + +LA+ RKW  E +ER +   H V+WT+PAI T + LI+ K+D DEL G CYVG  +  +   ++L P  L  L+G+  L+  F SL  +R  + + +         N   LEK I + G+F  +Y +P++  I C  Y Y ++D W               N +  R  D++CL+     +    +   F  L+IGITS MW+W  K
Sbjct:   30 SKCTPITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVP--IYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLPKKGD----PQAKSDPTKLCMAAPNI---KQTAPLNESDIWSNFESLGPEFKKINNTGPLRYKYTYVE-----------KYDQCVPQCKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTS-RFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVICD-----ETESFVIRAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSLFRIRTVLKNKE--------TNTDKLEKLIVRIGVFSVLYTIPVSAVIACSFYEYNNMDVWKVRAPF---------NTYICR-GDQACLENYGPSIEVFIVKY-FMLLIIGITSNMWIWSTK 515          
BLAST of Fzd-4-2 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 265.003 bits (676), Expect = 4.438e-80
Identity = 166/557 (29.80%), Postives = 272/557 (48.83%), Query Frame = 2
Query:  185 NRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFP-MNTEICI--RPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICV-FNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFST---LVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENP 1834
             RC+ +   +C GLQY+ T  PN++    QE++A  ++ +FPL+   CS    FFLC+ Y P+CT +  ET  L PCR +C  V+  CE  MK F   WP  L+C++FP +  EIC+    T    D++   N N                Y D ++ T R          +C +S    K   D  T      C   C  N++++  ++ +AR+W  IW ILC +S++  I TF+ D + RF YPERPIIF+  CY  + + F   ++  D+      I    P  ++   +G +   CT+ F+ +Y+F M +++WW++L ++ +LA+  KW  E +E  S   H+ +W +PA+ T  +L++ K+D DEL G CYVG  +  +   ++L P  + F++G+  L+  F SL  +R        +++ D    ++ +EK + + G+F  +Y VP    IGC  Y   + + W+          ++C         + SC            ++ +      L++GITSG W+W +K   LN  R        R K  P
Sbjct:   27 KRCEPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCTVL--ETP-LPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEICVGENTTTPTSDQDGGINNNT---------------YPDVDMSTMR---------YRCPESQ---KIPNDQYTFHGEKRCAATC-RNVFFTKREREIARMWTGIWAILCAVSTLFTILTFLIDMR-RFRYPERPIIFLSGCYFMVSIAFITGYVAGDKIACNEPIKKGFPKTLV---QGTKHEGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISLFRVR--------SVLKDDYSKREKIEKLMIRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSKT--LNSWRRFYRRFILREKGRP 538          
BLAST of Fzd-4-2 vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 241.891 bits (616), Expect = 8.218e-72
Identity = 159/533 (29.83%), Postives = 257/533 (48.22%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSY-YFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSF-NANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEI--NLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMIL--MKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            +C+KI+  +C+ + Y+ TRMPN +G   Q+++  ++  + PLI   C+     FFLC+ Y PMCTD +    T   CR +CE V+  C P +  F + WP  LNC +F +             +RN+     N  +  +K  P +K I     N  T +  +  +E     K   ++  V+S         + SC  +C+ +  + +SDK    IW  IW+I C IS+ + + TF+ +   RF YPER II++ LCY    +  +  LG  R+ + C    T P   +   +++G  +  C + FL  Y+F M A +WW++LA++ +LA+  KW CE +   +   HI++W LP I T  +LI  K+D DEL G C+VG Q+  +   F+L P+    ++G++ LI  F +L  +R  +                 LE+ I + GIF  +  VP T  I C  Y Y + + W   G     + E   + F L+                     +F +L  G+ +GMW+W +K
Sbjct:    3 KCEKISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMCTDKVDVVIT--SCRPLCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNN----------ERNMCMPGPNFTESPEKPRPDFKPI-----NDTTEKPPSTGSEQCRRFKNSKNYFYVQS---------TESCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETG-RFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCD---TDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVALFRIRTTVQRG-------GQAKTDKLERLIVRIGIFSVLSTVPATAVIACYFYEYANKEYW-YYGQRDGAVAEPNFSIFMLK---------------------VFMSLFTGVITGMWIWSHK 476          
BLAST of Fzd-4-2 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 236.113 bits (601), Expect = 2.358e-69
Identity = 155/534 (29.03%), Postives = 248/534 (46.44%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPM---NTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCD---SNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPM-CTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            +C++I   +C+G+ Y+ T MPN      Q ++A  ++ ++PL+  QCS   RFFLC+ Y P+C       K L PCR +CE+ +  C P M+ +   WP  + C+ FP       +C       + RN S  +                  +  N                C    VS+       T++ S   VP+C    +  +++    + A  W  +W ILC IS++V   TF+ D   RF YPERPIIF+  CY  + V  +  L    K++ C       +   LM+     P  CT+ FL +Y+F M +++WW++LA + +L++  KWS E +   S   H V+W +PAI    VL +  ID D + G CYVG  N +S + F+++P ++  + G+  L+  F SL+ +R+ +  +              LEK + + G+F  +Y VP T  + C  Y  ++ + W           E  +N  G       C      P   V +++ F  LV+GITSG W+W  K
Sbjct:   28 KCEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHY--DKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGDENTLC-------MGRNSSGESTPKPSQSPQPAPSPDTAAISANC-------------CSCRPPFVSIAGKNIKPTRAISVGGVPQCAMACNRTYFTHDQDSFASFWIGLWAILCFISTLVTTLTFLVDMH-RFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIAC-------DSNGLMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQH-------GSTKTDKLEKLMIRIGVFSVLYTVPATIVVACYYYELVNRETW-----------ERTINCSG-------CGVTRVKPDHSVFIIKYFMALVVGITSGFWIWSGK 506          
BLAST of Fzd-4-2 vs. Ensembl Nematostella
Match: EDO32500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUU2])

HSP 1 Score: 93.5893 bits (231), Expect = 7.691e-23
Identity = 46/116 (39.66%), Postives = 65/116 (56.03%), Query Frame = 2
Query:  188 RCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE-ICI 532
            RC ++   +C+ L Y++T  PNS+G   Q ++   ++ + PL+   CS     FLC  Y P CT ++   K +LPCR MC  V+  CE  MK F   WP  LNCKKFP  +  IC+
Sbjct:    2 RCQEVTIPMCKNLGYNQTLFPNSLGHKTQREAGLIVHQFVPLVKVNCSEMLSRFLCFTYAPFCTVLM---KPVLPCRSMCRAVRRGCETLMKRFGFDWPETLNCKKFPRESRSICV 114          
BLAST of Fzd-4-2 vs. Ensembl Medaka
Match: fzd10 (frizzled class receptor 10 [Source:NCBI gene;Acc:101161314])

HSP 1 Score: 300.442 bits (768), Expect = 1.016e-92
Identity = 179/559 (32.02%), Postives = 288/559 (51.52%), Query Frame = 2
Query:  128 LHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSH---VSVKSAVDNRTK----SKSYSCVPKC--DSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            L+K SAI   S +       RC  I   +C+ + Y+ TRMPN +G  +Q ++A ++ ++  LI   C  + +FFLC+ Y PMCT+ +  +  +  CR MCE+V+++C P ++ F+  WP  L+C + P   +   +C+   N   D                 PK          V   +  +F  +  L   D H   +  K    N  K     KS SC PKC    ++++S  DK  + +W  IW+ILC +SS   + TF+ D + RF YPERPIIF+ + Y    V  L  L +    + C           +++EG ES  CT+ FL +YYF M ++LWW++L ++ +LA+ +KW  E +E  S+  H+ +W +PA+ T ++L++ K+  DEL G CYVG  + ++   F+LIP     ++G+  L+  F +L  +R+ +            +N   LEK + + G+F  +Y VP TC I C  Y  L++D W  L        ++CV+  G R     C+    +P +E+ +++IF  LV+GITSGMW+W +K
Sbjct:   13 LNKASAI--SSIDPDWSGEGRCQHITIPLCKDIGYNMTRMPNLMGHDDQLEAAIKLQEFASLIQCGCHSHLKFFLCSLYAPMCTEQV--SNPIPACRVMCEQVKVKCSPILEKFQFPWPDSLDCSRLPTKNDPNNLCMEAPNNSSDEP---------------PK----------VPHTQPPDFRPQQPLSGQDLHPKDIGEKQTCSNPGKFHFVEKSESCAPKCYPKVDVFWSQGDKQFSLVWMAIWSILCFVSSAFTVLTFLIDPQ-RFKYPERPIIFLSMSYCVYSVGYLIRLFVGADGIACD---RDNGVQYIIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRKVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMKTEG--------ENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWRILA-----WKQKCVD--GSRPESDECVMKASIPAIEIFMVKIFMLLVVGITSGMWIWTSK 523          
BLAST of Fzd-4-2 vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 294.278 bits (752), Expect = 3.315e-90
Identity = 170/540 (31.48%), Postives = 284/540 (52.59%), Query Frame = 2
Query:  164 NAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDS--NIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            +   D   +C+ I   +C G+ Y+ TRMPN +   +Q ++A ++ ++ PL++  C  + RFFLC+ Y PMCTD +  + ++  CR MCE+ + +C P MK F   WP  L+C K P   +   +C+     +       +    + +    P+ +       +  ++RL             S  S ++    +   KS SC P+C    ++++S  DK+ A IW  +W+ILC +S+   + TF+ +   RF YPERPIIF+ +CY    +  +       + + C   H    ++ +++EG ES  CT+ FL +YYF M +++WW++L ++ +LA+ +KW  E +E  SN  H+ +W +PA+ T ++L + K+  DEL G CYVG  +S +   F+LIP     ++G+  ++  F +L  +R+ +             N + LEK + K GI+  +Y VP TC I C  Y  L++D W   G     L EEC + F     +  C     +P V V +L+IF +LV+GITSG+W+W +K
Sbjct:   32 DLERDRPAKCEPIVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMCTDKV--STSIPACRPMCEQARDKCAPIMKKFSYTWPDSLDCSKLPTRNDPNALCMEAPENETRTEGKKDKKKGEGMLPVPPRPR-----QPDTPSSRLPG-----------SGNSCENPDKFQFVEKSQSCAPRCSPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPH-RFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDREH---GELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVALFHIRKVMKTEG--------TNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKLRG-----LQEEC-DSFSSH--NSKCSLETSVPTVAVFMLKIFMSLVVGITSGVWVWSSK 533          
BLAST of Fzd-4-2 vs. Ensembl Medaka
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 256.144 bits (653), Expect = 3.409e-76
Identity = 163/571 (28.55%), Postives = 273/571 (47.81%), Query Frame = 2
Query:  122 LKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMN--TEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSI----FYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNR---TKSKSYSCVPKCDSNIWYSSSDK-NLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAA--NLGEEC-VNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRY 1795
            L ++  SA  +  +      +  C  I+  +C  + Y++T MPN +G TNQED+   ++ ++PL+  QCS   +FFLC+ Y P+CT +    + + PCR +CE+ +  CE  M  F  +WP  L+C+ FP+N  +EIC+     +     S           H P+  ++    F        N    F   + L+       V S +  R    K     C P   S I Y   D+    R+W  IW+ILC +S++  + T++ D + RF YPERPIIF+  CY  + V       L+ K +VC +          + +G +   CT+ F+ +Y+F M +++WW++L+++ +L++  KW  E +E  S   H+ +W +PAI T  +L + ++D D L G C+VG  N  +   F+L P  +   +G+  L+  F SL  +R  + H+            + LEK + + G+F  +Y VP T  I C  Y     + W +   +         C V+ F     D +             +++   T+++GITSG W+W + KTL +  R+
Sbjct:    7 LFVYSASAQHYSDSGISVPEHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSTELKFFLCSMYAPVCTVL---EQAIPPCRSLCERARQGCEALMNKFGFQWPERLHCEAFPVNGGSEICVGQNTSEPGSPSS--------SSPHVPELVTVPPNRFPNPPQPPHNSYHQFSCPLQLE-------VPSYLGYRFMGVKDCGAPCEPTKPSGIMYFREDEVKFGRLWVGIWSILCCVSTLFTVLTYLVDMR-RFRYPERPIIFLSGCYFMVAVAYAAGFFLEDK-VVC-VDKFKGEGFRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGIFNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG--------TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERTWHMQTCKRFAVPCPVHNFAPMTPDFTVF-----------MIKYLMTMIVGITSGFWVW-SGKTLQSWRRF 536          
BLAST of Fzd-4-2 vs. Ensembl Medaka
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:101169962])

HSP 1 Score: 254.218 bits (648), Expect = 8.097e-76
Identity = 169/536 (31.53%), Postives = 257/536 (47.95%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSK-SYSCVPKCD-SNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHR 1792
            CD I   +CQGL Y+ T+MPN VG   Q D+  ++  + PLI   CS   +FFLC+ Y PMCTD +     + PC  MC  V+ +C P +  F   WP  LNC +FP        P N         N   ++      P ++S+ +              ++ + + LDS        D  T  K + SCV +C   N  Y    K     W  +W +LC +S+ + + TF+ D + RF YPERPIIF+ +C     V  L  L L R+R+ C +        +L++EG +S  C + FL +Y+F M ++LWW++L ++ +LA+  KW  E +E  S+  HI +W +PA  T ++LI+  +D D+L G CYVG Q   +   F++ P     L+G++ +     +L  +R N+  +              LE+ + K G+F  +Y VP +  IGC LY   H   W   G+   +  +  V    LR                     IF +L++GITSGMW+W + KTL    R
Sbjct:   35 CDPIRISMCQGLGYNVTKMPNLVGNMLQSDAELQLTTFTPLIQCGCSSQLKFFLCSVYVPMCTDKV--PIPIGPCGSMCLSVKRKCLPVLLEFGYTWPEALNCSRFP--------PQN-------DHNHMCMEGPGDEDPPYQSVHH-------------PSDQDCQALDS------TPDQYTWLKQTESCVLQCGYDNGLYRRGAKVFTDAWMAVWAVLCFLSTTLTVLTFLLDSQ-RFSYPERPIIFLSMCCNLYSVAYLVRLTLGRERVSCDLDAV--GVPVLVQEGLKSTGCAIVFLLLYFFGMASSLWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAAKTIVILIMRLVDADDLTGLCYVGNQQQEALTGFVVAPLATYLLVGTLFICAGLMALFKIRSNLQKDG--------TKTDKLERLMVKIGVFSILYTVPASTVIGCYLYQLSH---W---GEFKTSTHDSYVTSEMLR---------------------IFMSLLVGITSGMWIW-SAKTLHTWQR 495          
BLAST of Fzd-4-2 vs. Ensembl Medaka
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 250.366 bits (638), Expect = 6.398e-74
Identity = 152/539 (28.20%), Postives = 261/539 (48.42%), Query Frame = 2
Query:  191 CDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTE---ICIRPTNYDLDRNLSFNANGLDYLKKHYPKW--KSIFYVDGNVKTNRLENFETEINLKCLDSHVSV---KSAVDNRTKSKSYS-CVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVC----QILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNK 1768
            C  I   +C+G+ Y+ T MPN      Q+++   ++ ++PL+  QCS   +FFLC+ Y P+C +     K L PCR +CE+ +  C P M+ +   WP  + C   P+      +C+     D +RN S  A+ +     ++P    KS     G     +      E   +CL+  V+V   +  + NR K+   + C   C  N +++  ++     W  +W++LC +S+   +ATF+ D + RF YPERPIIF+  CY  + V  +  L    +++ C     + H H        E     +CT+ FL +Y+F M +++WW++L+++ +LA+  KW  E +   +   H+ +W +P++ +  VL L  +D D + G CYVG QN  +   F+L P ++   +G++ L+  F SL  +R  I                 LEK + + GIF  +Y VP T  + C  Y   +  +W    + ++ L E    + G  ++              V +L+ F  L++GITSG+W+W  K
Sbjct:   21 CQGIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLE--DYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDLLPVQGNPDTLCM-----DYNRNDSTTASPVLSKPTNHPGRSPKSKPGRAGAPGKYKPPAAPCEPGCRCLEPMVAVTTERHPLYNRVKTGQVTNCAMPCH-NPYFTHDERAFTAFWIGLWSVLCFVSTFATVATFLIDME-RFKYPERPIIFLSACYMFVSVGYIVRLIAGHEKVACNRDFDVEHIH-------YETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQGG--------TKTDKLEKLMIRIGIFTVLYTVPATVIVACYFYEQHNRQDWEMTHNCSSCLMERERARSGPDYA--------------VFMLKYFMCLLVGITSGVWIWSGK 521          
BLAST of Fzd-4-2 vs. Planmine SMEST
Match: SMESG000038967.1 (SMESG000038967.1)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 635/636 (99.84%), Postives = 635/636 (99.84%), Query Frame = 2
Query:   98 GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV 2005
            GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPI NYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV
Sbjct:    7 GFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPITNYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV 642          
BLAST of Fzd-4-2 vs. Planmine SMEST
Match: SMESG000038967.1 (SMESG000038967.1)

HSP 1 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 586/587 (99.83%), Postives = 586/587 (99.83%), Query Frame = 2
Query:  245 MPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV 2005
            MPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPI NYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV
Sbjct:    1 MPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLVIGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPITNYSIPLKDAHPLSPINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV 587          
BLAST of Fzd-4-2 vs. Planmine SMEST
Match: SMESG000004519.1 (SMESG000004519.1)

HSP 1 Score: 339.732 bits (870), Expect = 5.021e-107
Identity = 189/540 (35.00%), Postives = 299/540 (55.37%), Query Frame = 2
Query:  176 DVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMC-TDMLGETKTLLPCREMCEKVQIRCEPFMK-AFKLKWPAELNCKKFPMNTEICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVD--GNVKTNRLENFETEINLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECVNKFGLRWSDKSCLK--GXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTL 1777
            D+Y +C  I +  CQ + Y  T MPN VG  +Q +++KR  D+ PLIN +CS Y + FLC+ YFPMC TD    + T+ PCR +C  V+ RCEP MK  FKL W  EL+C+KFP   +IC+ P ++  D       +  D  +  Y K + +   +  G  K    +     +  +CL S V++        ++ + SC   C +N+ +++ DK  A IW   W++LC  S ++ I  F  +   RFLYPE+PI+F+ +CY      NLF   L R  + C+  +   +   ++  G E+  C + FL +Y+F   +ALWW++L I+ +L++ R W  E +E IS+ +H+VSW +PA+ +  +LILHKID DEL G C+VG  N++    F+++P ++   +G V L + + SL+ +R++       +      N + LEK +AK G+F  +Y +P+ C I   +     +  ++            C+ + G+ WS   C++     LP VE+R+L IF  LVIGITSG+W+W NKKT+
Sbjct:   25 DIYKQCVPIKEPECQDVHYSNTSMPNLVGSYSQTEASKRFRDFNPLINIKCSNYLKLFLCSVYFPMCETDTSMSSSTVKPCRHLCNHVKERCEPLMKETFKLTWSEELDCEKFPERGKICLTPDSFSQDEFHPPANSQEDSYQDLYRKLQLVMQGNRIGQSKLEIYQKMSDMVGAQCLPSEVNIG-------QTPNISCAQICSANVQFNAHDKVFANIWLLGWSVLCFFSCLLTIIVFSCNTN-RFLYPEKPIVFLSICYFFYASGNLFGAILGRNVVACRAFNDKTD--FIVGSGRETTWCKINFLMIYFFGSASALWWVVLTITWFLSASRHWGYEAIESISSMLHLVSWAIPALKSIFILILHKIDADELTGQCFVGNSNNKVLWGFVIVPNMIYLFIGIVFLTMGYISLLKVRRSFLQRPDCI---DTNNLKRLEKLMAKIGVFSILYVLPVLCTIVSYIVDAYKMTNFDITLKALFRFSPNCIGRNGINWSSIKCVEILQPVLPSVEMRMLRIFMNLVIGITSGIWIWGNKKTV 551          
BLAST of Fzd-4-2 vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 265.388 bits (677), Expect = 5.748e-78
Identity = 168/570 (29.47%), Postives = 285/570 (50.00%), Query Frame = 2
Query:  152 FKSNNAHEDVYNRCDKINQQICQGLQYDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPM--NTE--ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVS-----------------VKSAVDNRTKSKS-YSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVC-QILHTHPNDMILMKEGYESPM-CTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECV--NKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLN 1783
             KS+N + D   +C+ I   +C+ + Y+ T MPN     NQ+++    + ++PL+  +CS   +FFLC+ Y P+C       K+L PCR +CE+V+  C+P ++ +  KWP ++NC +FP+  N E  +C       +++NLS  +  L  +    PK ++    D N +    +N   E++ +    + S                 +  A  NR  +   ++C   C S  + S SD+     W  +WTI+CL+S+   +ATF  D   R+ YPERPIIF+ +CY  + +  L  + +  + L C  I     + + L++ G   P  CT+ FL +YYF M A+LWW++L I+ +LA+  KW  E + + S   H ++W LP I + + L +  +D D + G CYVG  +  + + F+L P ++   +G+++LI  F SL  +R  I        L +    + LEK + + G+F  +Y  P    + C +Y   +  EW +      NL  +C   N+  L     S           V + + F  + +G+TSG W+W +KKT+L+
Sbjct:   31 LKSDNTNRD-KGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQY--VKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILC-------MEKNLSTASTTLASVVTLAPKEQN----DANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPG-RYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIK-------LQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQ------NLSCDCFDSNRHQLNLPRPS---------YSVFMFKYFMFMGVGMTSGFWIW-SKKTILS 562          
BLAST of Fzd-4-2 vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 251.521 bits (641), Expect = 2.719e-73
Identity = 160/541 (29.57%), Postives = 269/541 (49.72%), Query Frame = 2
Query:  239 TRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCTDMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPM--NTE--ICIRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETEINLKCLDSHVS-----------------VKSAVDNRTKSKS-YSCVPKCDSNIWYSSSDKNLARIWYFIWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHLGLDRKRLVC-QILHTHPNDMILMKEGYESPM-CTLTFLGMYYFEMVAALWWLMLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPDELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIAHNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHIDEWNKLGDIAANLGEECV--NKFGLRWSDKSCLKGXXXXXXXXXXXXIFSTLVIGITSGMWMWCNKKTLLN 1783
            T MPN     NQ+++    + ++PL+  +CS   +FFLC+ Y P+C       K+L PCR +CE+V+  C+P ++ +  KWP ++NC +FP+  N E  +C       +++NLS  +  L  +    PK ++    D N +    +N   E++ +    + S                 +  A  NR  +   ++C   C S  + S SD+     W  +WTI+CL+S+   +ATF  D   R+ YPERPIIF+ +CY  + +  L  + +  + L C  I     + + L++ G   P  CT+ FL +YYF M A+LWW++L I+ +LA+  KW  E + + S   H ++W LP I + + L +  +D D + G CYVG  +  + + F+L P ++   +G+++LI  F SL  +R  I        L +    + LEK + + G+F  +Y  P    + C +Y   +  EW +      NL  +C   N+  L     S           V + + F  + +G+TSG W+W +KKT+L+
Sbjct:    2 TMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQY--VKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILC-------MEKNLSTASTTLASVVTLAPKEQN----DANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPG-RYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIK-------LQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQ------NLSCDCFDSNRHQLNLPRPS---------YSVFMFKYFMFMGVGMTSGFWIW-SKKTILS 505          
The following BLAST results are available for this feature:
BLAST of Fzd-4-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD101.544e-9232.90frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD94.254e-8531.71frizzled class receptor 9 [Source:HGNC Symbol;Acc:... [more]
FZD43.373e-8331.95frizzled class receptor 4 [Source:HGNC Symbol;Acc:... [more]
FZD57.953e-7528.52frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD11.860e-7428.39frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-178.549e-6327.79Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-178.549e-6327.79Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-178.549e-6327.79Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-171.017e-6227.79Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-171.017e-6227.79Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz1.223e-6224.70gene:FBgn0001085 transcript:FBtr0330102[more]
fz1.947e-6227.31gene:FBgn0001085 transcript:FBtr0075743[more]
fz47.119e-4925.98gene:FBgn0027342 transcript:FBtr0071017[more]
fz47.119e-4925.98gene:FBgn0027342 transcript:FBtr0071018[more]
fz24.679e-4732.09gene:FBgn0016797 transcript:FBtr0112890[more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX322606.11.196e-9430.41pep chromosome:GRCz11:CHR_ALT_CTG5_1_52:56018527:5... [more]
fzd9a1.350e-9331.05frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9a1.881e-9331.84frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b2.983e-9231.34frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b2.983e-9231.34frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD92.049e-8931.08frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
FZD41.745e-8632.89frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
bdh22.743e-7528.973-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;... [more]
ntrk14.037e-7428.81neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
zdhhc91.311e-7228.16zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd104.274e-9230.74frizzled class receptor 10 [Source:MGI Symbol;Acc:... [more]
Fzd91.355e-8631.32frizzled class receptor 9 [Source:MGI Symbol;Acc:M... [more]
Fzd47.635e-8331.77frizzled class receptor 4 [Source:MGI Symbol;Acc:M... [more]
Fzd28.725e-7528.67frizzled class receptor 2 [Source:MGI Symbol;Acc:M... [more]
Fzd13.944e-7428.65frizzled class receptor 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Fzd-4-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DEB5|FZ10A_XENLA3.515e-9532.04Frizzled-10-A OS=Xenopus laevis OX=8355 GN=fzd10-a... [more]
sp|Q9W742|FZ10B_XENLA3.003e-9331.86Frizzled-10-B OS=Xenopus laevis OX=8355 GN=fzd10-b... [more]
sp|Q9ULW2|FZD10_HUMAN7.416e-9232.90Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 ... [more]
sp|Q9PWH2|FZD10_CHICK7.730e-9232.02Frizzled-10 OS=Gallus gallus OX=9031 GN=FZD10 PE=1... [more]
sp|Q8BKG4|FZD10_MOUSE2.989e-9130.74Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1... [more]
back to top
BLAST of Fzd-4-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DF470.000e+099.84Fzd-4-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
A0A1S6KMG70.000e+0100.00Uncharacterized protein (Fragment) OS=Schmidtea me... [more]
T1DBN20.000e+054.51Fzd-4-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A159X4Q57.252e-12498.50Frizzled-4-2 (Fragment) OS=Schmidtea mediterranea ... [more]
A0A074Z9D51.367e-12236.38Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd9a1.175e-9431.05frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b3.263e-9131.36frizzled-9 [Source:NCBI gene;Acc:103027133][more]
fzd101.283e-8632.06frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GE... [more]
fzd41.581e-7830.31frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000026985.29.285e-7527.77pep primary_assembly:Astyanax_mexicanus-2.0:19:270... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd21.360e-7428.89frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000011009.16.560e-7227.86pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd7a7.434e-7227.81frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8a2.528e-3927.43frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd3b7.646e-3528.95frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fzd-4-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385671.181e-8731.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357514.438e-8029.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308658.218e-7229.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429322.358e-6929.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325007.691e-2339.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fzd-4-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd101.016e-9232.02frizzled class receptor 10 [Source:NCBI gene;Acc:1... [more]
fzd9b3.315e-9031.48frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
fzd7b3.409e-7628.55frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd48.097e-7631.53frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd8a6.398e-7428.20frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fzd-4-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038967.10.000e+099.84SMESG000038967.1[more]
SMESG000038967.10.000e+099.83SMESG000038967.1[more]
SMESG000004519.15.021e-10735.00SMESG000004519.1[more]
SMESG000035834.15.748e-7829.47SMESG000035834.1[more]
SMESG000035834.12.719e-7329.57SMESG000035834.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024996 ID=SMED30024996|Name=Fzd-4-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2134bp
TATTATATTGCATTGGCTATTGTATTTTATGCTTAATATTTTTCTATAAA
ATAGTTTATTGAATTAAATTCTAATAACAATGATCATTTTATTTAATGGT
TTCGTTGTGTTATTTTGTTTTTTAAAACTCCACAAACTCTCTGCTATTTT
ATTTAAGTCCAATAATGCACACGAAGATGTCTACAATCGATGTGATAAAA
TCAACCAGCAAATTTGTCAAGGCTTGCAATATGACAAGACTAGAATGCCA
AATTCTGTCGGGATTACAAATCAAGAGGATTCAGCAAAACGTATGAATGA
TTATTTTCCATTAATTAACGCACAGTGTTCATATTATTTTCGGTTTTTCC
TATGCACCTTTTATTTTCCAATGTGTACCGATATGTTGGGTGAAACGAAA
ACTCTGCTTCCTTGCCGGGAAATGTGTGAGAAAGTTCAAATTCGGTGTGA
ACCGTTTATGAAAGCATTCAAATTGAAATGGCCAGCCGAACTGAATTGTA
AAAAGTTCCCCATGAATACAGAAATCTGCATTCGACCAACGAATTACGAT
CTCGATCGAAACCTTTCATTCAATGCCAATGGACTGGATTATTTGAAAAA
ACACTATCCGAAATGGAAATCAATTTTTTATGTCGATGGAAATGTTAAAA
CAAACAGATTGGAGAACTTTGAAACCGAGATCAATCTCAAATGTCTTGAC
AGTCACGTTTCCGTGAAATCCGCTGTGGATAATAGAACAAAATCAAAATC
TTACTCTTGCGTTCCGAAATGCGATTCGAATATTTGGTATAGTTCGTCCG
ATAAAAATCTCGCTCGGATTTGGTATTTTATTTGGACGATTTTGTGTTTG
ATTTCGAGCATTGTTGCCATTGCTACTTTTGTTTTTGATCAGAAAGTAAG
ATTTTTATATCCTGAACGGCCGATTATTTTTATTGTTTTATGTTACGGTT
GTATTTGTGTTTTCAATTTATTCCATTTGGGGCTTGATCGCAAACGGCTC
GTTTGTCAGATTCTTCACACACACCCAAACGATATGATTTTGATGAAAGA
AGGTTATGAAAGTCCAATGTGTACCTTGACGTTTTTGGGGATGTATTATT
TTGAAATGGTAGCCGCTTTGTGGTGGCTGATGTTGGCGATAAGTTGTTAT
TTAGCTTCAGAAAGAAAATGGAGTTGTGAAGGATTGGAGAGAATTAGTAA
TGCCATGCACATCGTGTCGTGGACTCTGCCTGCCATTAGTACGACAATTG
TGTTGATTCTCCATAAAATAGATCCGGATGAATTGCTTGGAAGTTGTTAT
GTCGGTCGACAGAATTCCAGGTCAAATCTTTTTTTCATTTTAATACCAAG
AATCCTTTGCTTTTTATTGGGTTCAGTGTTGTTGATTTTGTCTTTTCGAT
CACTGATGGTTTTGAGACAAAATATCGCTCACAATAAACTAAATTTGATA
TTGGATTCTATTCAAAATCAACAGAGTCTAGAAAAATTTATTGCTAAAAC
TGGTATATTCTGTGGAGTTTATGGAGTTCCAATGACGTGCTACATTGGCT
GTCAGTTGTATTATTATTTACATATTGATGAATGGAATAAGTTAGGAGAT
ATAGCCGCAAATCTTGGAGAAGAATGTGTCAATAAATTTGGGCTTAGGTG
GTCAGATAAGTCATGCTTGAAAGGTTTACCACTGCCATTGGTTGAAGTAC
GACTACTGGAAATATTTTCCACCCTTGTTATTGGCATTACCAGTGGAATG
TGGATGTGGTGCAACAAAAAAACTTTGTTGAATTTACACAGATATCTTGT
CTCAGAAATCACTTGCCGAAATAAAGAAAATCCAATAATGAACTATTCCA
TACCGTTGAAAGATGCCCACCCATTGAGTCCGATTAATCCACAAATTGAA
TCATCAATTTCTATCAGTAAATTGAAATATCATGAATTGGATACCAATTC
AAAATACAAAAACGATCTCGCCATATTTAACAAGCAAGTTTTAATGTGCA
ATGTGTAACGTTTGCCTCGGGCCCTTCCCCTTTTCCTTTCTTTTTTAAAA
ATTTAAAACAAAATTCTTTTGGCATGATCCAAATTATTAACGTGATTCAA
ATTCTATTCATTTTATTCAATCATCAATTATTGT
back to top

protein sequence of SMED30024996-orf-1

>SMED30024996-orf-1 ID=SMED30024996-orf-1|Name=SMED30024996-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MIILFNGFVVLFCFLKLHKLSAILFKSNNAHEDVYNRCDKINQQICQGLQ
YDKTRMPNSVGITNQEDSAKRMNDYFPLINAQCSYYFRFFLCTFYFPMCT
DMLGETKTLLPCREMCEKVQIRCEPFMKAFKLKWPAELNCKKFPMNTEIC
IRPTNYDLDRNLSFNANGLDYLKKHYPKWKSIFYVDGNVKTNRLENFETE
INLKCLDSHVSVKSAVDNRTKSKSYSCVPKCDSNIWYSSSDKNLARIWYF
IWTILCLISSIVAIATFVFDQKVRFLYPERPIIFIVLCYGCICVFNLFHL
GLDRKRLVCQILHTHPNDMILMKEGYESPMCTLTFLGMYYFEMVAALWWL
MLAISCYLASERKWSCEGLERISNAMHIVSWTLPAISTTIVLILHKIDPD
ELLGSCYVGRQNSRSNLFFILIPRILCFLLGSVLLILSFRSLMVLRQNIA
HNKLNLILDSIQNQQSLEKFIAKTGIFCGVYGVPMTCYIGCQLYYYLHID
EWNKLGDIAANLGEECVNKFGLRWSDKSCLKGLPLPLVEVRLLEIFSTLV
IGITSGMWMWCNKKTLLNLHRYLVSEITCRNKENPIMNYSIPLKDAHPLS
PINPQIESSISISKLKYHELDTNSKYKNDLAIFNKQVLMCNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 635..642
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 204..576
e-value: 8.6E-91
score: 306.3
NoneNo IPR availablePANTHERPTHR11309:SF99FRIZZLED-3coord: 38..579
NoneNo IPR availableCDDcd159097tmF_FZD4_9_10-likecoord: 237..573
e-value: 2.71161E-99
score: 304.613
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.788
NoneNo IPR availableTMHMMTMhelixcoord: 540..562
NoneNo IPR availableTMHMMTMhelixcoord: 282..301
NoneNo IPR availableTMHMMTMhelixcoord: 247..269
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 417..439
NoneNo IPR availableTMHMMTMhelixcoord: 372..394
NoneNo IPR availableTMHMMTMhelixcoord: 475..497
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 470..491
score: 33.64
coord: 540..560
score: 39.24
coord: 248..270
score: 29.91
coord: 376..399
score: 33.5
coord: 277..299
score: 41.39
coord: 333..357
score: 31.36
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 235..580
e-value: 1.1E-77
score: 274.0
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 237..568
e-value: 9.3E-80
score: 268.1
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 37..155
e-value: 1.1E-36
score: 137.9
IPR020067Frizzled domainPFAMPF01392Fzcoord: 38..147
e-value: 5.0E-26
score: 91.5
IPR020067Frizzled domainPROSITEPS50038FZcoord: 33..153
score: 23.53
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 33..160
e-value: 4.0E-34
score: 119.5
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 37..148
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 38..579
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 245..567
score: 23.797