THAP-type domain-containing protein

Overview
NameTHAP-type domain-containing protein
Smed IDSMED30024994
Length (bp)2086
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of THAP-type domain-containing protein (SMED30024994) t-SNE clustered cells

Violin plots show distribution of expression levels for THAP-type domain-containing protein (SMED30024994) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of THAP-type domain-containing protein (SMED30024994) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for THAP-type domain-containing protein (SMED30024994) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024994

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024994SMESG000028189.1 SmedASXL_008156SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30024994SMESG000028189.1 SmedASXL_008157SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30024994SMESG000028189.1 SmedASXL_008156SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
headSMED30024994SMESG000028189.1 dd_Smed_v6_24541_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30024994SMESG000028189.1 dd_Smed_v6_43551_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30024994SMESG000028189.1 Contig44799newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024994SMESG000028189.1 Contig44799uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP1 (C-terminal binding protein 1 [Source:HGNC Symbol;Acc:HGNC:2494])

HSP 1 Score: 132.88 bits (333), Expect = 1.115e-32
Identity = 101/334 (30.24%), Postives = 173/334 (51.80%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   16 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 132.88 bits (333), Expect = 1.451e-32
Identity = 111/358 (31.01%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + PL          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   E  IA+  I +  V+E AD+ IC ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G+TG AVA+RA+ FGF+V FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     ESLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPL--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 132.88 bits (333), Expect = 1.451e-32
Identity = 111/358 (31.01%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + PL          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   E  IA+  I +  V+E AD+ IC ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G+TG AVA+RA+ FGF+V FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     ESLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPL--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 132.88 bits (333), Expect = 1.451e-32
Identity = 111/358 (31.01%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + PL          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   E  IA+  I +  V+E AD+ IC ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G+TG AVA+RA+ FGF+V FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     ESLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPL--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 132.88 bits (333), Expect = 1.451e-32
Identity = 111/358 (31.01%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + PL          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   E  IA+  I +  V+E AD+ IC ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G+TG AVA+RA+ FGF+V FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     ESLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPL--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 254.603 bits (649), Expect = 2.055e-74
Identity = 184/554 (33.21%), Postives = 283/554 (51.08%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLDRLLKVS------NSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGA---VVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRNT 1787
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR RWL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK IK+ELPPK  ++S   +R K+ I +           FP   S    S S              ++ F + +  L+S                F P        PP    +P  Q A  D L   S      +S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E+++    ++   N+   + ++G  LG++G G+ G AV +RAR FG ++ FYD  +  G+D  LG  RV ++ + +  SDCIS++ +   +    I+ +     K G Y VN S    +        +    + GA   V ++   +   ++ L+  P   I   P     +++   ++R  A  E+R+ +     + L  C+NK E V RN+
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNSD--RRRKQNIPA----------RFPRPESPSGDSPSYSKK----------SRSFRDFYPSLSSTP-------------SFDPAQSPHTPHPPV---LPDPQQALNDILSMTSTRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCP--NIINTPHSAWMTEASCKDLRINAAKEIRKAINGRCPQDLTHCINK-EAVMRNS 512          
BLAST of THAP-type domain-containing protein vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 108.997 bits (271), Expect = 1.720e-24
Identity = 89/341 (26.10%), Postives = 168/341 (49.27%), Query Frame = 3
Query:  774 SNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVV---NAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRNT 1787
            S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E+++    ++   N+   + ++G  LG++G G+ G AV +RAR FG ++ FYD  +  G+D  LG  RV ++ + +  SDCIS++ +   +    I+ +     K G Y VN S    +        +    + GA +   ++   +   ++ L+  P   I   P     +++   ++R  A  E+R+ +     + L  C+NK E V RN+
Sbjct:   55 SSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCP--NIINTPHSAWMTEASCKDLRINAAKEIRKAINGRCPQDLTHCINK-EAVMRNS 391          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0082701)

HSP 1 Score: 134.42 bits (337), Expect = 6.720e-34
Identity = 110/347 (31.70%), Postives = 173/347 (49.86%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKA---NTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMS------------SVPAMKLTKNVLNVFE----DIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNK 1763
            +P V +LD     I+  IL  +    + +  +   + ++ LN    A   +TI+    L+K  + KF++L+ +V+IG    + DV+   E  IA+  +    V+E+ADT +CLILNLYR T +L N   E K+     +    +H    I+G TLGL+GLG+ G AVA+RA+ FGFNV FYD  L  G D  LGL RV +LQ LL +SDC+S++          I+       + G++ VN +            ++   ++    L+V E    ++  GA+ +A N+  T                P    +S +   E+RE A  E+RR ++    + LR+CVNK
Sbjct:   27 RPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII----LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICT----------------PHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK 353          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0082702)

HSP 1 Score: 134.42 bits (337), Expect = 6.720e-34
Identity = 110/347 (31.70%), Postives = 173/347 (49.86%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKA---NTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMS------------SVPAMKLTKNVLNVFE----DIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNK 1763
            +P V +LD     I+  IL  +    + +  +   + ++ LN    A   +TI+    L+K  + KF++L+ +V+IG    + DV+   E  IA+  +    V+E+ADT +CLILNLYR T +L N   E K+     +    +H    I+G TLGL+GLG+ G AVA+RA+ FGFNV FYD  L  G D  LGL RV +LQ LL +SDC+S++          I+       + G++ VN +            ++   ++    L+V E    ++  GA+ +A N+  T                P    +S +   E+RE A  E+RR ++    + LR+CVNK
Sbjct:   27 RPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII----LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICT----------------PHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK 353          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0082699)

HSP 1 Score: 134.42 bits (337), Expect = 6.720e-34
Identity = 110/347 (31.70%), Postives = 173/347 (49.86%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKA---NTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMS------------SVPAMKLTKNVLNVFE----DIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNK 1763
            +P V +LD     I+  IL  +    + +  +   + ++ LN    A   +TI+    L+K  + KF++L+ +V+IG    + DV+   E  IA+  +    V+E+ADT +CLILNLYR T +L N   E K+     +    +H    I+G TLGL+GLG+ G AVA+RA+ FGFNV FYD  L  G D  LGL RV +LQ LL +SDC+S++          I+       + G++ VN +            ++   ++    L+V E    ++  GA+ +A N+  T                P    +S +   E+RE A  E+RR ++    + LR+CVNK
Sbjct:   27 RPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII----LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICT----------------PHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK 353          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0082700)

HSP 1 Score: 134.42 bits (337), Expect = 6.720e-34
Identity = 110/347 (31.70%), Postives = 173/347 (49.86%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKA---NTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMS------------SVPAMKLTKNVLNVFE----DIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNK 1763
            +P V +LD     I+  IL  +    + +  +   + ++ LN    A   +TI+    L+K  + KF++L+ +V+IG    + DV+   E  IA+  +    V+E+ADT +CLILNLYR T +L N   E K+     +    +H    I+G TLGL+GLG+ G AVA+RA+ FGFNV FYD  L  G D  LGL RV +LQ LL +SDC+S++          I+       + G++ VN +            ++   ++    L+V E    ++  GA+ +A N+  T                P    +S +   E+RE A  E+RR ++    + LR+CVNK
Sbjct:   27 RPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII----LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICT----------------PHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK 353          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334516)

HSP 1 Score: 133.265 bits (334), Expect = 1.436e-33
Identity = 110/344 (31.98%), Postives = 173/344 (50.29%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKA---NTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMS------------SVPAMKLTKNVLNVFE-DIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNK 1763
            +P V +LD     I+  IL  +    + +  +   + ++ LN    A   +TI+    L+K  + KF++L+ +V+IG    + DV+   E  IA+  +    V+E+ADT +CLILNLYR T +L N   E K+     +    +H    I+G TLGL+GLG+ G AVA+RA+ FGFNV FYD  L  G D  LGL RV +LQ LL +SDC+S++          I+       + G++ VN +            ++   ++    L+V E +  +GA+ +A N+  T                P    +S +   E+RE A  E+RR ++    + LR+CVNK
Sbjct:   27 RPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII----LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNGALKDAPNLICT----------------PHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK 350          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 131.724 bits (330), Expect = 2.354e-32
Identity = 107/358 (29.89%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+ FGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFTQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 130.954 bits (328), Expect = 2.426e-32
Identity = 107/358 (29.89%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+ FGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFTQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 130.954 bits (328), Expect = 2.426e-32
Identity = 107/358 (29.89%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+ FGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFTQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 130.568 bits (327), Expect = 2.550e-32
Identity = 107/358 (29.89%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+ FGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFTQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 130.568 bits (327), Expect = 2.550e-32
Identity = 107/358 (29.89%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+ FGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFTQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: lzts3 (leucine zipper, putative tumor suppressor family member 3 [Source:Xenbase;Acc:XB-GENE-961223])

HSP 1 Score: 134.806 bits (338), Expect = 2.468e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   22 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKTFGFNVYFYDPYLSDGIERALGLQRVSTLQDLLFNSDCVTLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGALKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 351          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: lzts3 (leucine zipper, putative tumor suppressor family member 3 [Source:Xenbase;Acc:XB-GENE-961223])

HSP 1 Score: 134.42 bits (337), Expect = 2.790e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   16 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKTFGFNVYFYDPYLSDGIERALGLQRVSTLQDLLFNSDCVTLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGALKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: lzts3 (leucine zipper, putative tumor suppressor family member 3 [Source:Xenbase;Acc:XB-GENE-961223])

HSP 1 Score: 134.42 bits (337), Expect = 2.844e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   16 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKTFGFNVYFYDPYLSDGIERALGLQRVSTLQDLLFNSDCVTLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGALKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: lzts3 (leucine zipper, putative tumor suppressor family member 3 [Source:Xenbase;Acc:XB-GENE-961223])

HSP 1 Score: 134.806 bits (338), Expect = 2.877e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   27 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKTFGFNVYFYDPYLSDGIERALGLQRVSTLQDLLFNSDCVTLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGALKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 356          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: lzts3 (leucine zipper, putative tumor suppressor family member 3 [Source:Xenbase;Acc:XB-GENE-961223])

HSP 1 Score: 134.42 bits (337), Expect = 3.207e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   20 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKTFGFNVYFYDPYLSDGIERALGLQRVSTLQDLLFNSDCVTLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGALKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 349          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 134.42 bits (337), Expect = 2.113e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   16 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 134.42 bits (337), Expect = 2.938e-33
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   27 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 356          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp2 (C-terminal binding protein 2 [Source:MGI Symbol;Acc:MGI:1201686])

HSP 1 Score: 132.109 bits (331), Expect = 1.610e-32
Identity = 110/358 (30.73%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + PL          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G+TG AVA+RA+ FGF+V FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     ESLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPL--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp2 (C-terminal binding protein 2 [Source:MGI Symbol;Acc:MGI:1201686])

HSP 1 Score: 130.954 bits (328), Expect = 3.100e-32
Identity = 104/335 (31.04%), Postives = 172/335 (51.34%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G+TG AVA+RA+ FGF+V FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     ESLR+CVNK   V
Sbjct:    8 RPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFV 338          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 128.642 bits (322), Expect = 6.245e-32
Identity = 93/279 (33.33%), Postives = 151/279 (54.12%), Query Frame = 3
Query:  942 NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
             L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:    6 TLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 282          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q20595|CTBP1_CAEEL (C-terminal-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ctbp-1 PE=1 SV=3)

HSP 1 Score: 254.603 bits (649), Expect = 2.614e-73
Identity = 184/554 (33.21%), Postives = 283/554 (51.08%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLDRLLKVS------NSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGA---VVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRNT 1787
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR RWL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK IK+ELPPK  ++S   +R K+ I +           FP   S    S S              ++ F + +  L+S                F P        PP    +P  Q A  D L   S      +S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E+++    ++   N+   + ++G  LG++G G+ G AV +RAR FG ++ FYD  +  G+D  LG  RV ++ + +  SDCIS++ +   +    I+ +     K G Y VN S    +        +    + GA   V ++   +   ++ L+  P   I   P     +++   ++R  A  E+R+ +     + L  C+NK E V RN+
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNSD--RRRKQNIPA----------RFPRPESPSGDSPSYSKK----------SRSFRDFYPSLSSTP-------------SFDPAQSPHTPHPPV---LPDPQQALNDILSMTSTRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCP--NIINTPHSAWMTEASCKDLRINAAKEIRKAINGRCPQDLTHCINK-EAVMRNS 512          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9YHU0|CTBP1_XENLA (C-terminal-binding protein 1 OS=Xenopus laevis OX=8355 GN=ctbp1 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.105e-32
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   27 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKTFGFNVFFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFTQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 356          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z2F5|CTBP1_RAT (C-terminal-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=3)

HSP 1 Score: 134.42 bits (337), Expect = 1.667e-32
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   16 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 345          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O88712|CTBP1_MOUSE (C-terminal-binding protein 1 OS=Mus musculus OX=10090 GN=Ctbp1 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 2.055e-32
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNEL 1772
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +V+IG    + D++   +  IA+  + A  V+E AD+ +C ILNLYR T++L  +  E  ++    +    +     I+G+TLG+IGLG+ G AVA+RA+ FGFNV FYD  LS G +  LGL+RV +LQ LL  SDC++++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   +EMRE+A  E+RR +     +SL++CVNK+ L
Sbjct:   27 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAP--NLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHL 356          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O46036|CTBP_DROME (C-terminal-binding protein OS=Drosophila melanogaster OX=7227 GN=CtBP PE=1 SV=3)

HSP 1 Score: 134.806 bits (338), Expect = 2.612e-32
Identity = 110/347 (31.70%), Postives = 173/347 (49.86%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKA---NTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMS------------SVPAMKLTKNVLNVFE----DIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNK 1763
            +P V +LD     I+  IL  +    + +  +   + ++ LN    A   +TI+    L+K  + KF++L+ +V+IG    + DV+   E  IA+  +    V+E+ADT +CLILNLYR T +L N   E K+     +    +H    I+G TLGL+GLG+ G AVA+RA+ FGFNV FYD  L  G D  LGL RV +LQ LL +SDC+S++          I+       + G++ VN +            ++   ++    L+V E    ++  GA+ +A N+  T                P    +S +   E+RE A  E+RR ++    + LR+CVNK
Sbjct:   27 RPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII----LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICT----------------PHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK 353          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A2A2KNE1 (THAP-type domain-containing protein OS=Diploscapter pachys OX=2018661 GN=WR25_16236 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 1.273e-80
Identity = 197/551 (35.75%), Postives = 299/551 (54.26%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQDLNS-NTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPC--VDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQS-ISPNLFGYFKK--GSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE---STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVH 1778
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR +WL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK + +ELPPK  +S    +RNK       + ++P     P        + S   S+S         Q   ++FQ+ +  + +     + G+ LNG            PS                     ++P V +LD     I+  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF++L+ VV+IG +  + D++  TE  IA  V   PC  ++E+AD  I  +LNLYR T +L  +  E +++         +   R ++G+ LGLIGLG+ G AVA+RA+VFG  V FYD  LS G D  LG+ R DSL++L+ +SD IS++  P  D +   I+ +   Y KK  G + +N S    +        + E ++ GA ++   IE   +++++ L +LP  ++   P    +S+    E+R  A  EVRR +LN   + L++CVNK++L+ 
Sbjct:    1 MPTTCGFPNCKFRSRYRGQEDNRHFYRIPKRPQILRQKWLHAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQLNIELPPKEHKSGER-RRNKTSPTVPKNSLVPTKSRIPDIFRSSLDTASLPTSSSFKLDQSDQQQQQPSLFQERSHLHELLAMSAASGARLNG------------PSM--------------------SRPLVALLDGRDCSIEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIRLEKEDLEKFKALRIVVRIGSTADNIDIKAATELGIA--VCHTPCEYIEEVADFTISQLLNLYRKTYWLAKACSEGRKVSGLENVRELAAGSRRLRGEVLGLIGLGRIGTAVALRAKVFGLRVVFYDPLLSDGVDKSLGIDRCDSLEELMAQSDVISLHC-PLNDTTHHMINEHTMRYCKKEGGIFIINTSKGGLINEMDLARAIKEGVVKGAALDVHEIEPFDTSLLNPLRDLP--QVIHTPNAAWFSEGTCRELRVHAAKEVRRAILNRFPQDLQNCVNKDKLLQ 512          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A261CQW0 (THAP-type domain-containing protein (Fragment) OS=Caenorhabditis latens OX=1503980 GN=FL83_00450 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 4.848e-73
Identity = 184/561 (32.80%), Postives = 280/561 (49.91%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQ--DLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAP-----LDRLLKVSN-------SNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVV---NAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRN 1784
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR RWL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK IK+ELPPK  ++S     ++RR                                          Q+  N F   +  S    +Y     S  + +  L   P   P      P  Q  P     L+ +L ++N       S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E+++    ++   N+   + ++G  LG++G G+ G AV +RA+ FG +V FYD  +  G+D  LG  RV SL + +  SDCIS++ +   +    IS +     K G + VN S    +        +    + GA +   ++   +   ++ L+  P   I   P     ++S   E+R QA  E+R+ +     + L  C+NK E V RN
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNS-----DRRR-----------------------------------------KQNIPNRFSRPESPSGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPQTPHQQVLPDPQQALNDILSMTNPRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYTETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRAKAFGLHVIFYDPFVRDGHDKALGFERVSSLDEFMSRSDCISLHCNLGDETRGIISADTLRQCKPGIFIVNTSHAGLINENDLAAALKSGHVKGAALDVHDSVRFDPNCLNPLIGCP--NIINTPHSAWMTESACKELRIQAAKEIRKAINGRCPQDLTHCINK-EAVMRN 511          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A261BCV1 (THAP-type domain-containing protein (Fragment) OS=Caenorhabditis remanei OX=31234 GN=FL82_01799 PE=4 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 4.903e-73
Identity = 184/561 (32.80%), Postives = 280/561 (49.91%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQ--DLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAP-----LDRLLKVSN-------SNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVV---NAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRN 1784
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR RWL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK IK+ELPPK  ++S     ++RR                                          Q+  N F   +  S    +Y     S  + +  L   P   P      P  Q  P     L+ +L ++N       S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E+++    ++   N+   + ++G  LG++G G+ G AV +RA+ FG +V FYD  +  G+D  LG  RV SL + +  SDCIS++ +   +    IS +     K G + VN S    +        +    + GA +   ++   +   ++ L+  P   I   P     ++S   E+R QA  E+R+ +     + L  C+NK E V RN
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNS-----DRRR-----------------------------------------KQNIPNRFSRPESPSGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPQTPHQQVLPDPQQALNDILSMTNTRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYTETRKTIGADQVRENAVGSKKVRGCVLGVLGCGRVGTAVGLRAKAFGLHVIFYDPFVRDGHDKALGFERVSSLDEFMSRSDCISLHCNLGDETRGIISADTLRQCKPGIFIVNTSHAGLINENDLAAALKSGHVKGAALDVHDSVRFDPNCLNPLIGCP--NIINTPHSAWMTESACKELRIQAAKEIRKAINGRCPQDLTHCINK-EAVMRN 511          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A2P4WPR5 (THAP-type domain-containing protein OS=Caenorhabditis remanei OX=31234 GN=FL81_02459 PE=4 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 8.702e-73
Identity = 184/561 (32.80%), Postives = 280/561 (49.91%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQ--DLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAP-----LDRLLKVSN-------SNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVV---NAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRN 1784
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR RWL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK IK+ELPPK  ++S     ++RR                                          Q+  N F   +  S    +Y     S  + +  L   P   P      P  Q  P     L+ +L ++N       S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E+++    ++   N+   + ++G  LG++G G+ G AV +RA+ FG +V FYD  +  G+D  LG  RV SL + +  SDCIS++ +   +    IS +     K G + VN S    +        +    + GA +   ++   +   ++ L+  P   I   P     ++S   E+R QA  E+R+ +     + L  C+NK E V RN
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNS-----DRRR-----------------------------------------KQNIPNRFSRPESPSGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPQTPHQQVLPDPQQALNDILSMTNTRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYTETRKTIGADQVRENAVGSKKVRGSVLGVLGCGRVGTAVGLRAKAFGLHVIFYDPFVRDGHDKALGFERVSSLDEFMSRSDCISLHCNLGDETRGIISADTLRQCKPGIFIVNTSHAGLIIENDLAAALKSGHVKGAALDVHDSVRFDPNCLNPLIGCP--NIINTPHSAWMTESACKELRIQAAKEIRKAINGRCPQDLTHCINK-EAVMRN 511          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: E3LDT9 (CRE-CTBP-1 protein OS=Caenorhabditis remanei OX=31234 GN=Cre-ctbp-1 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 2.082e-67
Identity = 183/591 (30.96%), Postives = 276/591 (46.70%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQ--DLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAP-----LDRLLKVSN-------SNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXX---------------XAVAIRARVFGFNVKFYDSTLSPGNDWYL---------------GLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVV---NAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRN 1784
            MPTTCGFPNCKFRSRYRG +DNRHFYR+PK+P ILR RWL AIGRTEET+VSQLR+CS HF GGEKKEGD+PV DP++DK IK+ELPPK  ++S     ++RR                                          Q+  N F   +  S    +Y     S  + +  L   P   P      P  Q  P     L+ +L ++N       S++P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   L K  + KF+ LK V +IG  + + DV+  TE  IA+       V+++AD+ + LIL+L+R T +   S  E++++F  N    ++  V+ I    +    +G                   AV +RA+ FG +V FYD  +  G+D  L               GL RV SL + +  SDCIS++ +   +    IS +     K G + VN S    +        +    + GA +   ++   +   ++ L+  P   I   P     ++S   E+R QA  E+R+ +     + L  C+NK E V RN
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNS-----DRRR-----------------------------------------KQNIPNRFSRPESPSGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPQTPHQQVLPDPQQALNDILSMTNTRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYTETRKVFSSNSLDFSTKTVQTIGADQVRENAVGSKKVRGSVLGVLGCGRVGTAVGLRAKAFGLHVIFYDPFVRDGHDKALGFERYKLNFVVLNNYGLFRVSSLDEFMSRSDCISLHCNLGDETRGIISADTLRQCKPGIFIVNTSHAGLIIENDLAAALKSGHVKGAALDVHDSVRFDPNCLNPLIGCP--NIINTPHSAWMTESACKELRIQAAKEIRKAINGRCPQDLTHCINK-EAVMRN 541          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000001402.2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:103043993])

HSP 1 Score: 132.88 bits (333), Expect = 6.347e-33
Identity = 103/335 (30.75%), Postives = 173/335 (51.64%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+VFGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   26 RPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVLFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 356          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000050975.1 (C-terminal binding protein 2 [Source:NCBI gene;Acc:103043993])

HSP 1 Score: 132.494 bits (332), Expect = 8.973e-33
Identity = 103/335 (30.75%), Postives = 173/335 (51.64%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+VFGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   34 RPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVLFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFAQGPLKDAP--NLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 364          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:103035478])

HSP 1 Score: 130.954 bits (328), Expect = 3.306e-32
Identity = 104/338 (30.77%), Postives = 175/338 (51.78%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQS----ISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   LS+  + KF+ L+ +V+IG    + DV+   E  IA+  + A  V+E ADT +CLILNLYR  +++  +  E  +     +    +     I+G+TLG+IGLG+ G AVA+RA+ FGF V FYD  L  G +  LGL+R+ +LQ LL+ SDC+S++    C  ++     I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P  + YS+   +E RE+A  EVRR +     +SL++CVNK  L+
Sbjct:   33 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALLYHTITLSRDDLDKFKGLRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSMCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPEGVERSLGLQRMATLQDLLIHSDCVSLH----CSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAP--NLICTPHTSWYSEQASIEAREEAAREVRRAITGRIPDSLKNCVNKEYLM 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:103035478])

HSP 1 Score: 130.954 bits (328), Expect = 3.306e-32
Identity = 104/338 (30.77%), Postives = 175/338 (51.78%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQS----ISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   LS+  + KF+ L+ +V+IG    + DV+   E  IA+  + A  V+E ADT +CLILNLYR  +++  +  E  +     +    +     I+G+TLG+IGLG+ G AVA+RA+ FGF V FYD  L  G +  LGL+R+ +LQ LL+ SDC+S++    C  ++     I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P  + YS+   +E RE+A  EVRR +     +SL++CVNK  L+
Sbjct:   33 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALLYHTITLSRDDLDKFKGLRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSMCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPEGVERSLGLQRMATLQDLLIHSDCVSLH----CSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAP--NLICTPHTSWYSEQASIEAREEAAREVRRAITGRIPDSLKNCVNKEYLM 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:103035478])

HSP 1 Score: 130.568 bits (327), Expect = 4.134e-32
Identity = 104/338 (30.77%), Postives = 175/338 (51.78%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQS----ISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   LS+  + KF+ L+ +V+IG    + DV+   E  IA+  + A  V+E ADT +CLILNLYR  +++  +  E  +     +    +     I+G+TLG+IGLG+ G AVA+RA+ FGF V FYD  L  G +  LGL+R+ +LQ LL+ SDC+S++    C  ++     I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P  + YS+   +E RE+A  EVRR +     +SL++CVNK  L+
Sbjct:   20 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALLYHTITLSRDDLDKFKGLRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSMCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPEGVERSLGLQRMATLQDLLIHSDCVSLH----CSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAP--NLICTPHTSWYSEQASIEAREEAAREVRRAITGRIPDSLKNCVNKEYLM 350          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: zgc:136929 (C-terminal binding protein 1 [Source:NCBI gene;Acc:101164069])

HSP 1 Score: 134.035 bits (336), Expect = 3.228e-33
Identity = 107/338 (31.66%), Postives = 173/338 (51.18%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRN 1784
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L K  + KF++L+ +V+IG    + D++   E  IA+  + A  V+E AD+ +C IL LYR T++L  +  E  ++    +    +     I+G+TLGLIGLG+ G AVA+RA+VFGFNV FYD  L+ G +  LGL+RV +LQ LL  SDC+S++          I+       ++G++ VN +    +        + E  I GA ++    E  S     L + P   +   P    YS+   LEMRE+A  E+RR +     +SL++CVNK  L   N
Sbjct:   27 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLN--EAVGALMYHTITLMKEDLEKFKALRIIVRIGSGYDNIDIKSAGELGIAVCNMPAASVEETADSTLCHILTLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGLIGLGRVGQAVALRAKVFGFNVIFYDPYLADGVERSLGLQRVTTLQDLLFHSDCVSLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAP--NLICTPHAAWYSEQASLEMREEAAREIRRAVTGRIPDSLKNCVNKEFLSQNN 360          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 132.109 bits (331), Expect = 8.283e-33
Identity = 109/357 (30.53%), Postives = 180/357 (50.42%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIES-TIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+VFGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  T     L+   N I   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFTFAQGPLKDAPNLIC-TPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 132.494 bits (332), Expect = 8.604e-33
Identity = 104/334 (31.14%), Postives = 173/334 (51.80%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIES-TIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+VFGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  T     L+   N I   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   21 RPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFTFAQGPLKDAPNLICT-PHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 351          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:101158706])

HSP 1 Score: 132.494 bits (332), Expect = 8.942e-33
Identity = 105/338 (31.07%), Postives = 174/338 (51.48%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQS----ISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIE--STIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            +P V +LD     ++  IL  +    + +  + + + ++ LN  + A  + +   LS+  + KF+ L+ +V+IG    + DV+   E  IA+  + A  V+E ADT +CLILNLYR  +++  +  E  +     +    +     I+G+TLG+IGLG+ G AVA+RA+ FGF V FYD  L  G +  LGL+R+ +LQ LL+ SDC+S++    C  ++     I+       ++G++ VN S    +        + E  I GA ++    E  S     L + P   +   P    YS+   +E RE+A  EVRR +     +SL++CVNK  L+
Sbjct:   16 RPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNE-AVAALLYHTITLSRDDLEKFKGLRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSLCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPDGVERSLGLQRMATLQDLLIHSDCVSLH----CSLNEHNHHLINDFTIKQMRQGAFLVNTSRGGLVDEKALAQALKEGRIRGAALDVHEAEPFSFSTGPLKDAP--NLICTPHTAWYSEQASVEAREEAAREVRRAITGRIPDSLKNCVNKEYLM 346          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 132.494 bits (332), Expect = 1.061e-32
Identity = 109/357 (30.53%), Postives = 180/357 (50.42%), Query Frame = 3
Query:  714 CNGI-PVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIES-TIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELV 1775
            C GI P   + P+          +P V +LD     ++  IL  +    + +  + + + ++ LN       ++Y    L++  + KF++L+ +++IG    + D++   E  IA+  I +  V+E AD+ +C ILNLYR  ++L  +  E  ++    +    +     I+G+TLGLIG G++G AVA+RA+VFGFNV FYD  L  G +  LG++RV +LQ LL +SDC+S++ +        I+       ++G++ VN +    +        + E  I GA ++    E  T     L+   N I   P    YS+   LEMRE A  E+RR +     +SLR+CVNK   V
Sbjct:   18 CEGIRPQIMNGPM--------HPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLN--EAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFTFAQGPLKDAPNLIC-TPHTAWYSEQASLEMREAAATEIRRAITGRIPDSLRNCVNKEFFV 363          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000028189.1 (SMESG000028189.1)

HSP 1 Score: 1127.85 bits (2916), Expect = 0.000e+0
Identity = 587/589 (99.66%), Postives = 588/589 (99.83%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNIFQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRNTIYESLTKQKLQSTSPDIETVKNFSVESLIFDSKQADAIMDEEFS 1919
            MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPSNSSLFASSNSNIISNSLTNPPLLMNQHFTNIFQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQ+LKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKGQTLGLIGLGQTGIAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRN IYESLTKQKLQSTSPDIETVKNFSVESLIFDSKQADAIMDEEFS
Sbjct:    1 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPSNSSLFASSNSNIISNSLTNPPLLMNQHFTNIFQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLDRLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQLLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKGQTLGLIGLGQTGIAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRNRIYESLTKQKLQSTSPDIETVKNFSVESLIFDSKQADAIMDEEFS 589          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031097.1 (SMESG000031097.1)

HSP 1 Score: 251.521 bits (641), Expect = 1.098e-74
Identity = 174/484 (35.95%), Postives = 254/484 (52.48%), Query Frame = 3
Query:  153 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPXXXXXXXXXXXXXXXXXXXXPPLLMNQHFTNI------FQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGI------PVYQDAPLDRLLKVSNS-------------------NKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHN--SHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVN--IDPACDFSQSISPNLFGYFKKGSYFVNM 1496
            MPTTCGFPNCKFRSRYRGSDD RHFYRVPKKP+ LRM+WLEAIGRTEETIVSQLRVCSGHF GGEKKEGDVPV+DPS DK +KVE+PPK  R+SS  ++ + +   L   IL   K                  +    P + +NQ  + +      F    S    N  NSF  + N  +PL    F +P + N         + Q +  D L  +S +                    +  ++I+D   +P+D   L  I         TIE    +  + +     I++   +L+K  V+  ++++H+ KIG  + + D   +  +NI L  I +  +DE+AD ++  +L  YR+    T S +   + F+ N  P N     VR IK   LG+IG G   +++A RA+VFGFNV  +DS++     W  G+  V++++ +L   DCI +N  I+  CD ++ +   L    K G++ +++
Sbjct:    1 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKK-----------------SHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSF--MQNLLAPLI---FSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIF--PTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFK-NDKPFNILCQNVRQIKSNCLGIIGGGPLSLSIANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQVLLKL----KPGNFIIDL 453          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000039168.1 (SMESG000039168.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.190e-30
Identity = 99/336 (29.46%), Postives = 169/336 (50.30%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNG-SLESLRSCVNKNELVHRN 1784
            +P V +LD     ++  +L  +    + + S+   + +  LN  + A  + +  NL K  + KF+SLK +V+IG    + D++   E  IA+  +    V+E AD+ +C+ILNLYR T +L N   E K+I         +     I+G TLG+IG G+ G AVA+RA+ FGF V FYD  +  G +  +G+ RV +LQ LL +SDC+S++        + I+ +     + G++ VN +    +       ++ +  I    ++    E  ++ D        + + P    +S++   E+RE A  EVRR +      E+LR+C+NK  L + N
Sbjct:   14 RPLVALLDGRDCTVEMPLLKDVATVAFCDASSTSEIHERVLNE-AVAALMWHTINLQKEDLQKFKSLKVIVRIGSGYDNIDIKAAGELGIAVCNVPGYGVEETADSTLCMILNLYRRTYWLANIVKEGKRIAGPEMLKDAAAGCARIRGDTLGIIGFGRVGTAVAMRAQAFGFRVCFYDPYVPDGVERSMGIERVYTLQDLLYQSDCVSLHCSLNDQTKKLINDHTLKMMRPGAFLVNTARGGLIDELALANHLKDGRIRAVALDVVENEPFVLADSHLRDAPNVIVTPHSAYFSEASFRELREAAANEVRRAITTRIPTENLRNCINKEYLSYYN 348          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000039168.1 (SMESG000039168.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.345e-30
Identity = 99/336 (29.46%), Postives = 169/336 (50.30%), Query Frame = 3
Query:  780 KPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNSHRVRPIKXXXXXXXXXXXXXXAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSSVPAMKLTKNVLNVFEDIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQNDYSQSCVLEMREQALYEVRRGLLNG-SLESLRSCVNKNELVHRN 1784
            +P V +LD     ++  +L  +    + + S+   + +  LN  + A  + +  NL K  + KF+SLK +V+IG    + D++   E  IA+  +    V+E AD+ +C+ILNLYR T +L N   E K+I         +     I+G TLG+IG G+ G AVA+RA+ FGF V FYD  +  G +  +G+ RV +LQ LL +SDC+S++        + I+ +     + G++ VN +    +       ++ +  I    ++    E  ++ D        + + P    +S++   E+RE A  EVRR +      E+LR+C+NK  L + N
Sbjct:   15 RPLVALLDGRDCTVEMPLLKDVATVAFCDASSTSEIHERVLNE-AVAALMWHTINLQKEDLQKFKSLKVIVRIGSGYDNIDIKAAGELGIAVCNVPGYGVEETADSTLCMILNLYRRTYWLANIVKEGKRIAGPEMLKDAAAGCARIRGDTLGIIGFGRVGTAVAMRAQAFGFRVCFYDPYVPDGVERSMGIERVYTLQDLLYQSDCVSLHCSLNDQTKKLINDHTLKMMRPGAFLVNTARGGLIDELALANHLKDGRIRAVALDVVENEPFVLADSHLRDAPNVIVTPHSAYFSEASFRELREAAANEVRRAITTRIPTENLRNCINKEYLSYYN 349          
The following BLAST results are available for this feature:
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTBP11.115e-3230.24C-terminal binding protein 1 [Source:HGNC Symbol;A... [more]
CTBP21.451e-3231.01C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP21.451e-3231.01C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP21.451e-3231.01C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP21.451e-3231.01C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctbp-12.055e-7433.21C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
ctbp-11.720e-2426.10C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CtBP6.720e-3431.70gene:FBgn0020496 transcript:FBtr0082701[more]
CtBP6.720e-3431.70gene:FBgn0020496 transcript:FBtr0082702[more]
CtBP6.720e-3431.70gene:FBgn0020496 transcript:FBtr0082699[more]
CtBP6.720e-3431.70gene:FBgn0020496 transcript:FBtr0082700[more]
CtBP1.436e-3331.98gene:FBgn0020496 transcript:FBtr0334516[more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctbp2a2.354e-3229.89C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.426e-3229.89C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.426e-3229.89C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.550e-3229.89C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.550e-3229.89C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lzts32.468e-3330.54leucine zipper, putative tumor suppressor family m... [more]
lzts32.790e-3330.54leucine zipper, putative tumor suppressor family m... [more]
lzts32.844e-3330.54leucine zipper, putative tumor suppressor family m... [more]
lzts32.877e-3330.54leucine zipper, putative tumor suppressor family m... [more]
lzts33.207e-3330.54leucine zipper, putative tumor suppressor family m... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctbp12.113e-3330.54C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
Ctbp12.938e-3330.54C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
Ctbp21.610e-3230.73C-terminal binding protein 2 [Source:MGI Symbol;Ac... [more]
Ctbp23.100e-3231.04C-terminal binding protein 2 [Source:MGI Symbol;Ac... [more]
Ctbp16.245e-3233.33C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q20595|CTBP1_CAEEL2.614e-7333.21C-terminal-binding protein 1 OS=Caenorhabditis ele... [more]
sp|Q9YHU0|CTBP1_XENLA1.105e-3230.54C-terminal-binding protein 1 OS=Xenopus laevis OX=... [more]
sp|Q9Z2F5|CTBP1_RAT1.667e-3230.54C-terminal-binding protein 1 OS=Rattus norvegicus ... [more]
sp|O88712|CTBP1_MOUSE2.055e-3230.54C-terminal-binding protein 1 OS=Mus musculus OX=10... [more]
sp|O46036|CTBP_DROME2.612e-3231.70C-terminal-binding protein OS=Drosophila melanogas... [more]
back to top
BLAST of THAP-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2A2KNE11.273e-8035.75THAP-type domain-containing protein OS=Diploscapte... [more]
A0A261CQW04.848e-7332.80THAP-type domain-containing protein (Fragment) OS=... [more]
A0A261BCV14.903e-7332.80THAP-type domain-containing protein (Fragment) OS=... [more]
A0A2P4WPR58.702e-7332.80THAP-type domain-containing protein OS=Caenorhabdi... [more]
E3LDT92.082e-6730.96CRE-CTBP-1 protein OS=Caenorhabditis remanei OX=31... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000001402.26.347e-3330.75C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ENSAMXT00000050975.18.973e-3330.75C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ctbp13.306e-3230.77C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
ctbp13.306e-3230.77C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
ctbp14.134e-3230.77C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1369293.228e-3331.66C-terminal binding protein 1 [Source:NCBI gene;Acc... [more]
ctbp2a8.283e-3330.53C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ctbp2a8.604e-3331.14C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ctbp18.942e-3331.07C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
ctbp2a1.061e-3230.53C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000028189.10.000e+099.66SMESG000028189.1[more]
SMESG000031097.11.098e-7435.95SMESG000031097.1[more]
SMESG000039168.11.190e-3029.46SMESG000039168.1[more]
SMESG000039168.11.345e-3029.46SMESG000039168.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024994 ID=SMED30024994|Name=THAP-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2086bp
GAAACACCTTTGGTTGATGCCACCAAGTAAGGCTGGGTTTCTACCAATAG
ACAATCGATAGTTAGGCAACATATATAAGTAACTATTAATGAATATAAAA
CATTATAATTTTACATAAAAAATACATAAAAAATTTGAAATAATAATAAT
AAATGCCTACGACTTGTGGTTTTCCCAATTGCAAATTCCGATCTCGCTAT
CGGGGCTCCGATGATAATCGTCATTTTTATCGGGTCCCTAAAAAACCAGC
AATCCTGAGGATGAGATGGTTGGAGGCTATCGGAAGAACGGAAGAAACAA
TAGTTAGTCAGCTACGAGTCTGTAGTGGCCATTTTCCTGGTGGAGAGAAA
AAAGAAGGCGATGTTCCTGTGTCAGATCCTTCAATTGATAAGGCAATTAA
AGTAGAACTTCCACCGAAATCGTTTCGTTCATCGTCGACAATCAAACGAA
ACAAGCGTCGAATTAAATCTCTCGGTCATGGGATTTTGCCCCAACTGAAA
CATTTCCCCTCGAATTCGAGCTTGTTTGCGAGCTCAAACTCAAACATAAT
ATCAAATTCACTTACTAATCCACCGTTATTAATGAATCAACACTTTACAA
ATATATTTCAAGACCTCAACAGCAATACAATGTCAAATTATATTAATTCA
TTTGGATCCATTCTCAACGGATTTTCCCCGTTATTCAAAAAACCATTCCT
TGCTCCTCCAAGTTGTAATGGGATTCCAGTGTATCAAGACGCTCCTTTAG
ACAGATTACTCAAAGTTTCCAATTCAAACAAACCAGCAGTTCTAATATTA
GACATTTTACCAACTCCAATAGACGATGTGATTTTGGGTACGATTTGTCA
TTACAAATACATTAATACCTCAACCATTGAAACAATGACTGACGAAGAAC
TGAACTTCATATCAAAAGCTAATACGATCGTTTATCAGAAAAATCTAAGC
AAAACCCAGGTGTTGAAATTTCGATCTTTAAAGCATGTCGTAAAAATTGG
ACCGAGCCTTCAATCGGAAGACGTTCGAGAGATCACTGAAAAAAATATTG
CTCTCAGCGTTATCAGTGCACCTTGCGTAGATGAAATCGCTGACACAATC
ATATGTCTGATTCTCAATCTCTACCGTCACACTTCGTTTCTCACTAATTC
TACATATGAATCTAAACAAATATTTGAATGGAACCGAAATCCCCATAACT
CTCACAGGGTGAGACCTATCAAAGGGCAAACACTGGGCTTGATAGGCTTA
GGCCAGACCGGAATTGCAGTTGCGATTAGAGCACGGGTTTTTGGTTTCAA
TGTTAAGTTTTACGATTCAACCCTTTCCCCCGGAAACGATTGGTATCTGG
GTCTGAGAAGGGTTGACAGTCTACAACAGCTTCTATTAGAATCCGATTGC
ATATCTGTGAATATTGATCCAGCGTGTGATTTTAGCCAATCAATCTCTCC
AAATTTATTCGGATACTTTAAAAAAGGCTCATACTTCGTCAATATGTCGT
CAGTTCCAGCTATGAAATTGACAAAAAATGTGCTAAATGTGTTCGAAGAC
ATTATAGATGGTGCTGTTGTTAATGCAGCCAATATCGAGTCAACAATTGT
TGATGATTTATTAGAGTTACCTGGAAATAAAATTACGATTATGCCACCAC
AAAATGATTACAGTCAGTCTTGTGTATTAGAAATGAGAGAGCAAGCCTTA
TATGAAGTAAGAAGAGGACTCTTAAATGGTTCTTTAGAAAGCCTTCGCAG
TTGTGTAAACAAAAACGAATTGGTTCATAGAAACACAATCTATGAAAGCT
TAACTAAGCAAAAACTTCAATCAACAAGTCCAGATATTGAAACTGTGAAA
AACTTTTCCGTGGAATCTCTAATTTTCGATTCCAAACAAGCCGATGCTAT
TATGGACGAAGAATTTTCTTAATAATTGTGATGCAAACAGATTTGTCCAC
AAACATTTGATGATTCTTAGACTGATATTATGTAATGGATTCGTTATTTT
TCCCAAAATTTAATTTTTCTCAAAAAAATCTAAAATCAATTTGTAAATTA
TTTTGTAAATGATTCCATCAGAATATTCTGTGTGAC
back to top

protein sequence of SMED30024994-orf-1

>SMED30024994-orf-1 ID=SMED30024994-orf-1|Name=SMED30024994-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETI
VSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRN
KRRIKSLGHGILPQLKHFPSNSSLFASSNSNIISNSLTNPPLLMNQHFTN
IFQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGIPVYQDAPLD
RLLKVSNSNKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEEL
NFISKANTIVYQKNLSKTQVLKFRSLKHVVKIGPSLQSEDVREITEKNIA
LSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHNS
HRVRPIKGQTLGLIGLGQTGIAVAIRARVFGFNVKFYDSTLSPGNDWYLG
LRRVDSLQQLLLESDCISVNIDPACDFSQSISPNLFGYFKKGSYFVNMSS
VPAMKLTKNVLNVFEDIIDGAVVNAANIESTIVDDLLELPGNKITIMPPQ
NDYSQSCVLEMREQALYEVRRGLLNGSLESLRSCVNKNELVHRNTIYESL
TKQKLQSTSPDIETVKNFSVESLIFDSKQADAIMDEEFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038441THAP_Znf_sf
IPR036291NAD(P)-bd_dom_sf
IPR006140D-isomer_DH_NAD-bd
IPR016040NAD(P)-bd_dom
IPR006612THAP_Znf
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0051287NAD binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 227..523
e-value: 1.0E-48
score: 167.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 309..502
e-value: 1.0E-48
score: 167.5
NoneNo IPR availablePANTHERPTHR46029FAMILY NOT NAMEDcoord: 208..553
NoneNo IPR availablePANTHERPTHR46029FAMILY NOT NAMEDcoord: 4..81
NoneNo IPR availablePANTHERPTHR46029:SF7C-TERMINAL-BINDING PROTEINcoord: 208..553
NoneNo IPR availablePANTHERPTHR46029:SF7C-TERMINAL-BINDING PROTEINcoord: 4..81
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 1..65
IPR006612THAP-type zinc fingerPFAMPF05485THAPcoord: 5..63
e-value: 3.8E-8
score: 34.1
IPR006612THAP-type zinc fingerPROSITEPS50950ZF_THAPcoord: 1..79
score: 13.984
IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domainPFAMPF028262-Hacid_dh_Ccoord: 318..453
e-value: 1.9E-17
score: 63.2
IPR038441THAP-type zinc finger superfamilyGENE3DG3DSA:3.30.40.180coord: 1..89
e-value: 1.4E-39
score: 136.2
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 312..479