LisH domain-containing protein ARMC9

Overview
NameLisH domain-containing protein ARMC9
Smed IDSMED30024984
Length (bp)2515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LisH domain-containing protein ARMC9 (SMED30024984) t-SNE clustered cells

Violin plots show distribution of expression levels for LisH domain-containing protein ARMC9 (SMED30024984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LisH domain-containing protein ARMC9 (SMED30024984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LisH domain-containing protein ARMC9 (SMED30024984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024984SMESG000049428.1 SmedASXL_004458SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024984SMESG000049428.1 dd_Smed_v4_10926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024984SMESG000049428.1 dd_Smed_v4_10926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024984SMESG000049428.1 dd_Smed_v6_10926_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024984SMESG000049428.1 dd_Smed_v4_10926_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024984SMESG000049428.1 dd_Smed_v4_10926_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Human
Match: ARMC9 (armadillo repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:20730])

HSP 1 Score: 458.759 bits (1179), Expect = 1.427e-150
Identity = 286/691 (41.39%), Postives = 419/691 (60.64%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY------SLQSAHSRDAN---SSNPTISRPVTPGTFLGKRNPTP 2088
            E+++  ++ EY D+ +F +T  +   E K KGK + ++   + F DSK+  IQ+    AF  GD++ FFDLW+  +S+ +R+ DS  QKLEF+  I+FAI+ +K++    D E +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L +F  LI    N PKL+ +YK       ++ ++ L  ++VE+ RR+   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+                 PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++   S  +++Y+ARLINA A+L  GR YL +N ++ ++L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL +P IR+EA  M +E  L+  +K  + +M RQ+E+II QL S + P      D++E++DDEED +++E++LDK+E       EL GE+LL T Y      + ++     AN   S +  + RPVTPG   G RN  P
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGS-FRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEI-LQQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASL----------------APVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCY-SHNQRSVLQLLHST--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPLQRPVTPG---GHRNGYP 664          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Human
Match: ARMC9 (armadillo repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:20730])

HSP 1 Score: 459.914 bits (1182), Expect = 4.832e-149
Identity = 291/713 (40.81%), Postives = 425/713 (59.61%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY------SLQSAHSRDAN---SSNPTISRPVTPGTFLGKRNPTPSDIQNVRPP--TRSGSNIDPQT 2148
            E+++  ++ EY D+ +F +T  +   E K KGK + ++   + F DSK+  IQ+    AF  GD++ FFDLW+  +S+ +R+ DS  QKLEF+  I+FAI+ +K++    D E +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L +F  LI    N PKL+ +YK       ++ ++ L  ++VE+ RR+   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+                 PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++   S  +++Y+ARLINA A+L  GR YL +N ++ ++L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL +P IR+EA  M +E  L+  +K  + +M RQ+E+II QL S + P      D++E++DDEED +++E++LDK+E       EL GE+LL T Y      + ++     AN   S +  + RPVTPG   G RN  P       PP   +   N  PQ 
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGS-FRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEI-LQQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA----------------PVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCY-SHNQRSVLQLLHST--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPLQRPVTPG---GHRNGYPVVEDQHTPPQTAQHARNGHPQA 686          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Human
Match: ARMC9 (armadillo repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:20730])

HSP 1 Score: 459.914 bits (1182), Expect = 4.832e-149
Identity = 291/713 (40.81%), Postives = 425/713 (59.61%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY------SLQSAHSRDAN---SSNPTISRPVTPGTFLGKRNPTPSDIQNVRPP--TRSGSNIDPQT 2148
            E+++  ++ EY D+ +F +T  +   E K KGK + ++   + F DSK+  IQ+    AF  GD++ FFDLW+  +S+ +R+ DS  QKLEF+  I+FAI+ +K++    D E +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L +F  LI    N PKL+ +YK       ++ ++ L  ++VE+ RR+   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+                 PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++   S  +++Y+ARLINA A+L  GR YL +N ++ ++L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL +P IR+EA  M +E  L+  +K  + +M RQ+E+II QL S + P      D++E++DDEED +++E++LDK+E       EL GE+LL T Y      + ++     AN   S +  + RPVTPG   G RN  P       PP   +   N  PQ 
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGS-FRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEI-LQQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA----------------PVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCY-SHNQRSVLQLLHST--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPLQRPVTPG---GHRNGYPVVEDQHTPPQTAQHARNGHPQA 686          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Human
Match: ARMC9 (armadillo repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:20730])

HSP 1 Score: 159.458 bits (402), Expect = 1.856e-44
Identity = 86/174 (49.43%), Postives = 121/174 (69.54%), Query Frame = 1
Query: 1228 TIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINM 1740
            ++ Q+L++   S  +++Y+ARLINA A+L  GR YL +N ++ ++L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL +P IR+EA  M
Sbjct:    3 SVLQLLHST--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAM 170          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Human
Match: ARMC9 (armadillo repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:20730])

HSP 1 Score: 144.05 bits (362), Expect = 1.774e-38
Identity = 90/209 (43.06%), Postives = 129/209 (61.72%), Query Frame = 1
Query:  976 NGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTS 1587
            +G +A+    +   PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++   S  +++Y+ARLINA A+L  GR YL +N ++ ++L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++
Sbjct:    7 SGKMASTMLRASLAPVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCY-SHNQRSVLQLLHST--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRST 208          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Celegans
Match: F59G1.4 (F59G1.4 [Source:UniProtKB/TrEMBL;Acc:G5ECV5])

HSP 1 Score: 80.1073 bits (196), Expect = 2.660e-15
Identity = 68/247 (27.53%), Postives = 119/247 (48.18%), Query Frame = 1
Query: 1084 HGNLRLKVLLFQAFRWRLTKSDVESRDKFISE----ITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYV------------NGALYSILIIPEIR--------QEAINMDLET 1752
            H + R   L+ QA R +++   V + D+++ +    +  HD+L L+  + +    ++L A     + +E +ARLIN +A+   GRSY   +++I     + +L      S   + LI  +QK+S+R   Q  +I +GM+EW +  L++   L +Y  +Y  AL++NL   +      + H      +++++ DSF   IA+ V            N  L S+L  P IR         EAI + LET
Sbjct:   68 HPSARSSALILQALRQQMS---VATLDEYVRDSLEWMVSHDVLMLK-SKKNSLFVRVLQAD--GVDSREQMARLINTMASYTSGRSYFTVHHKIFLPCLIAVLRGKRIPSTTHDQLIACVQKMSIRATCQKELIQSGMLEWAVNHLDQK--LNNYAFEYLAALIVNLSTNS------LSHP-----LITRLADSFANSIANLVVKITHGPSCSLYNTLLLSVLSCPRIRLRAKDTKLLEAIRIRLET 295          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Zebrafish
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100334308])

HSP 1 Score: 265.388 bits (677), Expect = 8.753e-79
Identity = 201/499 (40.28%), Postives = 278/499 (55.71%), Query Frame = 1
Query:  913 SIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKS-TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRDANSSNPTIS----RPVTPG----TFLGKRNPTPSDIQ-------NVRPPTRSGSNIDPQTAVE-NKVLVVKPDLMRDNPQ--------------------------YQKAFSSKPKIPRTPDEE 2259
            S+DF+RPGTAS MLR S+                 P   K V   P L++ K+K DL  G+ RLK LL QA RWRLT+S   E RD  +     +DLL     +   T+  ++  K  ++ +++Y ARLINA A+LC GR YL +   +   L L+ L    +ES+ REN++ ALQKLSLRR  Q+ MI +G+I WL+  L ++  L+DYTL+Y+++LLMNLCLRT GKKRC E    +++VL+++L   N EI  YVNGALYSIL +PEIR+EA  M +E  L+ + K E+ ++NRQ+E+II QL S T   +  ESDDEE+EDDD+++ +V+E++LDKEE     P EL GE LL T Y     ++     R    S+ +I     RPVTP     T  G     P   Q       + RP TR+GS   P TA   ++ L    D  R + +                          +   F+S+PKIPRTPD +
Sbjct:    8 SLDFTRPGTASSMLRASVA----------------PQRPKDVPLLPSLDYEKLKKDLLTGSDRLKALLLQALRWRLTRSLHGEQRDTVLQAFISNDLLERYSNK-QKTVLHLIKCK--NEIVRQYTARLINAFASLCDGRLYLSQIPALLPFL-LDCLKTEEKESVTRENVLAALQKLSLRRAQQSAMIRDGLIGWLVKELNDSDCLSDYTLEYAISLLMNLCLRTQGKKRCAEEAKYVLKVLTELLGHENHEIRYYVNGALYSILSVPEIREEAKQMSMEEILRCYNKEENPELNRQIEFIIKQLNSATIPEQEPESDDEEDEDDDDDEEDVMEADLDKEEVLQPQPKELSGESLLTTEYLGIMTNMMKTKRRSCPPSSRSIDEPLQRPVTPSSHKNTIAGGEGVYPVTRQRSEDSRFSSRPATRTGSR--PSTAESIHQTLATDSDCWRSSVESGLMGSPERHVPAPGQTTNSVQSYSGHMVGFASRPKIPRTPDSD 484          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Zebrafish
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100334308])

HSP 1 Score: 256.914 bits (655), Expect = 1.727e-75
Identity = 201/511 (39.33%), Postives = 278/511 (54.40%), Query Frame = 1
Query:  913 SIDFSRPGT------------ASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKS-TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRDANSSNPTIS----RPVTPG----TFLGKRNPTPSDIQ-------NVRPPTRSGSNIDPQTAVE-NKVLVVKPDLMRDNPQ--------------------------YQKAFSSKPKIPRTPDEE 2259
            S+DF+RPGT            AS MLR S+                 P   K V   P L++ K+K DL  G+ RLK LL QA RWRLT+S   E RD  +     +DLL     +   T+  ++  K  ++ +++Y ARLINA A+LC GR YL +   +   L L+ L    +ES+ REN++ ALQKLSLRR  Q+ MI +G+I WL+  L ++  L+DYTL+Y+++LLMNLCLRT GKKRC E    +++VL+++L   N EI  YVNGALYSIL +PEIR+EA  M +E  L+ + K E+ ++NRQ+E+II QL S T   +  ESDDEE+EDDD+++ +V+E++LDKEE     P EL GE LL T Y     ++     R    S+ +I     RPVTP     T  G     P   Q       + RP TR+GS   P TA   ++ L    D  R + +                          +   F+S+PKIPRTPD +
Sbjct:    8 SLDFTRPGTGYYSMSPYDDGYASSMLRASVA----------------PQRPKDVPLLPSLDYEKLKKDLLTGSDRLKALLLQALRWRLTRSLHGEQRDTVLQAFISNDLLERYSNK-QKTVLHLIKCK--NEIVRQYTARLINAFASLCDGRLYLSQIPALLPFL-LDCLKTEEKESVTRENVLAALQKLSLRRAQQSAMIRDGLIGWLVKELNDSDCLSDYTLEYAISLLMNLCLRTQGKKRCAEEAKYVLKVLTELLGHENHEIRYYVNGALYSILSVPEIREEAKQMSMEEILRCYNKEENPELNRQIEFIIKQLNSATIPEQEPESDDEEDEDDDDDEEDVMEADLDKEEVLQPQPKELSGESLLTTEYLGIMTNMMKTKRRSCPPSSRSIDEPLQRPVTPSSHKNTIAGGEGVYPVTRQRSEDSRFSSRPATRTGSR--PSTAESIHQTLATDSDCWRSSVESGLMGSPERHVPAPGQTTNSVQSYSGHMVGFASRPKIPRTPDSD 496          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Zebrafish
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100334308])

HSP 1 Score: 249.21 bits (635), Expect = 5.103e-73
Identity = 184/452 (40.71%), Postives = 258/452 (57.08%), Query Frame = 1
Query: 1051 LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKS-TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRDANSSNPTIS----RPVTPG----TFLGKRNPTPSDIQ-------NVRPPTRSGSNIDPQTAVE-NKVLVVKPDLMRDNPQ--------------------------YQKAFSSKPKIPRTPDEE 2259
            L++ K+K DL  G+ RLK LL QA RWRLT+S   E RD  +     +DLL     +   T+  ++  K  ++ +++Y ARLINA A+LC GR YL +   +   L L+ L    +ES+ REN++ ALQKLSLRR  Q+ MI +G+I WL+  L ++  L+DYTL+Y+++LLMNLCLRT GKKRC E    +++VL+++L   N EI  YVNGALYSIL +PEIR+EA  M +E  L+ + K E+ ++NRQ+E+II QL S T   +  ESDDEE+EDDD+++ +V+E++LDKEE     P EL GE LL T Y     ++     R    S+ +I     RPVTP     T  G     P   Q       + RP TR+GS   P TA   ++ L    D  R + +                          +   F+S+PKIPRTPD +
Sbjct:   23 LDYEKLKKDLLTGSDRLKALLLQALRWRLTRSLHGEQRDTVLQAFISNDLLERYSNK-QKTVLHLIKCK--NEIVRQYTARLINAFASLCDGRLYLSQIPALLPFL-LDCLKTEEKESVTRENVLAALQKLSLRRAQQSAMIRDGLIGWLVKELNDSDCLSDYTLEYAISLLMNLCLRTQGKKRCAEEAKYVLKVLTELLGHENHEIRYYVNGALYSILSVPEIREEAKQMSMEEILRCYNKEENPELNRQIEFIIKQLNSATIPEQEPESDDEEDEDDDDDEEDVMEADLDKEEVLQPQPKELSGESLLTTEYLGIMTNMMKTKRRSCPPSSRSIDEPLQRPVTPSSHKNTIAGGEGVYPVTRQRSEDSRFSSRPATRTGSR--PSTAESIHQTLATDSDCWRSSVESGLMGSPERHVPAPGQTTNSVQSYSGHMVGFASRPKIPRTPDSD 468          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Xenopus
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100036614])

HSP 1 Score: 423.705 bits (1088), Expect = 3.021e-135
Identity = 280/722 (38.78%), Postives = 415/722 (57.48%), Query Frame = 1
Query:   67 FETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN---FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDA---------NSSNPTISRPVTPGTF-----LGKRNPTPSDIQNV-------------RPPTRSGS 2130
            +E D+  ++ E+ ++ +F  T  +   E K KGK +P++ +     +SK   IQ+    AF  GD +EFF LW   +  + +N + V QKLEF+ QI+FAIF +KHN       D E   +  F+ YLET G  +S   EF+ FYALP+V +P  HPSF ++FQ++W   + +RL++F  +I    + P+L+ LYK  S + N   ++ LQ +++E+  +A    K  N++Q DYHNL+G+TA+LVD LE +  GK ++P +LQ++C  LF +Q  +  +       SIDF+RPGTAS MLR SI     +    Q++   P           L++ K+K DL  GN RLK L+ QA RWRLT+S   E R+  +     +DLL     E  + +  +   +  S+ +++Y A LI+  ++L  GR Y+ +N R+   L +       +ES+ RE ++G LQKLSLRR +Q+ MI + +I WL+  LE+   L+DY L Y++AL MNLCLR++G+K C      +++VLS +L   N EI SYVNGALYSIL +P IR+EA +M +E  L+ +++  + DMN  +E+II QL S D+  +  ESDDEEEE DDEED + LE++LDK+E   A   EL GE+LL T+Y     +S             S++  + RPVTP T      + K +  PS   N              RPPTRSGS
Sbjct:   13 YEADLLGLVKEFLNFGEFQETLETFTKECKTKGKQLPKT-SGLALRESKTLLIQKDLITAFEDGDIKEFFALWQEHIPVETQNTNPVAQKLEFYLQIHFAIFPLKHNQGRIDRTDCEE-RISHFKTYLETSGAALSQTTEFLPFYALPFVPHPAAHPSFKEIFQESWEAELRMRLEKFLSVILKATSTPRLITLYKE-SLHNNQELLQQLQQQLMETEHKARTYKKCFNRMQSDYHNLIGVTADLVDSLEATINGKLITPEYLQSVCTRLFSTQMKQSSAQ------SIDFTRPGTASSMLRASI-----APLKQQEVPLFPS----------LDYEKLKKDLVFGNDRLKALILQALRWRLTRSQPGEQRNTVLQAYISNDLLDCHHNEQKNVLMLL---RSPSEVVRQYTALLIDVFSSLAYGRVYISQNPRLLHSL-VETWKAEEKESVIRETVLGILQKLSLRRSMQSAMIKDDLIFWLVQELEDTDHLSDYALQYTIALFMNLCLRSAGRKMCSRDADHVLKVLSDLLGHENHEIRSYVNGALYSILAVPSIREEARSMGMEEILRWYIREGNTDMNCHIEFIIKQLNSEDKFDESIESDDEEEEKDDEEDEDALEADLDKDEIIYAQSGELAGEKLLTTDYLGIMTNSFKVKKRMFGGVLQSADEPLQRPVTPSTHRVMNTVRKTSGPPSPPTNTFKTSQANMSVVSSRPPTRSGS 706          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Xenopus
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100036614])

HSP 1 Score: 416.001 bits (1068), Expect = 2.674e-132
Identity = 277/715 (38.74%), Postives = 410/715 (57.34%), Query Frame = 1
Query:   88 IIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN---FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDA---------NSSNPTISRPVTPGTF-----LGKRNPTPSDIQNV-------------RPPTRSGS 2130
            +  ++ ++ +F  T  +   E K KGK +P++ +     +SK   IQ+    AF  GD +EFF LW   +  + +N + V QKLEF+ QI+FAIF +KHN       D E   +  F+ YLET G  +S   EF+ FYALP+V +P  HPSF ++FQ++W   + +RL++F  +I    + P+L+ LYK  S + N   ++ LQ +++E+  +A    K  N++Q DYHNL+G+TA+LVD LE +  GK ++P +LQ++C  LF +Q  +  +       SIDF+RPGTAS MLR SI     +    Q++   P           L++ K+K DL  GN RLK L+ QA RWRLT+S   E R+  +     +DLL     E  + +  +   +  S+ +++Y A LI+  ++L  GR Y+ +N R+   L +       +ES+ RE ++G LQKLSLRR +Q+ MI + +I WL+  LE+   L+DY L Y++AL MNLCLR++G+K C      +++VLS +L   N EI SYVNGALYSIL +P IR+EA +M +E  L+ +++  + DMN  +E+II QL S D+  +  ESDDEEEE DDEED + LE++LDK+E   A   EL GE+LL T+Y     +S             S++  + RPVTP T      + K +  PS   N              RPPTRSGS
Sbjct:   17 LYFQFLNFGEFQETLETFTKECKTKGKQLPKT-SGLALRESKTLLIQKDLITAFEDGDIKEFFALWQEHIPVETQNTNPVAQKLEFYLQIHFAIFPLKHNQGRIDRTDCEE-RISHFKTYLETSGAALSQTTEFLPFYALPFVPHPAAHPSFKEIFQESWEAELRMRLEKFLSVILKATSTPRLITLYKE-SLHNNQELLQQLQQQLMETEHKARTYKKCFNRMQSDYHNLIGVTADLVDSLEATINGKLITPEYLQSVCTRLFSTQMKQSSAQ------SIDFTRPGTASSMLRASI-----APLKQQEVPLFPS----------LDYEKLKKDLVFGNDRLKALILQALRWRLTRSQPGEQRNTVLQAYISNDLLDCHHNEQKNVLMLL---RSPSEVVRQYTALLIDVFSSLAYGRVYISQNPRLLHSL-VETWKAEEKESVIRETVLGILQKLSLRRSMQSAMIKDDLIFWLVQELEDTDHLSDYALQYTIALFMNLCLRSAGRKMCSRDADHVLKVLSDLLGHENHEIRSYVNGALYSILAVPSIREEARSMGMEEILRWYIREGNTDMNCHIEFIIKQLNSEDKFDESIESDDEEEEKDDEEDEDALEADLDKDEIIYAQSGELAGEKLLTTDYLGIMTNSFKVKKRMFGGVLQSADEPLQRPVTPSTHRVMNTVRKTSGPPSPPTNTFKTSQANMSVVSSRPPTRSGS 703          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Xenopus
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100036614])

HSP 1 Score: 401.749 bits (1031), Expect = 1.168e-128
Identity = 264/675 (39.11%), Postives = 394/675 (58.37%), Query Frame = 1
Query:   88 IIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN---FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDA---------NSSNPTISRPVTPGT 2061
            +  ++ ++ +F  T  +   E K KGK +P++ +     +SK   IQ+    AF  GD +EFF LW   +  + +N + V QKLEF+ QI+FAIF +KHN       D E   +  F+ YLET G  +S   EF+ FYALP+V +P  HPSF ++FQ++W   + +RL++F  +I    + P+L+ LY S   + +   ++ LQ +++E+  +A    K  N++Q DYHNL+G+TA+LVD LE +  GK ++P +LQ++C  LF +Q  +  +       SIDF+RPGTAS MLR SI                 P+  + V   P L++ K+K DL  GN RLK L+ QA RWRLT+S   E R+  +     +DLL     E  + +  +   +  S+ +++Y A LI+  ++L  GR Y+ +N R+   L +       +ES+ RE ++G LQKLSLRR +Q+ MI + +I WL+  LE+   L+DY L Y++AL MNLCLR++G K C      +++VLS +L   N EI SYVNGALYSIL +P IR+EA +M +E  L+ +++  + DMN  +E+II QL S D+  +  ESDDEEEE DDEED + LE++LDK+E   A   EL GE+LL T+Y     +S             S++  + RPVTP T
Sbjct:   16 LYFQFLNFGEFQETLETFTKECKTKGKQLPKT-SGLALRESKTLLIQKDLITAFEDGDIKEFFALWQEHIPVETQNTNPVAQKLEFYLQIHFAIFPLKHNQGRIDRTDCEE-RISHFKTYLETSGAALSQTTEFLPFYALPFVPHPAAHPSFKEIFQESWEAELRMRLEKFLSVILKATSTPRLITLYVS---FASLKLLQQLQQQLMETEHKARTYKKCFNRMQSDYHNLIGVTADLVDSLEATINGKLITPEYLQSVCTRLFSTQMKQSSAQ------SIDFTRPGTASSMLRASI----------------APLKQQEVPLFPSLDYEKLKKDLVFGNDRLKALILQALRWRLTRSQPGEQRNTVLQAYISNDLLDCHHNEQKNVLMLL---RSPSEVVRQYTALLIDVFSSLAYGRVYISQNPRLLHSL-VETWKAEEKESVIRETVLGILQKLSLRRSMQSAMIKDDLIFWLVQELEDTDHLSDYALQYTIALFMNLCLRSAGIKMCSRDADHVLKVLSDLLGHENHEIRSYVNGALYSILAVPSIREEARSMGMEEILRWYIREGNTDMNCHIEFIIKQLNSEDKFDESIESDDEEEEKDDEEDEDALEADLDKDEIIYAQSGELAGEKLLTTDYLGIMTNSFKVKKRMFGGVLQSADEPLQRPVTPST 659          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Xenopus
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100036614])

HSP 1 Score: 395.971 bits (1016), Expect = 7.407e-127
Identity = 249/676 (36.83%), Postives = 373/676 (55.18%), Query Frame = 1
Query:   88 IIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGT-----ASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDA---------NSSNPTISRPVTPGT 2061
            +  ++ ++ +F  T  +   E K KGK +P++ +     +SK   IQ+    AF  GD +EFF LW   +  + +N + V QKLEF+ QI+FAIF +KHN   +D E   +  F+ YLET G  +S   EF+ FYALP+V +P  HPSF ++FQ++W   + +RL++F  +I    + P+L+ LY S +++K                  A    K  N++Q DYHNL+G+TA+LVD LE +  GK ++P +LQ++C  LF +Q  +  +       SIDF+RPGT     AS MLR SI                 P+  + V   P L++ K+K DL  GN RLK L+ QA RWRLT+S   E R+  +     +DLL     E  + +  +   +  S+ +++Y A LI+  ++L  GR Y+ +N R+   L +       +ES+ RE ++G LQKLSLRR +Q+ MI + +I WL+  LE+   L+DY L Y++AL MNLCLR++G+K C      +++VLS +L   N EI SYVNGALYSIL +P IR+EA +M +E  L+ +++  + DMN  +E+II QL S                    D + LE++LDK+E   A   EL GE+LL T+Y     +S             S++  + RPVTP T
Sbjct:   16 LYFQFLNFGEFQETLETFTKECKTKGKQLPKT-SGLALRESKTLLIQKDLITAFEDGDIKEFFALWQEHIPVETQNTNPVAQKLEFYLQIHFAIFPLKHN---QDCEE-RISHFKTYLETSGAALSQTTEFLPFYALPFVPHPAAHPSFKEIFQESWEAELRMRLEKFLSVILKATSTPRLITLYVSFTEHK------------------ARTYKKCFNRMQSDYHNLIGVTADLVDSLEATINGKLITPEYLQSVCTRLFSTQMKQSSAQ------SIDFTRPGTVSAYGASSMLRASI----------------APLKQQEVPLFPSLDYEKLKKDLVFGNDRLKALILQALRWRLTRSQPGEQRNTVLQAYISNDLLDCHHNEQKNVLMLL---RSPSEVVRQYTALLIDVFSSLAYGRVYISQNPRLLHSL-VETWKAEEKESVIRETVLGILQKLSLRRSMQSAMIKDDLIFWLVQELEDTDHLSDYALQYTIALFMNLCLRSAGRKMCSRDADHVLKVLSDLLGHENHEIRSYVNGALYSILAVPSIREEARSMGMEEILRWYIREGNTDMNCHIEFIIKQLNSG--------------KKCILDEDALEADLDKDEIIYAQSGELAGEKLLTTDYLGIMTNSFKVKKRMFGGVLQSADEPLQRPVTPST 628          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Xenopus
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100036614])

HSP 1 Score: 398.282 bits (1022), Expect = 1.005e-126
Identity = 262/670 (39.10%), Postives = 390/670 (58.21%), Query Frame = 1
Query:   97 EYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN---FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDA---------NSSNPTISRPVTPG 2058
            ++ ++ +F  T  +   E K KGK +P++ +     +SK   IQ+    AF  GD +EFF LW   +  + +N + V QKLEF+ QI+FAIF +KHN       D E   +  F+ YLET G  +S   EF+ FYALP+V +P  HPSF ++FQ++W   + +RL++F  +I    + P+L+ LY S         ++ LQ +++E+  +A    K  N++Q DYHNL+G+TA+LVD LE +  GK ++P +LQ++C  LF +Q  +  +       SIDF+RPGTAS MLR SI     +    Q++   P           L++ K+K DL  GN RLK L+ QA RWRLT+S   E R+  +     +DLL     E  + +  +   +  S+ +++Y A LI+  ++L  GR Y+ +N R+   L +       +ES+ RE ++G LQKLSLRR +Q+ MI + +I WL+  LE+   L+DY L Y++AL MNLCLR++G K C      +++VLS +L   N EI SYVNGALYSIL +P IR+EA +M +E  L+ +++  + DMN  +E+II QL S D+  +  ESDDEEEE DDEED + LE++LDK+E   A   EL GE+LL T+Y     +S             S++  + RPVTP 
Sbjct:   20 QFLNFGEFQETLETFTKECKTKGKQLPKT-SGLALRESKTLLIQKDLITAFEDGDIKEFFALWQEHIPVETQNTNPVAQKLEFYLQIHFAIFPLKHNQGRIDRTDCEE-RISHFKTYLETSGAALSQTTEFLPFYALPFVPHPAAHPSFKEIFQESWEAELRMRLEKFLSVILKATSTPRLITLYVS-------FLLQQLQQQLMETEHKARTYKKCFNRMQSDYHNLIGVTADLVDSLEATINGKLITPEYLQSVCTRLFSTQMKQSSAQ------SIDFTRPGTASSMLRASI-----APLKQQEVPLFPS----------LDYEKLKKDLVFGNDRLKALILQALRWRLTRSQPGEQRNTVLQAYISNDLLDCHHNEQKNVLMLL---RSPSEVVRQYTALLIDVFSSLAYGRVYISQNPRLLHSL-VETWKAEEKESVIRETVLGILQKLSLRRSMQSAMIKDDLIFWLVQELEDTDHLSDYALQYTIALFMNLCLRSAGIKMCSRDADHVLKVLSDLLGHENHEIRSYVNGALYSILAVPSIREEARSMGMEEILRWYIREGNTDMNCHIEFIIKQLNSEDKFDESIESDDEEEEKDDEEDEDALEADLDKDEIIYAQSGELAGEKLLTTDYLGIMTNSFKVKKRMFGGVLQSADEPLQRPVTPS 655          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Mouse
Match: Armc9 (armadillo repeat containing 9 [Source:MGI Symbol;Acc:MGI:1926045])

HSP 1 Score: 462.225 bits (1188), Expect = 3.611e-150
Identity = 316/843 (37.49%), Postives = 470/843 (55.75%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYK-SGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPT---------ISRPVTPG------TFLGKRNPTPSDIQNVR------------------PPTRSGSNIDPQTAVENK-----------------VLVVKPDLMRDNP-------QYQKAFSSKPKIPRTPD--EEN-LKRNSIQ-----SLTGPIQSSGRMPTTSANGNRKGKESMSTTK 2376
            E+++  ++ EY D+ +F +T  +   E K KGK + ++       DSK+  IQ     AF  GD++ FFDLW+  + + +R+ DS+ QKLEF+  I+FAI+ +K+     D + +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L++F  L F   N PKL+ +YK +G + K    ++ L  ++VE+ RRA   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+          +K+  D P+L        L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++K  S+ +++Y+ARLINA+A+L  GR YL +N ++  +L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ LL++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S D        D++E++DDEED +++E++LDK+E       EL GE+LL T Y     ++  A    P          + RPVTPG        LG    +P + Q  R                   P  +G      + +++K                   +  P  M  +P       ++  AF+ KP++P TP+  E+N LK  ++      S +GP Q+S   P ++A+  R    S S  K
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKNVGGPLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKE--LLQQLHQQLVEAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA--------PEKLK-DVPLLPS------LDYEKLKKDLIWGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCH-SHNQRSVLQLLHSK--SEAVRQYMARLINALASLAEGRLYLAQNTKVLRMLE----GRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVAHPDDYKEGKPGVTGCGTSSSSVMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSGHITREFVPAFTCKPQVPSTPETVEQNPLKAKALSLAPQFSSSGPQQAS--RPASTASSTRGLHSSQSIRK 818          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Mouse
Match: Armc9 (armadillo repeat containing 9 [Source:MGI Symbol;Acc:MGI:1926045])

HSP 1 Score: 455.292 bits (1170), Expect = 2.258e-149
Identity = 286/691 (41.39%), Postives = 417/691 (60.35%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYK-SGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPT---------ISRPVTPGTFLGKRNPTP 2088
            E+++  ++ EY D+ +F +T  +   E K KGK + ++       DSK+  IQ     AF  GD++ FFDLW+  + + +R+ DS+ QKLEF+  I+FAI+ +K+     D + +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L++F  L F   N PKL+ +YK +G + K    ++ L  ++VE+ RRA   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+          +K+  D P+L        L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++K  S+ +++Y+ARLINA+A+L  GR YL +N ++  +L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ LL++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S D        D++E++DDEED +++E++LDK+E       EL GE+LL T Y     ++  A    P          + RPVTPG   G R   P
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKNVGGPLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKE--LLQQLHQQLVEAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA--------PEKLK-DVPLLPS------LDYEKLKKDLIWGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCH-SHNQRSVLQLLHSK--SEAVRQYMARLINALASLAEGRLYLAQNTKVLRMLE----GRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRKGPASVQWSGDEPLRRPVTPG---GHRTGCP 665          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Mouse
Match: Armc9 (armadillo repeat containing 9 [Source:MGI Symbol;Acc:MGI:1926045])

HSP 1 Score: 458.759 bits (1179), Expect = 7.253e-149
Identity = 315/842 (37.41%), Postives = 466/842 (55.34%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYK-SGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPT---------ISRPVTPG------TFLGKRNPTPSDIQNVR----------------------------------------PPTRSGSNIDPQTAVE-NKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPD--EEN-LKRNSIQ-----SLTGPIQSSGRMPTTSANGNRKGKESMSTTK 2376
            E+++  ++ EY D+ +F +T  +   E K KGK + ++       DSK+  IQ     AF  GD++ FFDLW+  + + +R+ DS+ QKLEF+  I+FAI+ +K+     D + +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L++F  L F   N PKL+ +YK +G + K    ++ L  ++VE+ RRA   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+          +K+  D P+L        L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++K  S+ +++Y+ARLINA+A+L  GR YL +N ++  +L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ LL++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S D        D++E++DDEED +++E++LDK+E       EL GE+LL T Y     ++  A    P          + RPVTPG        LG    +P + Q  R                                        P     S + P  A+   + +   P       ++  AF+ KP++P TP+  E+N LK  ++      S +GP Q+S   P ++A+  R    S S  K
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKNVGGPLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKE--LLQQLHQQLVEAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA--------PEKLK-DVPLLPS------LDYEKLKKDLIWGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCH-SHNQRSVLQLLHSK--SEAVRQYMARLINALASLAEGRLYLAQNTKVLRMLE----GRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVAHPDDYKEGKPGVTGCGTSSSFMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSGHITREFVPAFTCKPQVPSTPETVEQNPLKAKALSLAPQFSSSGPQQAS--RPASTASSTRGLHSSQSIRK 817          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Mouse
Match: Armc9 (armadillo repeat containing 9 [Source:MGI Symbol;Acc:MGI:1926045])

HSP 1 Score: 154.066 bits (388), Expect = 1.182e-41
Identity = 79/145 (54.48%), Postives = 105/145 (72.41%), Query Frame = 1
Query: 1396 ESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKS 1830
            + I REN++GALQK SLRR +QT MI +G+I WL+ LL++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S
Sbjct:    1 DVITRENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNS 145          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Mouse
Match: Armc9 (armadillo repeat containing 9 [Source:MGI Symbol;Acc:MGI:1926045])

HSP 1 Score: 62.003 bits (149), Expect = 7.556e-11
Identity = 60/147 (40.82%), Postives = 82/147 (55.78%), Query Frame = 1
Query: 1675 YVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPT---------ISRPVTPGTFLGKRNPTP 2088
            YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S          D++E++DDEED +++E++LDK+E       EL GE+LL T Y     ++  A    P          + RPVTPG   G R   P
Sbjct:    2 YVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSD-LLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRKGPASVQWSGDEPLRRPVTPG---GHRTGCP 144          
BLAST of LisH domain-containing protein ARMC9 vs. UniProt/SwissProt
Match: sp|E7F187|ARMC9_DANRE (LisH domain-containing protein ARMC9 OS=Danio rerio OX=7955 GN=armc9 PE=2 SV=3)

HSP 1 Score: 463.381 bits (1191), Expect = 9.712e-150
Identity = 315/838 (37.59%), Postives = 466/838 (55.61%), Query Frame = 1
Query:   37 FKMTGEINTNF--ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSK--NIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNF--QDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKS-TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRDANSSNPTIS----RPVTPG----TFLGKRNPTPSDIQ-------NVRPPTRSGSNIDPQTAVE-NKVLVVKPDLMRDNPQ--------------------------YQKAFSSKPKIPRTPDEE--NLKRNSIQSL------TGPIQSSGRMPTTSANGNRKGKES 2361
            FK + ++  N   E+D+ S+I EY  + +F  T  +   E+K+KGK   +S  ++   DSK  +I E F  +F+ GD + F +LW   +  ++R+ D V QKLEF+ QI+F I+ +K      DK      +  FR YLET+G  +S   EF+ FYALP+V NP  HPSF +LFQD+W+P +  R+++F  +     N P+L+ LY       N  +++ +Q ++ E+ R+++  ++R  ++Q D+HNL+G+TAELVD LE +  GK +SP +LQ +C  LF     +  +       S+DF+RPGTAS MLR S+               D P+L        L++ K+K DL  G+ RLK LL QA RWRLT+S   E RD  +     +DLL     +   T+  ++  K  ++ +++Y ARLINA A+LC GR YL +   +   L L+ L    +ES+ REN++ ALQKLSLRR  Q+ MI +G+I WL+  L ++  L+DYTL+Y+++LLMNLCLRT GKKRC E    +++VL+++L   N EI  YVNGALYSIL +PEIR+EA  M +E  L+ + K E+ ++NRQ+E+II QL S T   +  ESDDEE+EDDD+++ +V+E++LDKEE     P EL GE LL T Y     ++     R    S+ +I     RPVTP     T  G     P   Q       + RP TR+GS   P TA   ++ L    D  R + +                          +   F+S+PKIPRTPD +  +  R+ +  L      + P QS  R  +   +  R  ++S
Sbjct:    3 FKKSLKMGENLASESDLLSMISEYLKFGEFEETARTFEKEVKRKGKPALKSAGASR-RDSKIISIYEDFLSSFNDGDYKVFSELWAKNIPPEIRDFDPVAQKLEFYLQIHFTIYPLKSPLGSHDKAEFDSRITHFRHYLETRGAALSQTTEFLPFYALPFVPNPMVHPSFQELFQDSWMPDLRDRMEKFLTVTLKASNTPRLLALYNDAGK-GNKEAIQQMQLQLTEAERKSAVHIRRFAKLQADHHNLIGVTAELVDSLEATVRGKMISPEYLQGVCVRLFSGNMRQSAAQ------SLDFTRPGTASSMLRASVAPQRPK---------DVPLLPS------LDYEKLKKDLLTGSDRLKALLLQALRWRLTRSLHGEQRDTVLQAFISNDLLERYSNK-QKTVLHLIKCK--NEIVRQYTARLINAFASLCDGRLYLSQIPALLPFL-LDCLKTEEKESVTRENVLAALQKLSLRRAQQSAMIRDGLIGWLVKELNDSDCLSDYTLEYAISLLMNLCLRTQGKKRCAEEAKYVLKVLTELLGHENHEIRYYVNGALYSILSVPEIREEAKQMSMEEILRCYNKEENPELNRQIEFIIKQLNSATIPEQEPESDDEEDEDDDDDEEDVMEADLDKEEVLQPQPKELSGESLLTTEYLGIMTNMMKTKRRSCPPSSRSIDEPLQRPVTPSSHKNTIAGGEGVYPVTRQRSEDSRFSSRPATRTGSR--PSTAESIHQTLATDSDCWRSSVESGLMGSPERHVPAPGQTTNSVQSYSGHMVGFASRPKIPRTPDSDAGSAGRSRLPPLAPQFSNSEPQQSGSRPGSAGGSSGRPSQQS 811          
BLAST of LisH domain-containing protein ARMC9 vs. UniProt/SwissProt
Match: sp|Q2KI89|ARMC9_BOVIN (LisH domain-containing protein ARMC9 OS=Bos taurus OX=9913 GN=ARMC9 PE=2 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 1.468e-148
Identity = 280/689 (40.64%), Postives = 411/689 (59.65%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKNI--QERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY---SLQSAHSRDANSSN------PTISRPVTPGTFLGKRNPTPS 2091
            E+++  ++ EY D+ +F +T  + L E K KGK + +S    +  D K++  Q     AF  GD++ FF LW+  +   +R+ DS+ QKLEF+  I+FAI+ +KH+    D E +   +  F+ +LETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W   ++L+L++F  L+F   N PKL+ LYK       DV ++ L  ++VE+ RR+   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+                 PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L +K  S+ +++Y ARLINA A+L  GR YL ++ ++  +L    L    ++ I REN++GALQK SLRR +QT MI +G+I WL+ +L+E   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL + +        D++E++DDEED + +E++LDK+E       EL GE+LL T Y      +  +R   ++         + RPVTPG   G R   P+
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFLKECKIKGKPLSKS-TCGSLRDPKSLKFQRDLLAAFDSGDQKVFFRLWEEHIPRPIRDGDSLAQKLEFYLHIHFAIYLLKHSAGRPDKEDLDERISYFKTFLETKGAALSQTTEFLPFYALPFVPNPMAHPSFKELFQDSWTSELKLKLEKFLALMFKASNTPKLLTLYKENGQSNKDV-LQQLHQQLVEAERRSMTYLKRYNRIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASL----------------APVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCH-SHSQRSVLQLLQSK--SEVVRQYTARLINAFASLAEGRRYLAQSTKVLRMLE-ERLKEEDKDVITRENVLGALQKFSLRRPLQTAMIQDGLIFWLIDILKEPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNAEELLDGVLESDDDEDEDDEEDHDTMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRRGTAGVQWGGPEPLRRPVTPG---GHRTGYPA 665          
BLAST of LisH domain-containing protein ARMC9 vs. UniProt/SwissProt
Match: sp|Q5R629|ARMC9_PONAB (LisH domain-containing protein ARMC9 OS=Pongo abelii OX=9601 GN=ARMC9 PE=2 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 2.181e-148
Identity = 284/691 (41.10%), Postives = 418/691 (60.49%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY------SLQSAHSRDAN---SSNPTISRPVTPGTFLGKRNPTP 2088
            E+++  ++ EY D+ +F +T  +   E K KGK + ++   + F DSK+  IQ+    AF  GD++ FF+LW+  + + +R+ DS  Q+LEF+  I+FAI+ +K++    D E +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++++L++F  LIF   N PKL+ +YK      N   ++ L  ++VE+ RR+   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+                 PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++K  S  +++Y+ARLINA A+L  GR YL +N ++  +L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YV+GALYSIL +P IR+EA  M +E  L+  +K  + +M RQ+E+II QL S + P      D++E++DDEED +++E++LDK+E       EL GE+LL T Y      + +      AN   S +  + RPVTPG   G RN  P
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGS-FRDSKSLTIQKDLVTAFDNGDQKVFFNLWEEHIPSSVRDGDSFAQRLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKMKLEKFLALIFKASNTPKLLTIYKENGQ-SNKEMLQQLHQQLVEAERRSMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASL----------------APVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCY-SHNQRSVLQLLHSK--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLRMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVSGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKMRRKGLANVQWSGDEPLQRPVTPG---GHRNGYP 664          
BLAST of LisH domain-containing protein ARMC9 vs. UniProt/SwissProt
Match: sp|Q7Z3E5|ARMC9_HUMAN (LisH domain-containing protein ARMC9 OS=Homo sapiens OX=9606 GN=ARMC9 PE=1 SV=3)

HSP 1 Score: 459.914 bits (1182), Expect = 2.320e-148
Identity = 291/713 (40.81%), Postives = 425/713 (59.61%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY------SLQSAHSRDAN---SSNPTISRPVTPGTFLGKRNPTPSDIQNVRPP--TRSGSNIDPQT 2148
            E+++  ++ EY D+ +F +T  +   E K KGK + ++   + F DSK+  IQ+    AF  GD++ FFDLW+  +S+ +R+ DS  QKLEF+  I+FAI+ +K++    D E +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L +F  LI    N PKL+ +YK       ++ ++ L  ++VE+ RR+   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+                 PV  K V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++   S  +++Y+ARLINA A+L  GR YL +N ++ ++L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ +L++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL +P IR+EA  M +E  L+  +K  + +M RQ+E+II QL S + P      D++E++DDEED +++E++LDK+E       EL GE+LL T Y      + ++     AN   S +  + RPVTPG   G RN  P       PP   +   N  PQ 
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGS-FRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEI-LQQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA----------------PVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCY-SHNQRSVLQLLHST--SDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLE----GRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPLQRPVTPG---GHRNGYPVVEDQHTPPQTAQHARNGHPQA 686          
BLAST of LisH domain-containing protein ARMC9 vs. UniProt/SwissProt
Match: sp|Q9D2I5|ARMC9_MOUSE (LisH domain-containing protein ARMC9 OS=Mus musculus OX=10090 GN=Armc9 PE=1 SV=1)

HSP 1 Score: 458.759 bits (1179), Expect = 5.074e-148
Identity = 315/842 (37.41%), Postives = 466/842 (55.34%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYK-SGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEES---IFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPT---------ISRPVTPG------TFLGKRNPTPSDIQNVR----------------------------------------PPTRSGSNIDPQTAVE-NKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPD--EEN-LKRNSIQ-----SLTGPIQSSGRMPTTSANGNRKGKESMSTTK 2376
            E+++  ++ EY D+ +F +T  +   E K KGK + ++       DSK+  IQ     AF  GD++ FFDLW+  + + +R+ DS+ QKLEF+  I+FAI+ +K+     D + +   +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++L+L++F  L F   N PKL+ +YK +G + K    ++ L  ++VE+ RRA   +KR N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF +Q  +       +  S+DF+RPGTAS MLR S+          +K+  D P+L        L++ K+K DL  G+ RLK  L QA RWRLT S   E R+  +     +DLL         ++ Q+L++K  S+ +++Y+ARLINA+A+L  GR YL +N ++  +L     G   EE    I REN++GALQK SLRR +QT MI +G+I WL+ LL++   L+DYTL+YSVALLMNLCLR++GK  C +    +++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S D        D++E++DDEED +++E++LDK+E       EL GE+LL T Y     ++  A    P          + RPVTPG        LG    +P + Q  R                                        P     S + P  A+   + +   P       ++  AF+ KP++P TP+  E+N LK  ++      S +GP Q+S   P ++A+  R    S S  K
Sbjct:    8 ESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKNVGGPLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKE--LLQQLHQQLVEAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ------SLAHSVDFTRPGTASTMLRASLA--------PEKLK-DVPLLPS------LDYEKLKKDLIWGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCH-SHNQRSVLQLLHSK--SEAVRQYMARLINALASLAEGRLYLAQNTKVLRMLE----GRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVAHPDDYKEGKPGVTGCGTSSSFMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSGHITREFVPAFTCKPQVPSTPETVEQNPLKAKALSLAPQFSSSGPQQAS--RPASTASSTRGLHSSQSIRK 817          
BLAST of LisH domain-containing protein ARMC9 vs. TrEMBL
Match: A0A2T7PPE1 (LisH domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02256 PE=4 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 1.596e-165
Identity = 321/840 (38.21%), Postives = 471/840 (56.07%), Query Frame = 1
Query:   43 MTGEINT-NFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSK--NIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYK-SGSDYK-NDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLN-NGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDVESRDKFISEITQHDLLGLEP-GEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNP-------TISRPVTPGTFLGK-----RNPT-PSDIQN------------------VRPPTRSGSNIDPQTAVENKVLVVKPDLMRDNP-------------------QYQKAFSSKPKIPRTPDEENLKRNSIQS------LTGPIQSSGRMPTTSANGNRKGKESMSTT 2373
            M+G ++   FE ++N+I+ EY D+  F +T  +   E K+K K +    +     D K   +Q +  + FH G    FF+LW   L   LR+ DSV QKLEF+  IYFA + IK+N    ++E+ AM  F++++ET+G+ +S   EF+ +YALP+V+NP+ HPS+ ++F + W   + +R+++F  L      +P+L +LY+ + +D+K N   +  LQ ++ ++ R+    ++R N+VQ DYH L+GITA+LVD LE +  GK ++P +LQ +C  LF S           ++ S+D +RPGTA   LR S+    +G +     I+ D              + KIK DL+  + R   L+ QA RWRLT+S  E RD+ I E  QHD+LG    G Y + I QML  K  S+ +++YLARL NA+A+LC GR YL  N  +   L   + G  H + + +E ++GALQKLSLRR +Q+ MI  G++EWL+ +LE+N  L+DYTL+YSVALLMNLCLRT+GKKRC  H  Q +++LS +L   N+EI  YVNGALYSIL IP IR+EA  M +E  L+  +K +  DMNRQ+E+II QL S +  +  ESDDE+++++DEED + LE++LDKEE   A   EL GE LL T+Y L +          P        + RPVTPG   G       NP+ PS + +                  VRPPTRSGS    Q +    +  V+P    ++                    +Y++AF SKP+IPRTPD     R++ +       L      SG  P+++           STT
Sbjct:    1 MSGNLSVVAFEGELNTIVKEYLDFGGFDSTLNAFEKECKEKNKAI-DILDKRAHGDEKLLAVQNQMMEFFHEGRSDFFFNLWQDHLPQALRDTDSVAQKLEFYLNIYFAAYPIKYNQPQNETEA-AMSKFKKFIETRGSNLSQTTEFLPYYALPFVTNPKTHPSYREIFAEGWSKDLAVRVEKFLTLALKSTTQPRLFDLYRGTQTDFKGNQQQILLLQQQLNDAERKTLTYIRRHNKVQADYHGLIGITADLVDALESTVQGKPITPEYLQQLCTRLFASH----------ISASVDLTRPGTAGEALRASVAPKRSGQLDAEAHINLD--------------YAKIKADLQSADDRRIALILQALRWRLTQSSPERRDRIIREYVQHDILGCSATGPYRERIMQML--KTSSEAVKQYLARLYNALASLCYGRGYLAMNPDLLPALMDILRGGEHRDLVAQEMVLGALQKLSLRRQLQSAMIERGVVEWLVGVLEDNDALSDYTLEYSVALLMNLCLRTAGKKRCAAHAHQTLQILSDLLGHDNQEIRPYVNGALYSILAIPSIREEAKAMGMEEILRCFIKDDQPDMNRQIEFIIKQLNSNENGEEYESDDEDDDEEDEEDQDALEADLDKEELLRAQAGELGGELLLTTHYPLIAPPDSSKGKRKPGDIHQDHPLQRPVTPGQRRGAFDVRSANPSRPSSVTDFRALTPGTARSDGVTKEMVRPPTRSGSRPTSQDSANRALSGVRPSSQHNDRAVRPSTRAMEKMGSDVNLNEYKQAFGSKPRIPRTPDTNGPSRSATRGSLKEMLLQPQYSQSGPRPSSAGKSGPASPHKKSTT 812          
BLAST of LisH domain-containing protein ARMC9 vs. TrEMBL
Match: A0A4W3HZC9 (LisH domain-containing protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 2.942e-159
Identity = 318/796 (39.95%), Postives = 462/796 (58.04%), Query Frame = 1
Query:   58 NTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQ--GFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLE-PGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-------------SLQSAHSRDANSSNPTISRPVTPGTFLGKRNPTPSDIQNV------RPPTRSGSNIDPQTAVENKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPD----EENLKRNSIQ---SLTGPIQSSGRMPTTSANGNR 2346
            N  +E ++N ++ EY  + D   T      E K KGK +P+S  S    +SK   +Q+    AF  G ++ FF+LW+  +  ++R+   + QKLEF+ QI+F IF +K++  + D      +   F++YLET+G  +S  PEF+ FYALP+V NP  HPSF +LFQD+W P +++RLK+F  +    +N P+L++LY              LQ ++VE+ RRA+  MK+ N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF ++       G  +  +IDF+RPGTAS MLR SI                 PV SK V   P L++ ++K DL +GN RLK LL QA RWRLT+S   E RD  +     +DLL      +  + +F + N+K  S+ +++Y ARL+NA A+L  GR YL +N  +  +L    L    ++SI REN++GALQKLSLRR +Q+ MI +G++ WL+ +LE++  L+DYTL+YS+AL MNLCLRT GK  C E+ +++++VLS +L   N EI  YVNGALYSIL +P IR EA  M +E  L   +K    +MNRQ+E+II QL S + P   ++D+EEEE+DDE++ E +E++LDK E     P EL GE+LL T Y              + S H     S +  + RPVTP T       +PS+          RPPTRSGS   P T+         P        Y  AFSS+P+IPRTP+       +K ++I    S +GP Q++   P ++ + NR
Sbjct:    4 NLTYEVELNDLVKEYLIFADLEETANHFEKECKNKGKTIPKSPGSNV-QESKILIVQDNILTAFEDGSRKVFFELWEEHIPQQIRDSQPLTQKLEFYLQIHFTIFPLKNSVGNPDKADTDERIFHFKKYLETRGATLSQTPEFLPFYALPFVPNPTVHPSFKELFQDSWTPELKMRLKKFLSMNLRAKNIPRLLSLYHQ------------LQQQLVEAERRAAAYMKKYNKMQEDYHNLIGVTAELVDSLEATVNGKMITPEYLQSVCIRLFSNKM------GQSLPQTIDFTRPGTASSMLRASIV----------------PVKSKDVPLLPSLDYERLKNDLVYGNDRLKALLLQALRWRLTQSQAGEQRDTVLQAYISNDLLECHRSSQVRNFLFNLFNSK--SEVVRQYTARLVNAFASLSDGRLYLSQNTVVLRVLE-ETLKAEEKDSITRENVLGALQKLSLRRVLQSTMIKDGIMFWLVNVLEDSDSLSDYTLEYSIALFMNLCLRTRGK--CAEYASRVLKVLSDLLGHENHEIRPYVNGALYSILAVPSIRDEAKAMGMEEILWCFIKEGSSEMNRQIEFIIKQLNSEEMPDDVDTDEEEEEEDDEDEHEAMEADLDKAEVLKPQPAELSGEKLLTTEYLGIMTNTVKARRKPMPSLH----QSFDEPLQRPVTPSTHRTTCTSSPSEESKFYSQPSSRPPTRSGSR--PTTS----GFFSSPKTGMRRHDYMTAFSSRPRIPRTPELITSPRKIKSSTIAPQFSQSGPQQTT--RPNSAGSSNR 747          
BLAST of LisH domain-containing protein ARMC9 vs. TrEMBL
Match: A0A210QD92 (LisH domain-containing protein ARMC9 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21204 PE=4 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 5.857e-158
Identity = 318/792 (40.15%), Postives = 436/792 (55.05%), Query Frame = 1
Query:   91 IIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSK--NIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLY---KSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQEL-QEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPTI-------SRPVTPGTFLGKRNPTPSDIQNV---------------RPPTRSGSNIDPQTAVENKVL--VVKPDLMRDNP-----------------------------------------QYQKAFSSKPKIPRTPD 2253
            ++ + D+  F  T  +   E  +K K V  S +  + S+ K   IQ      FH+G +   F LW+  L   +R+ D+V +KLEF+  IYFAI+ IK     ++ +   M  F++YLE +G  +S   EF+ FYALP+V N + HPS+ +LF D WI  +E RL++F  L      +PKL +LY   K G D  N   +  LQ ++V++ R+    +KR N++Q DYHNL+GITA+LV+ LE +  GK V+P +LQ IC  LF +           MN S+DF+RPGTAS  LRQSI       A  QK       + +P     L+F KIK D+     + K LL QA RWRLT+S+ + RD  ++    HDLLG   G  H T+  +L     S EL ++  ARL NA A+LC GR+YL +N  +   L L+ L    +ES+ RE ++GALQKLSLRR++QT MI  G+IEWL+ +LE+N  L+DYTL+YSVALLMNLCLRTSGKKRC+ H  Q ++VLS +L   N+EI  YVNGALYSIL IP IR+EA  M +E  L+  +K +  DMNRQ+E+II QL ST E   E + D+E+E+++EED + +E +LDK+E      NELCGE+LL T+Y      S+       T+        RPVTP    G  +P PS   +                RPPTRSGS    Q ++    L    +  L    P                                         +Y +AF S+PKIPRTPD
Sbjct:    1 MVHFLDFGGFDRTLSTFQKECDQKKKPV-TSHSIKSKSNQKLLAIQNDLMQQFHKGKRDRCFKLWNEHLPPNVRDSDAVAKKLEFYLNIYFAIYPIKFGRGQREGDR-CMTDFKKYLENRGASLSQTTEFLPFYALPFVPNAKSHPSYKELFTDAWIKDLENRLEKFLTLTLKSTPQPKLFDLYRGNKDGDDDDNFQQISRLQQQLVDAERKTMSYIKRHNRLQADYHNLIGITADLVEALESTVTGKPVTPEYLQEICARLFSAH----------MNQSVDFTRPGTASQFLRQSI-------APQQK------AMEEPEPYPSLDFTKIKQDMADATNKRKALLLQAMRWRLTQSNPQQRDTTMTAYRDHDLLGCVQGGPHRTV--VLGLLTSSDELVKQGAARLFNAFASLCAGRTYLAQNQDLFTSL-LDSLHSEEKESVTREMVLGALQKLSLRRNLQTSMIDAGLIEWLVKVLEDNDSLSDYTLEYSVALLMNLCLRTSGKKRCVTHANQTLKVLSDLLGHENQEIRPYVNGALYSILAIPSIREEAKAMGMEEILRCFIKEDQPDMNRQIEFIIKQLNST-ETVDEYASDDEDEEEEEEDQDAMELDLDKDEPIRPEGNELCGEQLLTTDYQAPGVGSKPKKRHTDTVMAQQVPLQRPVTPSQRRGTDSPHPSQAGSRAVSSLSRQATPSRLDRPPTRSGSRPSTQESLAQPGLRGPSRGPLRDGGPSRGMSRDGDRGDSRAESERPTSQASQKSLRPPSKASQVVGKEYTQAFGSRPKIPRTPD 763          
BLAST of LisH domain-containing protein ARMC9 vs. TrEMBL
Match: A0A4W3I081 (LisH domain-containing protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 4.333e-156
Identity = 321/804 (39.93%), Postives = 464/804 (57.71%), Query Frame = 1
Query:   58 NTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNF--QDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLE-PGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-------------SLQSAHSRDANSSNPTISRPVTPGTFLGKRNPTPSDIQNV------RPPTRSGSNIDPQTAVENKVLVVKPDLMRDNP--------QYQKAFSSKPKIPRTPD----EENLKRNSIQ---SLTGPIQSSGRMPTTSANGNR 2346
            N  +E ++N ++ EY  + D   T      E K KGK +P+S  S    +SK   +Q+    AF  G ++ FF+LW+  +  ++R+   + QKLEF+ QI+F IF +K++    DK      +  F++YLET+G  +S  PEF+ FYALP+V NP  HPSF +LFQD+W P +++RLK+F  +    +N P+L++LY              LQ ++VE+ RRA+  MK+ N++Q DYHNL+G+TAELVD LE +  GK ++P +LQ++C  LF ++       G  +  +IDF+RPGTAS MLR SI                 PV SK V   P L++ ++K DL +GN RLK LL QA RWRLT+S   E RD  +     +DLL      +  + +F + N+K  S+ +++Y ARL+NA A+L  GR YL +N  +  +L    L    ++SI REN++GALQKLSLRR +Q+ MI +G++ WL+ +LE++  L+DYTL+YS+AL MNLCLRT GK  C E+ +++++VLS +L   N EI  YVNGALYSIL +P IR EA  M +E  L   +K    +MNRQ+E+II QL S + P   ++D+EEEE+DDE++ E +E++LDK E     P EL GE+LL T Y              + S H     S +  + RPVTP T       +PS+          RPPTRSGS   P T+        K  LM             Y  AFSS+P+IPRTP+       +K ++I    S +GP Q++   P ++ + NR
Sbjct:    4 NLTYEVELNDLVKEYLIFADLEETANHFEKECKNKGKTIPKSPGSNV-QESKILIVQDNILTAFEDGSRKVFFELWEEHIPQQIRDSQPLTQKLEFYLQIHFTIFPLKNSVGNPDKADTDERIFHFKKYLETRGATLSQTPEFLPFYALPFVPNPTVHPSFKELFQDSWTPELKMRLKKFLSMNLRAKNIPRLLSLYHQ------------LQQQLVEAERRAAAYMKKYNKMQEDYHNLIGVTAELVDSLEATVNGKMITPEYLQSVCIRLFSNKM------GQSLPQTIDFTRPGTASSMLRASIV----------------PVKSKDVPLLPSLDYERLKNDLVYGNDRLKALLLQALRWRLTQSQAGEQRDTVLQAYISNDLLECHRSSQVRNFLFNLFNSK--SEVVRQYTARLVNAFASLSDGRLYLSQNTVVLRVLE-ETLKAEEKDSITRENVLGALQKLSLRRVLQSTMIKDGIMFWLVNVLEDSDSLSDYTLEYSIALFMNLCLRTRGK--CAEYASRVLKVLSDLLGHENHEIRPYVNGALYSILAVPSIRDEAKAMGMEEILWCFIKEGSSEMNRQIEFIIKQLNSEEMPDDVDTDEEEEEEDDEDEHEAMEADLDKAEVLKPQPAELSGEKLLTTEYLGIMTNTVKARRKPMPSLH----QSFDEPLQRPVTPSTHRTTCT-SPSEESKFYSQPSSRPPTRSGSR--PTTSGFFSSPASKLYLMPSTVFCYIYRRHDYMTAFSSRPRIPRTPELITSPRKIKSSTIAPQFSQSGPQQTT--RPNSAGSSNR 758          
BLAST of LisH domain-containing protein ARMC9 vs. TrEMBL
Match: K7F2T7 (Armadillo repeat containing 9 OS=Pelodiscus sinensis OX=13735 GN=ARMC9 PE=4 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 7.450e-156
Identity = 308/825 (37.33%), Postives = 462/825 (56.00%), Query Frame = 1
Query:   43 MTGEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDV-ESRDKFISEITQHDLLGLEPGE--YHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVP-NELCGEELLNTNYSLQSAHSRDAN---------SSNPTISRPVTPGTFLGKRNPTPSD--------------IQNVRPPTRSGS--------------NIDPQT-AVENKVLVVKPDLMRDN------PQYQKAFSSKPKIPRTPDEENLKRNSIQSLTGPIQSSGRMPTTSANGNRKGKE 2358
            M G+I   +E ++  ++ EY D+ +F +T  +   E K KGK +P++   +   DSK   IQ+    AF  G+++ FF+LW+  +S+ LR+ + + QKLEF+  I+FAI+ +KH+ +  D       +  F+ YLETKG  +S   EF+ FYALP+V NP  HPSF +LFQD+W P ++ RL++F  L     + P+L+ LYK       ++ ++ L  ++VE+  R    +KR N++Q+DYHNL+G+TAELVD LE +  GK ++P +LQ+IC  LF +Q  +       +  SIDF+RPGTAS MLR S+                 PV  + V   P L++ K+K DL  G+ RLK  L QA RWRLT S   E RD  +     +DLL +         ++ ++L++K  S+ +++Y+ARLINA A+L  GR YL +N ++ +LL    L    ++S+ REN++GALQK SLRR +Q+ MI++G+I WL+ +L++   L+DYTL+YSVALLMNLCLR+SGKK C +   ++++VLS +L   N EI  YVNGALYSIL IP IR+EA  M +E  L+  +K  + +M RQ+E+II QL S +        D+EEED+D+E+          ++  I     EL GE+LL T Y     H+             S +  + RPVTPG +     PTP +              +QN RPPTRSGS               +D  T AV         +  +D        ++  AF+SKP++PRTP+ ++           P    G++PT +   ++ G +
Sbjct:    1 MMGDI-LAYEAELLGLVKEYLDFAEFEDTVKTFTKECKIKGKPLPKTTGGS-LRDSKALIIQKDLLTAFENGNQKVFFELWEEHISSSLRDNEPLAQKLEFYLHIHFAIYLLKHSGRKPDKADFDERISRFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKTRLEKFLSLTLKASHAPRLLTLYKENGQCSKEM-LQQLHQQLVEAEHRNMTYLKRFNKIQVDYHNLIGVTAELVDSLEATVNGKMITPEYLQSICVRLFSNQMRQ------SIAHSIDFTRPGTASTMLRASLA----------------PVKMQEVPLLPSLDYEKLKKDLISGSDRLKTFLLQALRWRLTTSHPGEQRDTVLQAYISNDLLDIHNSSQSVQRSVLKLLHSK--SEAVRQYIARLINAFASLAEGRLYLSQNPKLLQLLE-ERLKAEDKDSLTRENVLGALQKFSLRRALQSAMINDGLIFWLVDVLKDTDCLSDYTLEYSVALLMNLCLRSSGKKMCAKVANRVLKVLSDLLGHENHEIQPYVNGALYSILAIPSIREEARAMGMEEILRCFIKEGNAEMIRQIEFIIKQLNSEEPLDDSVESDDEEEDEDDEEDHDTMEADLDKDEVIQPQLGELSGEKLLTTEYLGIMTHTPKVKKKLFPGVHLSVDEPLQRPVTPG-YHRAAYPTPENDAISSHGRDCKLQAMQNCRPPTRSGSRSSISNFGISSACLRMDQHTPAVTEDPSAQSTEFAQDRVNGLSYSEFCSAFTSKPRVPRTPEAQS-----------PSHRRGKIPTIAPQFSQSGPQ 785          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Cavefish
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:103047634])

HSP 1 Score: 475.322 bits (1222), Expect = 1.206e-155
Identity = 309/782 (39.51%), Postives = 459/782 (58.70%), Query Frame = 1
Query:   49 GEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNF--QDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGL-EPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY---------SLQSAHSRDANSSNPTISRPVTPGTF---LGKR-------------NPTPSDIQNVRPPTRSGSN----------IDPQTAVENKVLVVKPDLMRDNPQYQK----AFSSKPKIPRTPDEE 2259
            G+I  N E D+  +I EY  +++F +T      E K KGK VP++  S    DSK   IQ+    +F  GD + FF+LW   +   +R+ D   QKLEF+  I+F I+ +K+N   QDK      +  F+ YLET+G  +S   EF+ FYALP+V NP  HPSF +LFQD+W P +  +L++F   I    + P+L++LY+  +    + S+K +Q ++ E+ ++AS  M+R  ++Q DYHNL+G+TAELVD LE +  GK +SP +LQN+C  LF  Q       G  M  SIDF+RPGTAS MLR SI       A   K   D P+L        L+++K+K DL  G+ RLK LL QA RWRLT++   E RD  +     +DLL   +P +   ++ Q++ +   ++ +++Y ARLINA A++  GR+YL +   + +LL ++ L    ++S+ REN++GA+QKLSLRR  Q+ +I NGMI WL+  L+++  L+DYTL+Y+VALLMNLCLRT GKK+C E+   +++VLS +L   N E+  YVNG LYSIL +P +RQEA  M +E  L+ + K E+ ++NRQ+++II +L S +EP+ E   +++E+D+D+++ +V+E++LDKEE     P EL GE LL T Y           Q      A SS+  + RPVTP +    +G R             +P PS     RPPTRSGS           +D +    ++  +  PD  R N   Q       +++PKIPR+PD +
Sbjct:   10 GDILAN-EADLLLMIKEYLKFSEFEDTVKIFEKECKSKGKPVPKTPRSPPV-DSKILIIQKDLISSFDDGDMKVFFELWAENVPVDIRDSDPNVQKLEFYLHIHFVIYPLKNNVGRQDKADFDERISHFKHYLETRGAALSQTTEFLPFYALPFVPNPAVHPSFQELFQDSWAPDLRKKLEKFLTTILTSLSSPRLLSLYRESTKSSKE-SLKQMQAQLAEAEKKASSYMRRHGKMQADYHNLIGVTAELVDSLEATVSGKMISPEYLQNVCTRLFSGQM------GQSMVQSIDFTRPGTASSMLRASI------AAQRPK---DVPLLPS------LDYDKLKNDLMTGSDRLKALLLQALRWRLTRTVQGEQRDTVLQAYISNDLLNCCKPKQ--KSVLQLIRS--NNEIVRQYTARLINAFASVSEGRTYLSRFPSLLKLL-VDCLQTEEKDSVARENVLGAMQKLSLRRVHQSALIRNGMIGWLVDELQDSDCLSDYTLEYAVALLMNLCLRTQGKKKCTENTKHVLKVLSDLLGHENHEVRPYVNGTLYSILSVPSVRQEARAMSMEEILRCYTKEENPELNRQIQFIIDELNSVEEPQDEHDSEDDEDDEDDDEEDVMEADLDKEEVLQPRPKELSGENLLTTEYLGIMTNMVKGKQRWKGLSAQSSDEPLQRPVTPSSHRNTMGSRAGRDGTDLSSPFHSPFPS-----RPPTRSGSRPSTSDSTHRALDSECWRSSQESLGPPDTHRINGHSQSDLAPGLATRPKIPRSPDSD 757          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Cavefish
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:103047634])

HSP 1 Score: 466.848 bits (1200), Expect = 3.961e-152
Identity = 309/794 (38.92%), Postives = 459/794 (57.81%), Query Frame = 1
Query:   49 GEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNF--QDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGT------------ASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGL-EPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY---------SLQSAHSRDANSSNPTISRPVTPGTF---LGKR-------------NPTPSDIQNVRPPTRSGSN----------IDPQTAVENKVLVVKPDLMRDNPQYQK----AFSSKPKIPRTPDEE 2259
            G+I  N E D+  +I EY  +++F +T      E K KGK VP++  S    DSK   IQ+    +F  GD + FF+LW   +   +R+ D   QKLEF+  I+F I+ +K+N   QDK      +  F+ YLET+G  +S   EF+ FYALP+V NP  HPSF +LFQD+W P +  +L++F   I    + P+L++LY+  +    + S+K +Q ++ E+ ++AS  M+R  ++Q DYHNL+G+TAELVD LE +  GK +SP +LQN+C  LF  Q       G  M  SIDF+RPGT            AS MLR SI       A   K   D P+L        L+++K+K DL  G+ RLK LL QA RWRLT++   E RD  +     +DLL   +P +   ++ Q++ +   ++ +++Y ARLINA A++  GR+YL +   + +LL ++ L    ++S+ REN++GA+QKLSLRR  Q+ +I NGMI WL+  L+++  L+DYTL+Y+VALLMNLCLRT GKK+C E+   +++VLS +L   N E+  YVNG LYSIL +P +RQEA  M +E  L+ + K E+ ++NRQ+++II +L S +EP+ E   +++E+D+D+++ +V+E++LDKEE     P EL GE LL T Y           Q      A SS+  + RPVTP +    +G R             +P PS     RPPTRSGS           +D +    ++  +  PD  R N   Q       +++PKIPR+PD +
Sbjct:   10 GDILAN-EADLLLMIKEYLKFSEFEDTVKIFEKECKSKGKPVPKTPRSPPV-DSKILIIQKDLISSFDDGDMKVFFELWAENVPVDIRDSDPNVQKLEFYLHIHFVIYPLKNNVGRQDKADFDERISHFKHYLETRGAALSQTTEFLPFYALPFVPNPAVHPSFQELFQDSWAPDLRKKLEKFLTTILTSLSSPRLLSLYRESTKSSKE-SLKQMQAQLAEAEKKASSYMRRHGKMQADYHNLIGVTAELVDSLEATVSGKMISPEYLQNVCTRLFSGQM------GQSMVQSIDFTRPGTGYYSMTPYDDGYASSMLRASI------AAQRPK---DVPLLPS------LDYDKLKNDLMTGSDRLKALLLQALRWRLTRTVQGEQRDTVLQAYISNDLLNCCKPKQ--KSVLQLIRS--NNEIVRQYTARLINAFASVSEGRTYLSRFPSLLKLL-VDCLQTEEKDSVARENVLGAMQKLSLRRVHQSALIRNGMIGWLVDELQDSDCLSDYTLEYAVALLMNLCLRTQGKKKCTENTKHVLKVLSDLLGHENHEVRPYVNGTLYSILSVPSVRQEARAMSMEEILRCYTKEENPELNRQIQFIIDELNSVEEPQDEHDSEDDEDDEDDDEEDVMEADLDKEEVLQPRPKELSGENLLTTEYLGIMTNMVKGKQRWKGLSAQSSDEPLQRPVTPSSHRNTMGSRAGRDGTDLSSPFHSPFPS-----RPPTRSGSRPSTSDSTHRALDSECWRSSQESLGPPDTHRINGHSQSDLAPGLATRPKIPRSPDSD 769          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Cavefish
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:103047634])

HSP 1 Score: 428.713 bits (1101), Expect = 1.801e-139
Identity = 275/686 (40.09%), Postives = 406/686 (59.18%), Query Frame = 1
Query:   49 GEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKN--IQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNF--QDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGL-EPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY---------SLQSAHSRDANSSNPTISRPVTPGT 2061
            G+I  N E D+  +I EY  +++F +T      E K KGK VP++  S    DSK   IQ+    +F  GD + FF+LW   +   +R+ D   QKLEF+  I+F I+ +K+N   QDK      +  F+ YLET+G  +S   EF+ FYALP+V NP  HPSF +LFQD+W P +  +L++F   I              S     +  S+K +Q ++ E+ ++AS  M+R  ++Q DYHNL+G+TAELVD LE +  GK +SP +LQN+C  LF  Q       G  M  SIDF+RPGT S      I +         ++  D P+L        L+++K+K DL  G+ RLK LL QA RWRLT++   E RD  +     +DLL   +P +   ++ Q++ +   ++ +++Y ARLINA A++  GR+YL +   + +LL ++ L    ++S+ REN++GA+QKLSLRR  Q+ +I NGMI WL+  L+++  L+DYTL+Y+VALLMNLCLRT GKK+C E+   +++VLS +L   N E+  YVNG LYSIL +P +RQEA  M +E  L+ + K E+ ++NRQ+++II +L S  E   +E D E++EDD+++D +V+E++LDKEE     P EL GE LL T Y           Q      A SS+  + RPVTP +
Sbjct:    2 GDILAN-EADLLLMIKEYLKFSEFEDTVKIFEKECKSKGKPVPKTPRSPPV-DSKILIIQKDLISSFDDGDMKVFFELWAENVPVDIRDSDPNVQKLEFYLHIHFVIYPLKNNVGRQDKADFDERISHFKHYLETRGAALSQTTEFLPFYALPFVPNPAVHPSFQELFQDSWAPDLRKKLEKFLTTI----------LTSLSSPRLLSLYSLKQMQAQLAEAEKKASSYMRRHGKMQADYHNLIGVTAELVDSLEATVSGKMISPEYLQNVCTRLFSGQM------GQSMVQSIDFTRPGTVSHNAHTHISVI--------RMPKDVPLLPS------LDYDKLKNDLMTGSDRLKALLLQALRWRLTRTVQGEQRDTVLQAYISNDLLNCCKPKQ--KSVLQLIRS--NNEIVRQYTARLINAFASVSEGRTYLSRFPSLLKLL-VDCLQTEEKDSVARENVLGAMQKLSLRRVHQSALIRNGMIGWLVDELQDSDCLSDYTLEYAVALLMNLCLRTQGKKKCTENTKHVLKVLSDLLGHENHEVRPYVNGTLYSILSVPSVRQEARAMSMEEILRCYTKEENPELNRQIQFIIDELNSV-EEPQDEHDSEDDEDDEDDDEDVMEADLDKEEVLQPRPKELSGENLLTTEYLGIMTNMVKGKQRWKGLSAQSSDEPLQRPVTPSS 649          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Sea Lamprey
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:100334308])

HSP 1 Score: 454.136 bits (1167), Expect = 1.012e-147
Identity = 316/850 (37.18%), Postives = 464/850 (54.59%), Query Frame = 1
Query:   67 FETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESI--AMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTE--IVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQ-QHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSD-VESRDKFISEITQHDLLGLEP-GEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSL---RRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY------SLQSAHSRD-----ANSSNPTISRPVTPGTFL--------------GKRNPTPSDIQNVRPPTRSGS----------------------NIDPQTAVENKV----------LVVKPDLMRDNPQ----YQKAFSSKPKIPRTPDE---ENLKRNSIQSL------TGPIQSSGRMPTTSANGNRKGKESMSTT 2373
            +E +++SII EY ++ ++  T  +L  E   KGK VP+S      S+   +Q     AF +G++ EFF LW   +   L + D   QKLEF+ QI+FAI+ I+H     DS  +  +M  F+ +LET+G+ +S   EF+ FYALP+V  P  HPSF QLF ++W P +  +L+RF  L     + P+L+ L+K G     D+  +  + E   V+++RRA+   +R +++Q DYH L+ +TAELVD LE +  GK ++  +LQ+IC  LF SQ +H L         S+DF+RPGTAS +LR S+                 P+  + +   P L+++K++ DL HG  RLK LL QA RWRLTKS   E RD  +     +DLLG     +Y+  +  +L +K  S+ +++Y ARLINA+A+L  GR+YL ++  +  +L    L     +S+ REN++GALQKLSL   RR +QT MI +G++ WL++ L +   L+DYTL+YSVALLMNLCLR++GK++C E    + +VL+ +L   N+EI  YVNGALYSIL +  IR+EA  M +E  L   +K  + + NRQ+E+II QL S    +  ESDDEE+E++DEE+ + +E +LDK E       EL GE+LL+  Y      +LQ  H R      + S N  + RPVTP T                G      SD+ + RPPTRSGS                      N + Q                 + V+ D MR+        + AF S+P+IPRTP+    + L+  +  SL       GP Q  GR P++  +   K   S +TT
Sbjct:    7 YEAELSSIIREYLNFMEYEETVKALDRECSSKGKAVPKSGGVMKDSNVLLVQGELLSAFDQGERTEFFVLWGENIPGTLCDSDPTAQKLEFYLQIHFAIYPIQHAVGKPDSAMVEASMTEFKTFLETRGSALSQTTEFLPFYALPFVPKPAAHPSFRQLFSNSWTPELRTQLERFLSLTLKANSFPRLLTLFKEGGHASRDLHERLHECERRAVDADRRATGYTRRYSKLQADYHGLISVTAELVDSLEATISGKMITAEYLQSICTRLFSSQLRHSLVH-------SVDFTRPGTASTILRASVA----------------PMHPRDIPLLPSLDYDKLRHDLLHGTDRLKALLLQALRWRLTKSQQGEQRDTVLQAFIANDLLGCHARSQYNADVLGLLMSK--SEVVRQYTARLINALASLADGRTYLSQSPAVLRVLQ-ESLQAEDRDSLTRENVLGALQKLSLKRTRRSLQTAMIQDGLVLWLISELGDTDALSDYTLEYSVALLMNLCLRSAGKRKCAEDARSVFKVLTDLLGHENQEIRPYVNGALYSILALYSIREEAKAMGMEEILSCFVKEGNVETNRQIEFIIKQLNSDSPDEGVESDDEEQEEEDEEEQDGMELDLDKAEVLRPQAGELTGEKLLSAEYLGIMTNTLQ--HRRRNPAIVSQSMNEPLQRPVTPSTHRSALTVIRPVNLSEGGGSVTAHSDVSS-RPPTRSGSRPSSASPASKAQTMNTFTPGSPNKERQVGKRGSRWGHSCRTGWDVEVERDPMRNLEAGVRDVKVAFGSRPRIPRTPESSAAQALRLKTPPSLAPRFSRAGPQQ--GR-PSSGGSSKHKQHASRTTT 824          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Nematostella
Match: EDO42368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S2])

HSP 1 Score: 380.948 bits (977), Expect = 1.101e-122
Identity = 240/594 (40.40%), Postives = 349/594 (58.75%), Query Frame = 1
Query:  220 QERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELR--LKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKST--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY 1986
            Q     AF  G  + FF  W+ KL   +   DS CQKLEF   IYFA++ I +  Q+K     +M+ F+ YLE KG  +S   EF+ +YALP+V +P  HPSF  LF + W  G+ELR  L  F +     Q +PKL  L+ S      +  ++ L  ++ E   R++Q  K+ +++Q DYH L+G+ AELVD LE +  GK V+P +L +IC  LF +              SID ++PGTAS MLR SI  N  SV  N          S P     L+F KIK DL       + LL QA RWRLTK+ ++++R         HDLLGL   +    + Q+L+  + S  +++Y+ARLINA+A+L  GRSYL +N+ +  +L+  ++    + SI  +N++GALQKLSLRR +Q+ MI N +I+WL+ LLE++  L+DY L+Y+VALLMNL LR+ GKKRCI     +++VLS +L   N+EI  Y+NGALYS+L +P I++ A  M +E+ L+  +  +  ++ RQ+++II QL +          SDDE+EEDDD+ + + ++ ELDK E  + V  EL G+ELL   Y
Sbjct:    4 QLSILSAFDNGSYQTFFTTWNNKLPVDVLQSDSTCQKLEFNLNIYFAVYPITNGRQNKHQLEQSMRIFKAYLENKGAGLSQTTEFLPYYALPFVPDPTTHPSFKPLFSNTW--GLELRSTLDSFLKTALKSQEKPKLYTLFVSFIPIHAE-QVRLLHHQLSEVEHRSAQHFKKYSRIQGDYHKLIGVAAELVDSLENAVRGKMVTPEYLHDICMRLFNNSSQ----------DSIDVTKPGTASSMLRASIAQNAQSVEVN----------SIPA----LDFEKIKSDLVSLPDHKRTLLLQALRWRLTKAKNMDARIASARAFIIHDLLGLSVPDDIRGVLQILS--HASDVVRQYMARLINAMASLAAGRSYLTQNSDLILVLHSTLVA-EKKASITSDNILGALQKLSLRRRLQSVMIENDLIQWLVGLLEDHDSLSDYALEYAVALLMNLVLRSKGKKRCISDAGTVLKVLSDLLGHENQEIRPYINGALYSLLALPAIKEAARAMGMESILECFLDDDTPELKRQIQFIIKQLNTENPQATNAPMSDDEDEEDDDDFEGDTIDMELDKHEVQLPVEGELAGDELLAAEY 567          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Medaka
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:101159181])

HSP 1 Score: 441.81 bits (1135), Expect = 2.000e-142
Identity = 311/834 (37.29%), Postives = 449/834 (53.84%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSE-NSTTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN--FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRD-----ANSSNPTISRPVTP--------GTFLGKRNPTPSDIQNV----------------RPPTRSGSNIDPQTAVENKV-------------------LVVKPDLMRDN-----PQYQKAFSSKPKIPRTPD-------EENLKRNSIQ---SLTGPIQSSGRMPTTSANGNRKG 2352
            E D+  +I EY  + +F  T      E K KGK V +   N+   S ++ IQE    +F  GD + FF+LW   + +++++ D+  Q LEF+  ++F IF ++ +   QD+      +  F++YLET+G ++S N EF+ +YALP+V  P  HPSF  LF+D WI  ++ RL +F  +       P+L+ LYK G     D+ ++ LQ ++ ES+RR S  +++ N++Q DYHNL+GITAELVD LE +  GK +SP +LQ++   LF +Q          M  S DF+RPGTAS MLR SI                 P   K V   P L++ K+K DL  G+ RLK LL QA RWRLT+S   E R+  +     +DLLG    +   T+  +L +   ++ +++Y+ARLINA A+L  GR YL     + ++L +  L    ++S+  EN++  LQKLSLRR  QT MI++ +I WL   L+++  L+DYTL YS ALLMNLCLRT GKK+C E+   +++VL+ +L   N EI  YVNGALYSIL IP +RQEA  M +E  L  + K ++QD NRQ+E+II QL S +E   E  D++EE+D DE+  E       +EE       EL GE LL T Y     ++  A  R      +N   P + RPVTP        G F    N  P  IQ V                RPPTRSGS     +++ + +                    VVK     ++       Y  AF+SKPKIPRTPD        ++ +R ++Q   S +GP QS+   P++++   R G
Sbjct:   16 EADLLGMIKEYLKFGEFEETVQIFDKECKSKGKLVSKPRGNALRDSKTRVIQEDLLSSFDDGDHKVFFELWKENIPSEVKDLDAETQGLEFYLHVHFTIFPLRSHPVRQDRTEFEERISHFKQYLETRGAELSQNAEFLPYYALPFVPFPAVHPSFKDLFKDTWIQQLKGRLDKFLTMTLKPSKTPRLMTLYKEGGKVTKDI-IQQLQLQLAESDRRLSSCLRKFNKMQADYHNLIGITAELVDSLEATISGKMISPEYLQSVYARLFNNQ----------MRQSSDFTRPGTASSMLRASIA----------------PPRPKEVPILPSLDYEKLKKDLIEGSDRLKTLLLQALRWRLTRSLPGEQRETVLQAYIGNDLLGRYSTQ-QKTVLLLLRSP--NEIVRQYMARLINAFASLVEGRIYLSHIPVLLKIL-METLRKEEKDSLTWENVLVCLQKLSLRRSQQTIMIADDLIGWLTDELQDSDCLSDYTLVYSAALLMNLCLRTKGKKKCAENAKLVLKVLTDLLGHENHEIRPYVNGALYSILSIPSVRQEAKEMSVEEILHCYNKEKNQDFNRQIEFIIKQLNSAEEEGPESDDEDEEDDKDEDLLETDLY---REELLQPEHGELSGESLLTTEYLGIMTNMAKAKRRSTPLPQSNGDGP-LQRPVTPSSHRDLTTGDFRAI-NQGPELIQEVPQKSVERSFPLSQYNSRPPTRSGSRPSTDSSLRHSIDSESGQFFQAAEGDGSHEHRVVKEYSHAEHNGHGSGGYTTAFTSKPKIPRTPDTLISPSSAQHDRRLALQPKFSQSGPQQSN--RPSSASFAGRGG 811          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Medaka
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:101159181])

HSP 1 Score: 436.417 bits (1121), Expect = 3.202e-140
Identity = 307/834 (36.81%), Postives = 451/834 (54.08%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSE-NSTTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN--FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRD-----ANSSNPTISRPVTP--------GTFLGKRNPTPSDIQNV----------------RPPTRSGSNIDPQTAVENKV-------------------LVVKPDLMRDN-----PQYQKAFSSKPKIPRTPD-------EENLKRNSIQ---SLTGPIQSSGRMPTTSANGNRKG 2352
            E D+  +I EY  + +F  T      E K KGK V +   N+   S ++ IQE    +F  GD + FF+LW   + +++++ D+  Q LEF+  ++F IF ++ +   QD+      +  F++YLET+G ++S N EF+ +YALP+V  P  HPSF  LF+D WI  ++ RL +F  +       P+L+ LYK G     D+ ++ LQ ++ ES+RR S  +++ N++Q DYHNL+GITAELVD LE +  GK +SP +LQ++   LF +Q          M  S DF+RPGT    +      ++G  ++  + S  PP   K V   P L++ K+K DL  G+ RLK LL QA RWRLT+S   E R+  +     +DLLG    +   T+  +L +   ++ +++Y+ARLINA A+L  GR YL     + ++L +  L    ++S+  EN++  LQKLSLRR  QT MI++ +I WL   L+++  L+DYTL YS ALLMNLCLRT GKK+C E+   +++VL+ +L   N EI  YVNGALYSIL IP +RQEA  M +E  L  + K ++QD NRQ+E+II QL S +E   E  D++EE+D DE+  E       +EE       EL GE LL T Y     ++  A  R      +N   P + RPVTP        G F    N  P  IQ V                RPPTRSGS     +++ + +                    VVK     ++       Y  AF+SKPKIPRTPD        ++ +R ++Q   S +GP QS+   P++++   R G
Sbjct:   16 EADLLGMIKEYLKFGEFEETVQIFDKECKSKGKLVSKPRGNALRDSKTRVIQEDLLSSFDDGDHKVFFELWKENIPSEVKDLDAETQGLEFYLHVHFTIFPLRSHPVRQDRTEFEERISHFKQYLETRGAELSQNAEFLPYYALPFVPFPAVHPSFKDLFKDTWIQQLKGRLDKFLTMTLKPSKTPRLMTLYKEGGKVTKDI-IQQLQLQLAESDRRLSSCLRKFNKMQADYHNLIGITAELVDSLEATISGKMISPEYLQSVYARLFNNQ----------MRQSSDFTRPGTGYYSMSP---YDDGYASSMLRASIAPPR-PKEVPILPSLDYEKLKKDLIEGSDRLKTLLLQALRWRLTRSLPGEQRETVLQAYIGNDLLGRYSTQ-QKTVLLLLRSP--NEIVRQYMARLINAFASLVEGRIYLSHIPVLLKIL-METLRKEEKDSLTWENVLVCLQKLSLRRSQQTIMIADDLIGWLTDELQDSDCLSDYTLVYSAALLMNLCLRTKGKKKCAENAKLVLKVLTDLLGHENHEIRPYVNGALYSILSIPSVRQEAKEMSVEEILHCYNKEKNQDFNRQIEFIIKQLNSAEEEGPESDDEDEEDDKDEDLLETDLY---REELLQPEHGELSGESLLTTEYLGIMTNMAKAKRRSTPLPQSNGDGP-LQRPVTPSSHRDLTTGDFRAI-NQGPELIQEVPQKSVERSFPLSQYNSRPPTRSGSRPSTDSSLRHSIDSESGQFFQAAEGDGSHEHRVVKEYSHAEHNGHGSGGYTTAFTSKPKIPRTPDTLISPSSAQHDRRLALQPKFSQSGPQQSN--RPSSASFAGRGG 823          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Medaka
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:101159181])

HSP 1 Score: 427.943 bits (1099), Expect = 1.119e-137
Identity = 285/738 (38.62%), Postives = 409/738 (55.42%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSE-NSTTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN--FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRD-----ANSSNPTISRPVTP--------GTFLGKRNPTPSDIQNV----------------RPPTRSGSNIDPQTAVENKV 2166
            E D+  +I EY  + +F  T      E K KGK V +   N+   S ++ IQE    +F  GD + FF+LW   + +++++ D+  Q LEF+  ++F IF ++ +   QD+      +  F++YLET+G ++S N EF+ +YALP+V  P  HPSF  LF+D WI  ++ RL +F  +       P+L+ LYK G     D+ ++ LQ ++ ES+RR S  +++ N++Q DYHNL+GITAELVD LE +  GK +SP +LQ++   LF +Q          M  S DF+RPGTAS MLR SI                 P   K V   P L++ K+K DL  G+ RLK LL QA RWRLT+S   E R+  +     +DLLG    +   T+  +L +   ++ +++Y+ARLINA A+L  GR YL     + ++L +  L    ++S+  EN++  LQKLSLRR  QT MI++ +I WL   L+++  L+DYTL YS ALLMNLCLRT GKK+C E+   +++VL+ +L   N EI  YVNGALYSIL IP +RQEA  M +E  L  + K ++QD NRQ+E+II QL S +E   E  D++EE+D DE+  E       +EE       EL GE LL T Y     ++  A  R      +N   P + RPVTP        G F    N  P  IQ V                RPPTRSGS     +++ + +
Sbjct:   16 EADLLGMIKEYLKFGEFEETVQIFDKECKSKGKLVSKPRGNALRDSKTRVIQEDLLSSFDDGDHKVFFELWKENIPSEVKDLDAETQGLEFYLHVHFTIFPLRSHPVRQDRTEFEERISHFKQYLETRGAELSQNAEFLPYYALPFVPFPAVHPSFKDLFKDTWIQQLKGRLDKFLTMTLKPSKTPRLMTLYKEGGKVTKDI-IQQLQLQLAESDRRLSSCLRKFNKMQADYHNLIGITAELVDSLEATISGKMISPEYLQSVYARLFNNQ----------MRQSSDFTRPGTASSMLRASI----------------APPRPKEVPILPSLDYEKLKKDLIEGSDRLKTLLLQALRWRLTRSLPGEQRETVLQAYIGNDLLGRYSTQ-QKTVLLLLRSP--NEIVRQYMARLINAFASLVEGRIYLSHIPVLLKIL-METLRKEEKDSLTWENVLVCLQKLSLRRSQQTIMIADDLIGWLTDELQDSDCLSDYTLVYSAALLMNLCLRTKGKKKCAENAKLVLKVLTDLLGHENHEIRPYVNGALYSILSIPSVRQEAKEMSVEEILHCYNKEKNQDFNRQIEFIIKQLNSAEEEGPESDDEDEEDDKDEDLLETDLY---REELLQPEHGELSGESLLTTEYLGIMTNMAKAKRRSTPLPQSNGDGP-LQRPVTPSSHRDLTTGDFRAI-NQGPELIQEVPQKSVERSFPLSQYNSRPPTRSGSRPSTDSSLRHSI 717          
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Medaka
Match: armc9 (armadillo repeat containing 9 [Source:NCBI gene;Acc:101159181])

HSP 1 Score: 411.379 bits (1056), Expect = 1.025e-132
Identity = 271/681 (39.79%), Postives = 393/681 (57.71%), Query Frame = 1
Query:   70 ETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSE-NSTTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHN--FQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKP-LNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKS-DVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEE--SIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNY-----SLQSAHSRD-----ANSSNPTISRPVTPGT 2061
            E D+  +I EY  + +F  T      E K KGK V +   N+   S ++ IQE    +F  GD + FF+LW   + +++++ D+  Q LEF+  ++F IF ++ +   QD+      +  F++YLET+G ++S N EF+ +YALP+V  P  HPSF  LF+D WI  ++ RL +F  +       P+L+ LY S S          LQ ++ ES+RR S  +++ N++Q DYHNL+GITAELVD LE +  GK +SP +LQ++   LF +Q          M  S DF+RPGTAS MLR SI                 P   K V   P L++ K+K DL  G+ RLK LL QA RWRLT+S   E R+  +     +DLLG    +   T+  +L +   ++ +++Y+ARLINA A+L  GR YL   + I  LL + +  L  EE  S+  EN++  LQKLSLRR  QT MI++ +I WL   L+++  L+DYTL YS ALLMNLCLRT GKK+C E+   +++VL+ +L   N EI  YVNGALYSIL IP +RQEA  M +E  L  + K ++QD NRQ+E+II QL S    + E  + ++E+++D++D ++LE++L +EE       EL GE LL T Y     ++  A  R      +N   P + RPVTP +
Sbjct:    8 EADLLGMIKEYLKFGEFEETVQIFDKECKSKGKLVSKPRGNALRDSKTRVIQEDLLSSFDDGDHKVFFELWKENIPSEVKDLDAETQGLEFYLHVHFTIFPLRSHPVRQDRTEFEERISHFKQYLETRGAELSQNAEFLPYYALPFVPFPAVHPSFKDLFKDTWIQQLKGRLDKFLTMTLKPSKTPRLMTLYVSFS--------LQLQLQLAESDRRLSSCLRKFNKMQADYHNLIGITAELVDSLEATISGKMISPEYLQSVYARLFNNQ----------MRQSSDFTRPGTASSMLRASI----------------APPRPKEVPILPSLDYEKLKKDLIEGSDRLKTLLLQALRWRLTRSLPGEQRETVLQAYIGNDLLGRYSTQ-QKTVLLLLRSP--NEIVRQYMARLINAFASLVEGRIYL---SHIPVLLKILMETLRKEEKDSLTWENVLVCLQKLSLRRSQQTIMIADDLIGWLTDELQDSDCLSDYTLVYSAALLMNLCLRTKGKKKCAENAKLVLKVLTDLLGHENHEIRPYVNGALYSILSIPSVRQEAKEMSVEEILHCYNKEKNQDFNRQIEFIIKQLNSA---EEEGPESDDEDEEDDKDEDLLETDLYREELLQPEHGELSGESLLTTEYLGIMTNMAKAKRRSTPLPQSNGDGP-LQRPVTPSS 644          
BLAST of LisH domain-containing protein ARMC9 vs. Planmine SMEST
Match: SMESG000049428.1 (SMESG000049428.1)

HSP 1 Score: 1533.85 bits (3970), Expect = 0.000e+0
Identity = 776/778 (99.74%), Postives = 776/778 (99.74%), Query Frame = 1
Query:   43 MTGEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPTISRPVTPGTFLGKRNPTPSDIQNVRPPTRSGSNIDPQTAVENKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPDEENLKRNSIQSLTGPIQSSGRMPTTSANGNRKGKESMSTTK 2376
            MTGEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENST FSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTDEPKIEESDDEEEEDDDEEDPEVLESELDKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPTISRPVTPGTFLGKRNPTPSDIQNVR PTRSGSNIDPQTAVENKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPDEENLKRNSIQSLTGPIQSSGRMPTTSANGNRKGKESMSTTK
Sbjct:    1 MTGEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENSTPFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFFCQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYALPYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKSGSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVDLLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTASMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGNLRLKVLLFQAFRWRLTKSDVESRDKFISEITQHDLLGLEPGEYHDTIFQMLNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTHEESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTLDYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGALYSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTDEPKIEESDDEEEEDDDEEDPEVLESELDKEESCIAVPNELCGEELLNTNYSLQSAHSRDANSSNPTISRPVTPGTFLGKRNPTPSDIQNVRTPTRSGSNIDPQTAVENKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPDEENLKRNSIQSLTGPIQSSGRMPTTSANGNRKGKESMSTTK 778          
The following BLAST results are available for this feature:
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARMC91.427e-15041.39armadillo repeat containing 9 [Source:HGNC Symbol;... [more]
ARMC94.832e-14940.81armadillo repeat containing 9 [Source:HGNC Symbol;... [more]
ARMC94.832e-14940.81armadillo repeat containing 9 [Source:HGNC Symbol;... [more]
ARMC91.856e-4449.43armadillo repeat containing 9 [Source:HGNC Symbol;... [more]
ARMC91.774e-3843.06armadillo repeat containing 9 [Source:HGNC Symbol;... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F59G1.42.660e-1527.53F59G1.4 [Source:UniProtKB/TrEMBL;Acc:G5ECV5][more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
armc98.753e-7940.28armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc91.727e-7539.33armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc95.103e-7340.71armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
armc93.021e-13538.78armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc92.674e-13238.74armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc91.168e-12839.11armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc97.407e-12736.83armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc91.005e-12639.10armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Armc93.611e-15037.49armadillo repeat containing 9 [Source:MGI Symbol;A... [more]
Armc92.258e-14941.39armadillo repeat containing 9 [Source:MGI Symbol;A... [more]
Armc97.253e-14937.41armadillo repeat containing 9 [Source:MGI Symbol;A... [more]
Armc91.182e-4154.48armadillo repeat containing 9 [Source:MGI Symbol;A... [more]
Armc97.556e-1140.82armadillo repeat containing 9 [Source:MGI Symbol;A... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7F187|ARMC9_DANRE9.712e-15037.59LisH domain-containing protein ARMC9 OS=Danio reri... [more]
sp|Q2KI89|ARMC9_BOVIN1.468e-14840.64LisH domain-containing protein ARMC9 OS=Bos taurus... [more]
sp|Q5R629|ARMC9_PONAB2.181e-14841.10LisH domain-containing protein ARMC9 OS=Pongo abel... [more]
sp|Q7Z3E5|ARMC9_HUMAN2.320e-14840.81LisH domain-containing protein ARMC9 OS=Homo sapie... [more]
sp|Q9D2I5|ARMC9_MOUSE5.074e-14837.41LisH domain-containing protein ARMC9 OS=Mus muscul... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PPE11.596e-16538.21LisH domain-containing protein OS=Pomacea canalicu... [more]
A0A4W3HZC92.942e-15939.95LisH domain-containing protein OS=Callorhinchus mi... [more]
A0A210QD925.857e-15840.15LisH domain-containing protein ARMC9 OS=Mizuhopect... [more]
A0A4W3I0814.333e-15639.93LisH domain-containing protein OS=Callorhinchus mi... [more]
K7F2T77.450e-15637.33Armadillo repeat containing 9 OS=Pelodiscus sinens... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
armc91.206e-15539.51armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc93.961e-15238.92armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc91.801e-13940.09armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc91.012e-14737.18armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423681.101e-12240.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
armc92.000e-14237.29armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc93.202e-14036.81armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc91.119e-13738.62armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
armc91.025e-13239.79armadillo repeat containing 9 [Source:NCBI gene;Ac... [more]
back to top
BLAST of LisH domain-containing protein ARMC9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049428.10.000e+099.74SMESG000049428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024984 ID=SMED30024984|Name=LisH domain-containing protein ARMC9|organism=Schmidtea mediterranea sexual|type=transcript|length=2515bp
ATCTATATAAATCTTATATGCTGAAAAATAGTGCGTTTTAAGATGACAGG
TGAGATAAATACAAATTTTGAAACAGACATCAATTCTATTATTATTGAAT
ACTTTGATTATAATGATTTCAGCAACACAAAATTATCTTTACTCGATGAG
TTGAAAAAAAAGGGTAAATTTGTTCCACAGTCGGAAAATTCTACGACTTT
TTCGGATTCGAAAAATATCCAAGAAAGATTTTTTGATGCGTTTCACCGAG
GTGACAAGCGAGAATTTTTCGACTTATGGGATGCGAAATTATCGGCAAAA
TTGCGCAACGAGGATTCAGTCTGCCAGAAATTAGAATTTTTTTGCCAAAT
TTATTTCGCAATTTTTTCGATCAAACATAATTTTCAAGATAAAGATTCTG
AATCGATCGCGATGCAGGGATTCCGTGAATACCTTGAAACTAAAGGAAAC
AAAGTCAGTACCAATCCCGAATTCGTCCAATTCTATGCGTTGCCGTACGT
CTCGAATCCCCAGCAGCATCCGTCCTTCACTCAGCTGTTCCAGGACAATT
GGATTCCGGGAATAGAATTGCGCTTGAAACGATTTTTCCAGTTGATTTTT
GGCGAGCAAAATGAGCCGAAACTCGTCAATCTTTACAAATCTGGAAGCGA
CTACAAAAACGATGTCAGCATGAAAACGCTCCAGACTGAAATAGTTGAAT
CAAACCGACGAGCCAGTCAACTAATGAAACGCCTCAATCAAGTCCAACTT
GATTATCATAATCTATTGGGAATTACTGCTGAGCTCGTGGATTTGCTCGA
AGGAAGCTTCTACGGAAAATCCGTTAGTCCGAGTCATTTACAAAACATCT
GCCAAAGTCTTTTCGTTTCCCAACAGCACCGATTGAAATCAAACGGTATT
CCAATGAATACCAGCATCGACTTTTCCAGACCCGGGACAGCCTCTATGAT
GTTACGACAGTCTATACAATTAAACAACGGATCTGTTGCGAACAACCAGA
AAATATCCTTCGATCCTCCAGTTTTATCAAAGCCTGTGAAGACTAAACCA
CTAAATTTCAATAAAATCAAATTTGACCTCGAGCATGGAAACCTGCGATT
AAAGGTTTTGCTTTTTCAAGCTTTTCGATGGAGACTCACAAAATCGGATG
TCGAAAGCCGAGATAAATTCATTTCGGAAATCACTCAGCACGACCTGCTT
GGTCTTGAACCCGGTGAATATCACGACACGATATTTCAGATGCTCAACGC
AAAATATGGATCCCAAGAGCTCCAAGAATATTTGGCTAGGTTGATCAACG
CCATCGCGACATTGTGCAGAGGCCGCTCATATCTGGTGAAAAATAACCGA
ATCTGTGAATTGTTGTATTTGAATATTCTCGGCTTGACTCACGAGGAATC
TATTTTCAGGGAAAATTTAATTGGAGCTCTTCAGAAACTGAGTTTGAGAC
GACACATTCAGACATACATGATATCGAATGGAATGATAGAATGGTTAATG
ACCCTTTTGGAAGAGAATGGCTTCCTGACAGATTATACGCTGGACTATTC
GGTGGCACTTTTAATGAATTTGTGCTTGCGGACATCCGGGAAAAAGCGAT
GTATTGAACACAAAACTCAAATTATCAGAGTACTCAGTAAAATGTTGGAT
AGTTTTAATAAAGAAATTGCTTCTTACGTCAATGGAGCTCTTTATTCCAT
CCTGATTATACCGGAAATAAGACAAGAAGCTATTAATATGGATTTGGAAA
CCACACTGAAGAGTCATATGAAGCCAGAACACCAGGACATGAATCGGCAA
TTAGAGTATATAATTGGTCAGCTTAAATCAACTGACGAACCGAAAATTGA
GGAATCTGATGATGAAGAAGAGGAAGATGATGATGAGGAAGATCCTGAAG
TGCTGGAGAGTGAATTAGATAAAGAGGAATCATGTATTGCAGTCCCGAAT
GAATTGTGTGGAGAAGAGCTATTGAATACCAATTATTCTTTGCAGTCTGC
TCATTCCAGGGATGCAAATTCATCAAATCCTACAATTAGTCGACCTGTTA
CTCCTGGAACCTTTCTCGGTAAACGCAACCCGACTCCAAGTGATATTCAG
AATGTTAGGCCACCGACGAGAAGTGGTTCAAATATTGATCCGCAAACCGC
TGTAGAAAACAAAGTTCTAGTTGTGAAACCTGATTTGATGAGAGATAATC
CCCAATATCAAAAGGCTTTTTCTTCGAAACCCAAAATTCCCAGAACGCCA
GATGAAGAAAACTTAAAAAGAAACAGTATTCAAAGCTTAACTGGGCCAAT
TCAATCTTCTGGACGCATGCCAACTACCAGTGCTAATGGCAACAGGAAAG
GCAAAGAGTCCATGTCAACTACTAAGTGATATATTGTGCATTGAGATCTG
TGAATCAATACATTTGTATTTGTCATTATTTGTATGGTTCATAAATATCG
ATTTTGCACTCCACCAATCGTTATGTAATATTGATTTACAAAAGTATTCG
AATTACCAAACTCTT
back to top

protein sequence of SMED30024984-orf-1

>SMED30024984-orf-1 ID=SMED30024984-orf-1|Name=SMED30024984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=779bp
MTGEINTNFETDINSIIIEYFDYNDFSNTKLSLLDELKKKGKFVPQSENS
TTFSDSKNIQERFFDAFHRGDKREFFDLWDAKLSAKLRNEDSVCQKLEFF
CQIYFAIFSIKHNFQDKDSESIAMQGFREYLETKGNKVSTNPEFVQFYAL
PYVSNPQQHPSFTQLFQDNWIPGIELRLKRFFQLIFGEQNEPKLVNLYKS
GSDYKNDVSMKTLQTEIVESNRRASQLMKRLNQVQLDYHNLLGITAELVD
LLEGSFYGKSVSPSHLQNICQSLFVSQQHRLKSNGIPMNTSIDFSRPGTA
SMMLRQSIQLNNGSVANNQKISFDPPVLSKPVKTKPLNFNKIKFDLEHGN
LRLKVLLFQAFRWRLTKSDVESRDKFISEITQHDLLGLEPGEYHDTIFQM
LNAKYGSQELQEYLARLINAIATLCRGRSYLVKNNRICELLYLNILGLTH
EESIFRENLIGALQKLSLRRHIQTYMISNGMIEWLMTLLEENGFLTDYTL
DYSVALLMNLCLRTSGKKRCIEHKTQIIRVLSKMLDSFNKEIASYVNGAL
YSILIIPEIRQEAINMDLETTLKSHMKPEHQDMNRQLEYIIGQLKSTDEP
KIEESDDEEEEDDDEEDPEVLESELDKEESCIAVPNELCGEELLNTNYSL
QSAHSRDANSSNPTISRPVTPGTFLGKRNPTPSDIQNVRPPTRSGSNIDP
QTAVENKVLVVKPDLMRDNPQYQKAFSSKPKIPRTPDEENLKRNSIQSLT
GPIQSSGRMPTTSANGNRKGKESMSTTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0036064ciliary basal body
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040369ARMC9
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 210..237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 602..624
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 654..669
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 742..778
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 594..628
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 719..778
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 654..684
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 387..609
e-value: 8.8E-9
score: 36.5
IPR040369LisH domain-containing protein ARMC9PANTHERPTHR14881FAMILY NOT NAMEDcoord: 10..678
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 395..601