SMED30024979

Overview
NameSMED30024979
Smed IDSMED30024979
Length (bp)2435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024979 (SMED30024979) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024979 (SMED30024979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024979 (SMED30024979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024979 (SMED30024979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30024979SMESG000005613.1 dd_Smed_v4_1548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024979SMESG000005613.1 dd_Smed_v4_709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30024979SMESG000005613.1 dd_Smed_v4_1548_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024979SMESG000005613.1 dd_Smed_v6_709_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024979SMESG000005613.1 dd_Smed_v6_1548_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_1548_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_1548_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_1548_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30024979SMESG000005613.1 dd_Smed_v4_1548_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_709_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_709_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_709_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30024979SMESG000005613.1 dd_Smed_v4_709_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30024979SMESG000005613.1 dd_Smed_v4_709_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30024979 vs. Planmine SMEST
Match: SMESG000005613.1 (SMESG000005613.1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 484/798 (60.65%), Postives = 568/798 (71.18%), Query Frame = 3
Query:    9 KVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLA---LLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSM--AFS-VTDDAKLIEELQTRIEELLKEIQQLRNEKLE-------------SEVTTTDQTEILLK---EFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKF--NLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLERELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTLKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFEKIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHXXXXXXXXXXXXXXXFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKSTTENAVYQSSSLDVXXXXXXXXXXSENRN 2327
            K +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ LRNEK     LL +I++L+ E  ES     D  E     ++LK+F    +          +++  ++   F  +    + I  LQ     L+ EI QL+ E L              SE+   ++ +I L    E++  + +  V++ K     DG  NE                    +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ L+NE  +LL    +    L    + +  + +   +  ++ D  F      +I    +  E+        RELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSST KFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFE IKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVK TTENAVYQSSSLDVKRKRKRRHRKSENRN
Sbjct: 2524 KSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVTTTDQTE-----ILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRK-----DGDANEKL-----------------VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKD--FTTEDEIEIKEQIIKPEIAPQSMAFSRELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTSKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFENIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKPTTENAVYQSSSLDVKRKRKRRHRKSENRN 3291          

HSP 2 Score: 555.829 bits (1431), Expect = 1.605e-173
Identity = 332/339 (97.94%), Postives = 336/339 (99.12%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSL 1019
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +L
Sbjct: 1321 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKFTL 1659          

HSP 3 Score: 553.518 bits (1425), Expect = 1.010e-172
Identity = 340/382 (89.01%), Postives = 354/382 (92.67%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENS---SLLFQFHQY-NSRLLSKVQKFNLQSSQKEFIINDCLFPISCS 1136
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE +    LL +  Q  N +L S+V      + Q E ++ + + P   S
Sbjct: 2279 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVT----TTDQTEILLKEFMPPKQTS 2656          

HSP 4 Score: 532.717 bits (1371), Expect = 1.581e-165
Identity = 319/393 (81.17%), Postives = 342/393 (87.02%), Query Frame = 3
Query:  102 IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKID 1262
            IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTK LDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID
Sbjct: 1667 IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKNLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEID 2047          

HSP 5 Score: 521.161 bits (1341), Expect = 1.730e-161
Identity = 337/430 (78.37%), Postives = 359/430 (83.49%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST                   E+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:   66 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST-------------------ELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 464          

HSP 6 Score: 521.161 bits (1341), Expect = 1.730e-161
Identity = 337/430 (78.37%), Postives = 359/430 (83.49%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST                   E+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  380 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST-------------------ELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 778          

HSP 7 Score: 520.005 bits (1338), Expect = 3.827e-161
Identity = 333/430 (77.44%), Postives = 358/430 (83.26%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSE E                 IELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 1005 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSETE-----------------IELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1405          

HSP 8 Score: 505.368 bits (1300), Expect = 4.331e-156
Identity = 327/430 (76.05%), Postives = 353/430 (82.09%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKE+                       EMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  694 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKERT----------------------EMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1089          

HSP 9 Score: 498.819 bits (1283), Expect = 9.405e-154
Identity = 327/430 (76.05%), Postives = 353/430 (82.09%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTK LDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEM                      LEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 1967 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKNLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMK---------------------LEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2363          

HSP 10 Score: 208.764 bits (530), Expect = 1.996e-55
Identity = 154/157 (98.09%), Postives = 156/157 (99.36%), Query Frame = 3
Query:    3 NEK-VTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFS 470
            NEK VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFS
Sbjct: 2758 NEKLVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFS 2914          

HSP 11 Score: 147.902 bits (372), Expect = 7.083e-36
Identity = 89/162 (54.94%), Postives = 110/162 (67.90%), Query Frame = 3
Query:  807 MKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            MKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKE+EIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:    1 MKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKEIEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 150          

HSP 12 Score: 73.559 bits (179), Expect = 6.391e-13
Identity = 70/255 (27.45%), Postives = 131/255 (51.37%), Query Frame = 3
Query:  606 EFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSK----VQKFNLQSSQ--------------KEFIINDCLFPISCSRDIF-PIPLVNELQTHIDLLERELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVET 1310
            E++  + +  V++ K  D ++  L E+++EIE KN ++ +L++ K +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ L+NE  +LL    +    L       V  F   +                KE II   L P S +  +     L+ ELQT I+ L +E+ +L+++    +++  ++ +  +L+   + P    T
Sbjct:   25 EYLTKEMSECVIYRKDGDANEK-LVELYKEIEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTE--ILLKEFMPPKQTST 276          
BLAST of SMED30024979 vs. Planmine SMEST
Match: SMESG000005613.1 (SMESG000005613.1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 484/798 (60.65%), Postives = 568/798 (71.18%), Query Frame = 3
Query:    9 KVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLA---LLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSM--AFS-VTDDAKLIEELQTRIEELLKEIQQLRNEKLE-------------SEVTTTDQTEILLK---EFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKF--NLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLERELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTLKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFEKIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHXXXXXXXXXXXXXXXFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKSTTENAVYQSSSLDVXXXXXXXXXXSENRN 2327
            K +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ LRNEK     LL +I++L+ E  ES     D  E     ++LK+F    +          +++  ++   F  +    + I  LQ     L+ EI QL+ E L              SE+   ++ +I L    E++  + +  V++ K     DG  NE                    +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ L+NE  +LL    +    L    + +  + +   +  ++ D  F      +I    +  E+        RELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSST KFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFE IKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVK TTENAVYQSSSLDVKRKRKRRHRKSENRN
Sbjct: 5001 KSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVTTTDQTE-----ILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRK-----DGDANEKL-----------------VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKD--FTTEDEIEIKEQIIKPEIAPQSMAFSRELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTSKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFENIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKPTTENAVYQSSSLDVKRKRKRRHRKSENRN 5768          

HSP 2 Score: 572.392 bits (1474), Expect = 3.841e-179
Identity = 356/430 (82.79%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  949 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1366          

HSP 3 Score: 571.237 bits (1471), Expect = 8.268e-179
Identity = 355/430 (82.56%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  283 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 700          

HSP 4 Score: 571.237 bits (1471), Expect = 8.268e-179
Identity = 355/430 (82.56%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  616 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1033          

HSP 5 Score: 570.466 bits (1469), Expect = 1.512e-178
Identity = 355/430 (82.56%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 1282 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1699          

HSP 6 Score: 561.222 bits (1445), Expect = 2.351e-175
Identity = 334/340 (98.24%), Postives = 338/340 (99.41%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLL 1022
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL
Sbjct: 1930 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLL 2269          

HSP 7 Score: 555.829 bits (1431), Expect = 2.041e-173
Identity = 332/339 (97.94%), Postives = 336/339 (99.12%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSL 1019
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +L
Sbjct: 3798 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKFTL 4136          

HSP 8 Score: 553.518 bits (1425), Expect = 1.134e-172
Identity = 340/382 (89.01%), Postives = 354/382 (92.67%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENS---SLLFQFHQY-NSRLLSKVQKFNLQSSQKEFIINDCLFPISCS 1136
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE +    LL +  Q  N +L S+V      + Q E ++ + + P   S
Sbjct: 4756 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVT----TTDQTEILLKEFMPPKQTS 5133          

HSP 9 Score: 532.717 bits (1371), Expect = 1.909e-165
Identity = 319/393 (81.17%), Postives = 342/393 (87.02%), Query Frame = 3
Query:  102 IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKID 1262
            IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTK LDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID
Sbjct: 4144 IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKNLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEID 4524          

HSP 10 Score: 525.398 bits (1352), Expect = 5.945e-163
Identity = 339/430 (78.84%), Postives = 360/430 (83.72%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSD                  VLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 1615 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSD------------------VLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2014          

HSP 11 Score: 521.161 bits (1341), Expect = 2.107e-161
Identity = 337/430 (78.37%), Postives = 359/430 (83.49%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST                   E+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 2539 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST-------------------ELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2937          

HSP 12 Score: 521.161 bits (1341), Expect = 2.107e-161
Identity = 337/430 (78.37%), Postives = 359/430 (83.49%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST                   E+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 2853 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST-------------------ELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 3251          

HSP 13 Score: 520.005 bits (1338), Expect = 4.937e-161
Identity = 333/430 (77.44%), Postives = 358/430 (83.26%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSE E                 IELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 3482 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSETE-----------------IELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 3882          

HSP 14 Score: 519.62 bits (1337), Expect = 5.865e-161
Identity = 333/430 (77.44%), Postives = 358/430 (83.26%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSE                  KIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 3167 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSE------------------KIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 3566          

HSP 15 Score: 504.982 bits (1299), Expect = 6.206e-156
Identity = 303/379 (79.95%), Postives = 326/379 (86.02%), Query Frame = 3
Query:  156 MTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            MTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLN EYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:    1 MTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNAEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 367          

HSP 16 Score: 498.434 bits (1282), Expect = 1.213e-153
Identity = 327/430 (76.05%), Postives = 353/430 (82.09%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTK LDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEM                      LEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 4444 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKNLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMK---------------------LEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 4840          

HSP 17 Score: 450.284 bits (1157), Expect = 4.249e-137
Identity = 296/430 (68.84%), Postives = 320/430 (74.42%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYE             +ELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT+ S                                            EVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKE+EIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 2263 NEKVTLLENIDKLRREMHRKYE-------------NELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATEYS--------------------------------------------EVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKEIEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2623          

HSP 18 Score: 208.379 bits (529), Expect = 2.517e-55
Identity = 154/157 (98.09%), Postives = 156/157 (99.36%), Query Frame = 3
Query:    3 NEK-VTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFS 470
            NEK VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFS
Sbjct: 5235 NEKLVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFS 5391          
BLAST of SMED30024979 vs. Planmine SMEST
Match: SMESG000005613.1 (SMESG000005613.1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 484/798 (60.65%), Postives = 568/798 (71.18%), Query Frame = 3
Query:    9 KVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLA---LLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSM--AFS-VTDDAKLIEELQTRIEELLKEIQQLRNEKLE-------------SEVTTTDQTEILLK---EFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKF--NLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLERELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTLKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFEKIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHXXXXXXXXXXXXXXXFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKSTTENAVYQSSSLDVXXXXXXXXXXSENRN 2327
            K +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ LRNEK     LL +I++L+ E  ES     D  E     ++LK+F    +          +++  ++   F  +    + I  LQ     L+ EI QL+ E L              SE+   ++ +I L    E++  + +  V++ K     DG  NE                    +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ L+NE  +LL    +    L    + +  + +   +  ++ D  F      +I    +  E+        RELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSST KFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFE IKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVK TTENAVYQSSSLDVKRKRKRRHRKSENRN
Sbjct: 4997 KSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVTTTDQTE-----ILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRK-----DGDANEKL-----------------VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKD--FTTEDEIEIKEQIIKPEIAPQSMAFSRELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTSKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFENIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKPTTENAVYQSSSLDVKRKRKRRHRKSENRN 5764          

HSP 2 Score: 572.392 bits (1474), Expect = 3.696e-179
Identity = 356/430 (82.79%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  949 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1366          

HSP 3 Score: 571.622 bits (1472), Expect = 7.956e-179
Identity = 355/430 (82.56%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  283 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 700          

HSP 4 Score: 571.622 bits (1472), Expect = 7.956e-179
Identity = 355/430 (82.56%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:  616 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1033          

HSP 5 Score: 570.852 bits (1470), Expect = 1.469e-178
Identity = 355/430 (82.56%), Postives = 378/430 (87.91%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 1282 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 1699          

HSP 6 Score: 561.607 bits (1446), Expect = 2.241e-175
Identity = 334/340 (98.24%), Postives = 338/340 (99.41%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLL 1022
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL
Sbjct: 1930 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLL 2269          

HSP 7 Score: 555.829 bits (1431), Expect = 1.946e-173
Identity = 332/339 (97.94%), Postives = 336/339 (99.12%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSL 1019
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +L
Sbjct: 3794 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKFTL 4132          

HSP 8 Score: 553.518 bits (1425), Expect = 1.091e-172
Identity = 340/382 (89.01%), Postives = 354/382 (92.67%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENS---SLLFQFHQY-NSRLLSKVQKFNLQSSQKEFIINDCLFPISCS 1136
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE +    LL +  Q  N +L S+V      + Q E ++ + + P   S
Sbjct: 4752 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVT----TTDQTEILLKEFMPPKQTS 5129          

HSP 9 Score: 532.717 bits (1371), Expect = 1.855e-165
Identity = 319/393 (81.17%), Postives = 342/393 (87.02%), Query Frame = 3
Query:  102 IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKID 1262
            IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTK LDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID
Sbjct: 4140 IISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKNLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEID 4520          

HSP 10 Score: 525.398 bits (1352), Expect = 5.831e-163
Identity = 339/430 (78.84%), Postives = 360/430 (83.72%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSD                  VLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 1615 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSD------------------VLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2014          

HSP 11 Score: 521.161 bits (1341), Expect = 2.048e-161
Identity = 337/430 (78.37%), Postives = 359/430 (83.49%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST                   E+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 2539 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST-------------------ELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2937          

HSP 12 Score: 521.161 bits (1341), Expect = 2.048e-161
Identity = 337/430 (78.37%), Postives = 359/430 (83.49%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST                   E+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 2853 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTST-------------------ELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 3251          

HSP 13 Score: 520.005 bits (1338), Expect = 4.751e-161
Identity = 333/430 (77.44%), Postives = 358/430 (83.26%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSE E                 IELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 3478 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSETE-----------------IELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 3878          

HSP 14 Score: 505.368 bits (1300), Expect = 5.325e-156
Identity = 327/430 (76.05%), Postives = 353/430 (82.09%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKE+                       EMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 3167 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKERT----------------------EMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 3562          

HSP 15 Score: 505.368 bits (1300), Expect = 5.973e-156
Identity = 303/379 (79.95%), Postives = 326/379 (86.02%), Query Frame = 3
Query:  156 MTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            MTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLN EYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct:    1 MTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNAEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 367          

HSP 16 Score: 498.434 bits (1282), Expect = 1.190e-153
Identity = 327/430 (76.05%), Postives = 353/430 (82.09%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTK LDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFE+MTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFSVTDDA LIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEM                      LEIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 4440 NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKNLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEKMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSVTDDANLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMK---------------------LEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 4836          

HSP 17 Score: 450.284 bits (1157), Expect = 4.169e-137
Identity = 296/430 (68.84%), Postives = 320/430 (74.42%), Query Frame = 3
Query:    3 NEKVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLER------ELLELQSKYFNLKISLQEKIDDNVL 1274
            NEKVTLLENIDKLRREMHRKYE             +ELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT+ S                                            EVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKE+EIKNHDLMLL+NE  +LL    +    +  K +KF L+  +KE II++ L  I  S           L+++ID + R      E+ + +S + N  + L ++ID   L
Sbjct: 2263 NEKVTLLENIDKLRREMHRKYE-------------NELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATEYS--------------------------------------------EVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKEIEIKNHDLMLLRNEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISE-LHSIQVS-----------LESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTL 2623          

HSP 18 Score: 208.379 bits (529), Expect = 2.494e-55
Identity = 154/157 (98.09%), Postives = 156/157 (99.36%), Query Frame = 3
Query:    3 NEK-VTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFS 470
            NEK VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFS
Sbjct: 5231 NEKLVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFS 5387          
BLAST of SMED30024979 vs. Planmine SMEST
Match: SMESG000005613.1 (SMESG000005613.1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 484/798 (60.65%), Postives = 568/798 (71.18%), Query Frame = 3
Query:    9 KVTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLA---LLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSM--AFS-VTDDAKLIEELQTRIEELLKEIQQLRNEKLE-------------SEVTTTDQTEILLK---EFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRLLSKVQKF--NLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLERELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTLKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFEKIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHXXXXXXXXXXXXXXXFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKSTTENAVYQSSSLDVXXXXXXXXXXSENRN 2327
            K +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ LRNEK     LL +I++L+ E  ES     D  E     ++LK+F    +          +++  ++   F  +    + I  LQ     L+ EI QL+ E L              SE+   ++ +I L    E++  + +  V++ K     DG  NE                    +L+  ID+L+RE+  K  +  +KLKEK + I EL   ++ L  N++ +T+ + E   I  ++ D   KLVEL+KE++ K  D++ L+NE  +LL    +    L    + +  + +   +  ++ D  F      +I    +  E+        RELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSST KFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFE IKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVK TTENAVYQSSSLDVKRKRKRRHRKSENRN
Sbjct:  230 KSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECV-IYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVTTTDQTE-----ILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRK-----DGDANEKL-----------------VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKD--FTTEDEIEIKEQIIKPEIAPQSMAFSRELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEISSKLSSTSKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFENIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLISESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIHVEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKPTTENAVYQSSSLDVKRKRKRRHRKSENRN 997          

HSP 2 Score: 520.776 bits (1340), Expect = 3.016e-171
Identity = 324/366 (88.52%), Postives = 338/366 (92.35%), Query Frame = 3
Query:   51 MHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENS---SLLFQFHQY-NSRLLSKVQKFNLQSSQKEFIINDCLFPISCS 1136
            MHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKAT++SDGTL EIFQE+EGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLL+NE +    LL +  Q  N +L S+V      + Q E ++ + + P   S
Sbjct:    1 MHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAPQSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATELSDGTLIEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLRNEKTRIEELLKEIQQLRNEKLESEVTT----TDQTEILLKEFMPPKQTS 362          

HSP 3 Score: 207.994 bits (528), Expect = 1.053e-55
Identity = 154/157 (98.09%), Postives = 156/157 (99.36%), Query Frame = 3
Query:    3 NEK-VTLLENIDKLRREMHRXXXXXXXXXXXXXXIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIXXXXXXXXXXXXXYVDSFEQMTRTVVLKDFTTXXXXXXXXXXXXXXLAPQSMAFS 470
            NEK VTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQ+ELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPE+APQSMAFS
Sbjct:  464 NEKLVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTDIERLQDELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFS 620          
BLAST of SMED30024979 vs. Planmine SMEST
Match: SMESG000005612.1 (SMESG000005612.1)

HSP 1 Score: 117.472 bits (293), Expect = 1.103e-26
Identity = 146/500 (29.20%), Postives = 250/500 (50.00%), Query Frame = 3
Query:  519 ELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYN-----------SRLLSKVQKFNLQSSQKEFII---NDC--------------------LFPI-SCSRDIFPIPL---------VNELQTHIDLLERELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCD----------SNEISSKLSSTLKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFHQLLQDQDIINSKYEEIWE-----ASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFEKIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQ 1841
            ELL+EI++L+ +    +V  +++   LL+E    K + +   EK +      L+EI +E++ KN ++ VLQD K   +  IDQLK+E+ ++D          N ++IEL + K +L   +E L K   E  +Y ++     +  EL+K+LE KN +L+ +++EN  L  + +  N             L  K+ + N Q+   EF I   + C                      PI S  ++I   P            E+Q+HI  LE ELL LQ KY++LK S      D++  SH  +P++V  + S + S             S+  + +  S    L+SIEKLN+EI+EQR KNQ+L+ S  +S   K+ L+  ++QL+++ + + +KY+ + E      +   I +++     L E+L K +EEN  L  +L+  +E L++++   + I+    +E  +W   LK  +++    E+KIKELLNQ+  L R++Q
Sbjct:  463 ELLREIERLKQD-YSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS-----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSA-------NEKVIELSQTK-QLETKLEDLKKSNGEKEVYFQNSKPMVEFEELFKKLEKKNEELVRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQN---EFCIEWKDKCENLEKTLQESLNSNRQHLEMTVPIESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSA--ITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIEAETISDNKADQSHSASNLLNSIEKLNIEISEQRLKNQDLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEEL-RSKQ 942          
The following BLAST results are available for this feature:
BLAST of SMED30024979 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024979 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005613.11.605e-17360.65SMESG000005613.1[more]
SMESG000005613.13.841e-17960.65SMESG000005613.1[more]
SMESG000005613.13.696e-17960.65SMESG000005613.1[more]
SMESG000005613.13.016e-17160.65SMESG000005613.1[more]
SMESG000005612.11.103e-2629.20SMESG000005612.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024979 ID=SMED30024979|Name=SMED30024979|organism=Schmidtea mediterranea sexual|type=transcript|length=2435bp
GAAATGAAAAGGTTACACTATTGGAGAATATCGATAAATTGCGAAGAGAA
ATGCATCGGAAATACGAAAAGTTCACTTTGAAATTAAAAGAGAAAGAAAC
AATTATCAGTGAATTGCATTCAATACAAGTATCCTTGGAATCAAACATTG
ATCAAATGACTCGAAGAGTGAAAGAAACTACAGAAATATCTGATCAAGAA
AGTGATTTTGGTAACAAATTAGTGGAGTTACACAAAGAGATCGACACAAA
GACTCTTGATATCATCACGCTCAGAAATGAGAAACTGGCTCTGCTGACGG
ATATTGAAAGATTACAAGAGGAATTACGAGAAAGTCGAGAACTGTACGTT
GATTCCTTCGAACAAATGACGAGAACAGTCGTTTTGAAAGACTTCACTAC
TGAAGACGAAATTGAAATTAAAGAACAAATCATCAAACCAGAACTAGCTC
CACAATCGATGGCGTTCAGTGTGACAGATGATGCGAAACTCATTGAGGAA
TTGCAGACGAGAATCGAAGAACTTTTGAAAGAGATTCAACAACTGCGCAA
TGAGAAACTTGAATCTGAAGTCACTACGACAGATCAAACGGAAATCCTTT
TGAAAGAATTCATGCCTCCAAAACAGACTTCGACTGTAGTCCACGAAAAA
GCAACAGATGTATCTGATGGTACTCTGAATGAAATATTCCAGGAAATAGA
AGGAAAGAATCGTGAAATTTCAGTGCTTCAAGATCACAAATCATCTCTGA
TACATGAAATTGATCAACTTAAACGAGAACTTTTAAACAAAGATTCAGAA
GTAGAAATGAAATTAAAAGAAAAGAACAGTGAGATTATTGAATTGGAAAG
ACAGAAAATCGAGTTGGGACTAAATGTCGAATATTTGACTAAGGAAATGA
GTGAATGTGTCATTTACCGAAAAGATGGAGACGCAAATGAGAAACTTGTT
GAGTTGTATAAAGAACTAGAGATTAAAAATCACGATCTGATGTTGTTGAA
AAATGAAAATTCCTCTCTTTTATTTCAATTTCATCAATATAATTCTCGTT
TGCTTTCAAAGGTACAGAAATTTAATCTCCAATCTTCGCAAAAAGAATTT
ATTATCAATGATTGTCTTTTTCCAATTTCTTGCTCTCGAGATATTTTTCC
TATTCCTTTGGTTAATGAACTTCAAACTCATATTGATTTATTGGAGCGCG
AGCTTTTGGAACTTCAATCAAAATATTTTAATTTGAAAATATCCCTTCAA
GAAAAAATTGACGATAATGTACTCGTTAGTCATGAACTTACTCCTAGTTC
AGTCGAAACTTTTGCGTCTCATTTGAAGTCCTTTTGTGACAGTAATGAAA
TATCTTCTAAACTTTCTTCGACTTTGAAATTTTTAGATTCGATTGAGAAA
CTAAATGTCGAAATAGCCGAACAACGAAATAAAAATCAAGAATTACGAAC
ATCAATTCAACAGTCGCTTTTGTCGAAGTCGCCACTCCAAGGCACATTTC
ATCAACTGTTACAAGACCAAGACATAATTAATTCGAAATATGAAGAAATA
TGGGAGGCATCCAAGTGTACCATTTCTGAACATGACTATGAAAATTCTCG
ATTGCGAGAAGAATTAACGAAGTTTAAAGAAGAAAATGAAAAATTAAGTA
ACCGTTTAAATATTTCTCAAGAAGTACTTAAACAAAGTGATATACATTTT
GAAAAGATCAAAGAATGTTATCTCAAGGAAAATGAAAGTTGGGATAGACG
CCTTAAAATATTACAAGAACAAGGAATTATAAATGAAGATAAAATAAAAG
AACTTTTAAACCAACTTAGTGTTTTGGAGAGAAACAGACAAAATTTGAAA
TCCGAAGAAACCGTCGATCAAATAATTTGTGGTCAAATTGTAGAAACTTC
TAATGATTACGAGAAGGAAAATGAAAAAGATAAACATGAATCGTTGATTT
CCGAGTCTATTGAAACTGAAAATGAAATTTCATTCAAACAAAATCTACAA
AAATGCCTATTAGAAAATAAAAATTTGAAAGCACAGTTAAAGGCTTTCCG
AGAGGTTCTAGAAGAAACTGATATTCGTTTTTCAAAGATTCAACAAATCC
ATGTTGAAGAAGAGTCAAATTGGAAATACAAAATACAATCTTTAATTGAA
AAAGATAAAGAACATAAAGACAAGTTTAATTGTCTTATGAATAAATTGGA
CACTTTGGAACGAGAAAAAGCCGAAACATTAGTGAAGTCTACGACCGAAA
ATGCCGTTTACCAGTCCTCATCACTGGACGTTAAGAGAAAGAGGAAACGC
AGACATCGTAAAAGCGAAAATAGAAATTAGGCAGACTTTAGAGAATATCA
AATTTTATAAAAACGATCGTTATTTCATTTTGACATGAAATTTACAATAT
TATTTAAGTGATATTATCGAATAAATTTTTTTCAT
back to top

protein sequence of SMED30024979-orf-1

>SMED30024979-orf-1 ID=SMED30024979-orf-1|Name=SMED30024979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=776bp
NEKVTLLENIDKLRREMHRKYEKFTLKLKEKETIISELHSIQVSLESNID
QMTRRVKETTEISDQESDFGNKLVELHKEIDTKTLDIITLRNEKLALLTD
IERLQEELRESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPELAP
QSMAFSVTDDAKLIEELQTRIEELLKEIQQLRNEKLESEVTTTDQTEILL
KEFMPPKQTSTVVHEKATDVSDGTLNEIFQEIEGKNREISVLQDHKSSLI
HEIDQLKRELLNKDSEVEMKLKEKNSEIIELERQKIELGLNVEYLTKEMS
ECVIYRKDGDANEKLVELYKELEIKNHDLMLLKNENSSLLFQFHQYNSRL
LSKVQKFNLQSSQKEFIINDCLFPISCSRDIFPIPLVNELQTHIDLLERE
LLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCDSNEI
SSKLSSTLKFLDSIEKLNVEIAEQRNKNQELRTSIQQSLLSKSPLQGTFH
QLLQDQDIINSKYEEIWEASKCTISEHDYENSRLREELTKFKEENEKLSN
RLNISQEVLKQSDIHFEKIKECYLKENESWDRRLKILQEQGIINEDKIKE
LLNQLSVLERNRQNLKSEETVDQIICGQIVETSNDYEKENEKDKHESLIS
ESIETENEISFKQNLQKCLLENKNLKAQLKAFREVLEETDIRFSKIQQIH
VEEESNWKYKIQSLIEKDKEHKDKFNCLMNKLDTLEREKAETLVKSTTEN
AVYQSSSLDVKRKRKRRHRKSENRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:00324402-alkenal reductase [NAD(P)] activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 17..37