VAMP (vesicle-associated membrane protein)-associated protein A, like

Overview
NameVAMP (vesicle-associated membrane protein)-associated protein A, like
Smed IDSMED30024958
Length (bp)920
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of VAMP (vesicle-associated membrane protein)-associated protein A, like (SMED30024958) t-SNE clustered cells

Violin plots show distribution of expression levels for VAMP (vesicle-associated membrane protein)-associated protein A, like (SMED30024958) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of VAMP (vesicle-associated membrane protein)-associated protein A, like (SMED30024958) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for VAMP (vesicle-associated membrane protein)-associated protein A, like (SMED30024958) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024958

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024958SMESG000079557.1 SMESG000074066.1 Contig5553GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30024958SMESG000079557.1 SMESG000074066.1 Contig5553GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024958SMESG000079557.1 SMESG000074066.1 Contig5553GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30024958SMESG000062111.1 Contig5553GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30024958SMESG000062111.1 Contig5553GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024958SMESG000062111.1 Contig5553GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30024958SMESG000062111.1 dd_Smed_v4_1433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024958SMESG000062111.1 dd_Smed_v4_1433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Human
Match: VAPA (VAMP associated protein A [Source:HGNC Symbol;Acc:HGNC:12648])

HSP 1 Score: 190.274 bits (482), Expect = 8.451e-59
Identity = 100/249 (40.16%), Postives = 144/249 (57.83%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +  K EQ L++ P  +LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +N++           + DG                      ++L+ E+  L  EN+ L+   +RLR++A  +K  + S+ S   NV     +   +IAA+        +G  LGKF+
Sbjct:    7 AMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAI-------FIGFFLGKFI 248          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Human
Match: VAPB (VAMP associated protein B and C [Source:HGNC Symbol;Acc:HGNC:12649])

HSP 1 Score: 179.874 bits (455), Expect = 7.106e-55
Identity = 98/247 (39.68%), Postives = 146/247 (59.11%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSG-----DINEVVEKSNFYTLTE------------------ENDGEKLKSEIEGLILENQKLKTNE-VRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKF 760
            K EQ L + P +ELKF GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS+  P    ++E VWK A+  D+MD KLRC FE+P ++      +IN+++  +   T T                     + ++L+ E++ L  EN++ K  + +R+R+         + S S +  +    + +      L L +  F++G+I+GK 
Sbjct:    3 KVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRK--------TVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKI 241          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Human
Match: VAPA (VAMP associated protein A [Source:HGNC Symbol;Acc:HGNC:12648])

HSP 1 Score: 170.244 bits (430), Expect = 1.675e-50
Identity = 77/146 (52.74%), Postives = 103/146 (70.55%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLT 520
            +  K EQ L++ P  +LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +  +    N  T+T
Sbjct:    7 AMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLG-ITPPGNAPTVT 151          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Human
Match: VAPB (VAMP associated protein B and C [Source:HGNC Symbol;Acc:HGNC:12649])

HSP 1 Score: 88.5817 bits (218), Expect = 6.622e-22
Identity = 41/68 (60.29%), Postives = 54/68 (79.41%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIA 295
            K EQ L + P +ELKF GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++
Sbjct:    3 KVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVS 70          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Human
Match: VAPB (VAMP associated protein B and C [Source:HGNC Symbol;Acc:HGNC:12649])

HSP 1 Score: 87.8113 bits (216), Expect = 2.638e-21
Identity = 41/68 (60.29%), Postives = 54/68 (79.41%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIA 295
            K EQ L + P +ELKF GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++
Sbjct:    3 KVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVS 70          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Celegans
Match: vpr-1 (Major sperm protein [Source:UniProtKB/TrEMBL;Acc:O44782])

HSP 1 Score: 128.642 bits (322), Expect = 1.874e-35
Identity = 92/247 (37.25%), Postives = 128/247 (51.82%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILP-ETYDNLEQVWKNAQQSDIMDFKLRCAF--EIPEQSGD---------------INEVVEKSNFYTLTEENDGE--KLKSEIEGLILENQKLKTNEVRLRQ--IAMQEKNVAL-SSQSDVINVKIGNQT-QWFIIAALILGLTMFLLGIILGKF 760
            +K   L ++PN EL F GPF+ VVTSH+ L N + + VCFKVKTTAPKQYCVRPNSG ++   +  I VMLQP +  P +  +HKFMVQS + P E   +LE VWK    +++   KL   F  +    SGD                 +  E  + Y+ T  +DG    L+  ++  + E ++L+     L Q    M +KN  L  S SD   V     T Q F+IA   L     L+G+I+G+ 
Sbjct:    3 EKHSLLQVTPNRELVFTGPFSDVVTSHMTLKNTSTNPVCFKVKTTAPKQYCVRPNSGLLKSGDSKQITVMLQPLEGIPSDAGRHKFMVQSCVAPSEDLPDLESVWKIIDPAELTYSKLMVTFVDKRDPASGDDTKTFAVRNEDSFASSGQAQELGSSYSGTPSHDGTVNSLRKSLKSTVDEKEELQKKVHGLEQEIEVMLKKNRKLQQSHSDGALVDGAYPTLQIFLIAVAAL-----LIGLIVGRL 244          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Celegans
Match: F42G2.5 (Major sperm protein [Source:UniProtKB/TrEMBL;Acc:O17099])

HSP 1 Score: 99.3673 bits (246), Expect = 1.571e-23
Identity = 49/110 (44.55%), Postives = 66/110 (60.00%), Query Frame = 2
Query:  128 ELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPET-YDNLEQVWKNAQQSDIMDFKLRCAF 454
            EL F GPF  V+T+++ LTN + S VCF VKTT P  YCVRPN G +    +  I VMLQP +  P +  +HKF+VQS + P     +LE VWKN +  ++   +L   F
Sbjct:   13 ELVFSGPFDHVITTYMTLTNISQSPVCFLVKTTVPNSYCVRPNRGILNIGDSKQIEVMLQPLEKVPPDAKQHKFLVQSCVAPSIDVSDLESVWKNVKPDELTYNRLVVTF 122          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Fly
Match: Vap33 (gene:FBgn0029687 transcript:FBtr0070617)

HSP 1 Score: 126.716 bits (317), Expect = 8.204e-35
Identity = 61/130 (46.92%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYD--NLEQVWKNAQQSDIMDFKLRCAFEIP 463
            MS+   +  L I P +EL+F GPFT+ V + + L N +   + FK+KTTAPK+YCVRPN G I P ++  + + LQPF YD +EK+KHKFMVQS++ P   D  +L ++WK+ +   +MD KL+C FE+P
Sbjct:    1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMP 130          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Fly
Match: Vap33 (gene:FBgn0029687 transcript:FBtr0342739)

HSP 1 Score: 127.102 bits (318), Expect = 1.407e-34
Identity = 61/130 (46.92%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYD--NLEQVWKNAQQSDIMDFKLRCAFEIP 463
            MS+   +  L I P +EL+F GPFT+ V + + L N +   + FK+KTTAPK+YCVRPN G I P ++  + + LQPF YD +EK+KHKFMVQS++ P   D  +L ++WK+ +   +MD KL+C FE+P
Sbjct:    1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMP 130          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Fly
Match: Vap33 (gene:FBgn0029687 transcript:FBtr0070618)

HSP 1 Score: 127.102 bits (318), Expect = 1.407e-34
Identity = 61/130 (46.92%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYD--NLEQVWKNAQQSDIMDFKLRCAFEIP 463
            MS+   +  L I P +EL+F GPFT+ V + + L N +   + FK+KTTAPK+YCVRPN G I P ++  + + LQPF YD +EK+KHKFMVQS++ P   D  +L ++WK+ +   +MD KL+C FE+P
Sbjct:    1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMP 130          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Fly
Match: Vap33 (gene:FBgn0029687 transcript:FBtr0070616)

HSP 1 Score: 127.102 bits (318), Expect = 1.407e-34
Identity = 61/130 (46.92%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYD--NLEQVWKNAQQSDIMDFKLRCAFEIP 463
            MS+   +  L I P +EL+F GPFT+ V + + L N +   + FK+KTTAPK+YCVRPN G I P ++  + + LQPF YD +EK+KHKFMVQS++ P   D  +L ++WK+ +   +MD KL+C FE+P
Sbjct:    1 MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTAPKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMDADLSDLNKLWKDLEPEQLMDAKLKCVFEMP 130          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Fly
Match: fan (gene:FBgn0028379 transcript:FBtr0076683)

HSP 1 Score: 74.7146 bits (182), Expect = 1.461e-15
Identity = 54/223 (24.22%), Postives = 115/223 (51.57%), Query Frame = 2
Query:   98 EQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNS-SVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVR-LRQIAM-QEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGK 757
            E  L + P + + F GPF + V+  L + N + +  + FK+KTT PK + VRPN G + P++   + + +QP     + K +HKF++ +  +     ++++ WK    ++  + K++C   +P +  D  +     +    T+  DGE        +  + Q++     + L+Q++M +++++AL+ Q D +  +   +T +F +AA+++ +   + G   GK
Sbjct:    6 ESKLALDPCDVIVFEGPFNRSVSRKLVIKNTSKTQRMAFKMKTTTPKLFYVRPNIGVLGPEQKVSVDIFMQPI-LQEQIKKRHKFLLLAAEVTGDISDVQEFWKMQNPNETRETKIKCEL-VPSKEDDFRQA--GGSAVISTDNKDGE--------VHFDAQEVSEPMAKLLKQVSMLEDEHMALTDQIDGLRDQAIGRT-FFYMAAIVIIILSAVAGAYYGK 215          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Zebrafish
Match: vapal (VAMP (vesicle-associated membrane protein)-associated protein A, like [Source:ZFIN;Acc:ZDB-GENE-040718-281])

HSP 1 Score: 193.741 bits (491), Expect = 1.920e-60
Identity = 100/248 (40.32%), Postives = 145/248 (58.47%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEEN------------------------DGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            K EQ L++ P N+LKF GPFT VVT++LKL NP+   VCFKVKTTAP++YCVRPNSG I+P     I+VMLQPF YDP EKSKHKFMVQ++  P    + E +WK+A+  ++MD KLRC FE+P ++  +NEV        L                            D ++L++E+  L  EN++LK   +RLR++  +  +V+ +S + V     G  +    + +L++ +    +G  LGKF+
Sbjct:    3 KLEQILVLDPPNDLKFKGPFTDVVTANLKLKNPSERKVCFKVKTTAPRRYCVRPNSGIIDPGATLTISVMLQPFDYDPNEKSKHKFMVQTIFAPPAVSDTEAMWKDAKPDELMDSKLRCVFELPSENDKVNEVDSACKVPVLNSSKADGLLSVKPLSGAHDDSEMRRILEDCKRLQTELSKLHDENRQLKDEGLRLRRLQPRTDHVSSNSSTSV-----GRDSVSGSLPSLLVVIAAIFIGFFLGKFI 245          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Zebrafish
Match: vapb (VAMP (vesicle-associated membrane protein)-associated protein B and C [Source:ZFIN;Acc:ZDB-GENE-030131-2348])

HSP 1 Score: 185.267 bits (469), Expect = 3.230e-57
Identity = 99/247 (40.08%), Postives = 152/247 (61.54%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYT---------------LTEENDGE---------KLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKF 760
            + EQ L++ P +EL+F GPFT VVT+ LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQSL+ P    + E VWK+A+  D+MD KLRC F++P ++   +E+  +SN  +                +  +DGE         +L++E++ L  EN++++  +  LR      K+  +S+    + V++  +     + ALI  +  F++G+I+GK 
Sbjct:    3 RPEQVLLLEPQHELRFRGPFTDVVTTTLKLANPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGTSINVSVMLQPFDYDPNEKSKHKFMVQSLLAPPDMTDTEGVWKDAKPEDLMDSKLRCVFDMPAENEKTHEM--ESNKISSLSKSESSTLSMKSMASSMDDGEVKKIMEECKRLQTEVQRLREENKQIRQEDDGLR----MRKSTVMSAPHSSLAVRVKEEGLSSRVIALI--VLFFVVGVIVGKL 241          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Zebrafish
Match: vapb (VAMP (vesicle-associated membrane protein)-associated protein B and C [Source:ZFIN;Acc:ZDB-GENE-030131-2348])

HSP 1 Score: 185.267 bits (469), Expect = 3.230e-57
Identity = 99/247 (40.08%), Postives = 152/247 (61.54%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYT---------------LTEENDGE---------KLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKF 760
            + EQ L++ P +EL+F GPFT VVT+ LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQSL+ P    + E VWK+A+  D+MD KLRC F++P ++   +E+  +SN  +                +  +DGE         +L++E++ L  EN++++  +  LR      K+  +S+    + V++  +     + ALI  +  F++G+I+GK 
Sbjct:    3 RPEQVLLLEPQHELRFRGPFTDVVTTTLKLANPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGTSINVSVMLQPFDYDPNEKSKHKFMVQSLLAPPDMTDTEGVWKDAKPEDLMDSKLRCVFDMPAENEKTHEM--ESNKISSLSKSESSTLSMKSMASSMDDGEVKKIMEECKRLQTEVQRLREENKQIRQEDDGLR----MRKSTVMSAPHSSLAVRVKEEGLSSRVIALI--VLFFVVGVIVGKL 241          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Zebrafish
Match: top1mt (DNA topoisomerase I mitochondrial [Source:ZFIN;Acc:ZDB-GENE-040624-2])

HSP 1 Score: 145.976 bits (367), Expect = 4.677e-43
Identity = 65/120 (54.17%), Postives = 86/120 (71.67%), Query Frame = 2
Query:   89 EKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRC 448
             K EQ LI+ P+N+L+F GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     I+VMLQPF YDP EKSKHKFMVQ++  P +  +LE +  +   +  +   + C
Sbjct:    2 SKLEQILILEPSNDLRFRGPFTDVVTTNLKLRNPSDRRVCFKVKTTAPRRYCVRPNSGIIDPGATVTISVMLQPFDYDPNEKSKHKFMVQTIFAPSSVSDLEAMVSSQTHTHSLSLVVLC 121          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Zebrafish
Match: mospd2 (motile sperm domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-041114-1])

HSP 1 Score: 61.6178 bits (148), Expect = 3.679e-10
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 2
Query:  113 ISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQ-PFKYDPKEKSKHKFMVQSLILPETYD----NLEQVWKNAQQSDIMDFKLRC 448
            ISP  EL F G         + L N T + V FKV+TTAP++Y V+P++ + EP  + DI V L   F+  P++    +F+V +  +  +      +L Q WK   +  IM+ +LRC
Sbjct:  336 ISPAEELSF-GASESEKKCLIVLNNVTKNHVAFKVRTTAPEKYRVKPSNSSCEPGASVDIVVSLHGGFQASPQD----RFLVMAAEMESSSGAAATDLAQFWKEVSKPKIMEHRLRC 447          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Xenopus
Match: oprl1 (opiate receptor-like 1 [Source:Xenbase;Acc:XB-GENE-5825353])

HSP 1 Score: 190.66 bits (483), Expect = 2.977e-59
Identity = 100/244 (40.98%), Postives = 140/244 (57.38%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG----------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            ++  K EQ LI+ P NELKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P T  ++E VWK A+  D+MD KLRC F++P +        E +  Y+      G                ++L+SE+  L  ENQ LK   +R+R+ + +   +               + Q   I +L++ +    +G  LGKF+
Sbjct:    8 VTMSKHEQILILDPPNELKFKGPFTDVVTTNLKLRNPSDKKVCFKVKTTAPRRYCVRPNSGTIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPTISDMEAVWKEAKPDDLMDSKLRCVFDMPHEQEKPTH--ESTKLYSCLPGTKGSSSMDDTETRKLMEECKRLQSEMIKLSDENQVLKEETLRMRKASDKSGKML--------------RDQGIPIPSLVVVIAAIFIGFFLGKFI 235          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Xenopus
Match: VAPB (VAMP associated protein B and C [Source:HGNC Symbol;Acc:HGNC:12649])

HSP 1 Score: 155.606 bits (392), Expect = 1.516e-46
Identity = 68/109 (62.39%), Postives = 87/109 (79.82%), Query Frame = 2
Query:  143 GPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQ 469
            GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS++ P    ++E VWK A+  D+MD KLRC FE+P +
Sbjct:   23 GPFTDVVTTNLKLGNPTDKNVCFKVKTTAPRRYCVRPNSGVIDAGSSINVSVMLQPFDYDPNEKSKHKFMVQSIMAPTDTSDMEAVWKEAKPDDLMDSKLRCVFELPSE 131          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Xenopus
Match: VAPB (VAMP associated protein B and C [Source:HGNC Symbol;Acc:HGNC:12649])

HSP 1 Score: 155.992 bits (393), Expect = 1.795e-46
Identity = 68/109 (62.39%), Postives = 87/109 (79.82%), Query Frame = 2
Query:  143 GPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQ 469
            GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS++ P    ++E VWK A+  D+MD KLRC FE+P +
Sbjct:   37 GPFTDVVTTNLKLGNPTDKNVCFKVKTTAPRRYCVRPNSGVIDAGSSINVSVMLQPFDYDPNEKSKHKFMVQSIMAPTDTSDMEAVWKEAKPDDLMDSKLRCVFELPSE 145          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Xenopus
Match: VAPB (VAMP associated protein B and C [Source:HGNC Symbol;Acc:HGNC:12649])

HSP 1 Score: 155.992 bits (393), Expect = 3.702e-46
Identity = 68/109 (62.39%), Postives = 87/109 (79.82%), Query Frame = 2
Query:  143 GPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQ 469
            GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS++ P    ++E VWK A+  D+MD KLRC FE+P +
Sbjct:   55 GPFTDVVTTNLKLGNPTDKNVCFKVKTTAPRRYCVRPNSGVIDAGSSINVSVMLQPFDYDPNEKSKHKFMVQSIMAPTDTSDMEAVWKEAKPDDLMDSKLRCVFELPSE 163          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Xenopus
Match: mospd2 (motile sperm domain containing 2 [Source:NCBI gene;Acc:493504])

HSP 1 Score: 60.077 bits (144), Expect = 1.359e-9
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  107 LIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPE--TYDNLEQVWKNAQQSDIMDFKLRC 448
            L ISP  EL F    +      + L N T ++V FKV+TTAP++Y V+P++ + EP    DI V L    +    + +   M   +  P   +   L Q WK   +S +M+ +LRC
Sbjct:  299 LHISPAEELHFGSKESGERKCVIVLNNVTKNTVAFKVRTTAPEKYRVKPSNSSCEPGSTVDIVVSLHA-AFVASLQDRFLVMAAEMEQPSGASTQELTQFWKEVPRSKVMEHRLRC 413          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Mouse
Match: Vapb (vesicle-associated membrane protein, associated protein B and C [Source:MGI Symbol;Acc:MGI:1928744])

HSP 1 Score: 188.348 bits (477), Expect = 2.421e-58
Identity = 103/243 (42.39%), Postives = 147/243 (60.49%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSG-----DINEVVEKSNFYT--------LTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEK-------NVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKF 760
            K EQ L + P +ELKF GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS+  P    ++E VWK A+  D+MD KLRC FE+P ++      +IN+++  S   T        LT   D     +E++ ++ E ++L+    RLR+ + Q K         A+ S S V  +    + +      L L +  F++G+I+GK 
Sbjct:    3 KVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDD----TEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSARLLALVVLFFIVGVIIGKI 241          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Mouse
Match: Vapa (vesicle-associated membrane protein, associated protein A [Source:MGI Symbol;Acc:MGI:1353561])

HSP 1 Score: 187.963 bits (476), Expect = 4.466e-58
Identity = 100/249 (40.16%), Postives = 145/249 (58.23%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +  K EQ L++ P ++LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +N++           + DG                      ++L+ E+  L  EN+ L+   +RLR++A  +K  + S+ S   NV     +   +IAA+        +G  LGKF+
Sbjct:    7 AMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAI-------FIGFFLGKFI 248          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Mouse
Match: Vapa (vesicle-associated membrane protein, associated protein A [Source:MGI Symbol;Acc:MGI:1353561])

HSP 1 Score: 107.842 bits (268), Expect = 2.111e-27
Identity = 45/80 (56.25%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  230 PKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQ 469
            P++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P +
Sbjct:    2 PRRYCVRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNE 81          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Mouse
Match: Mospd2 (motile sperm domain containing 2 [Source:MGI Symbol;Acc:MGI:1924013])

HSP 1 Score: 57.3806 bits (137), Expect = 9.139e-9
Identity = 45/165 (27.27%), Postives = 85/165 (51.52%), Query Frame = 2
Query:  107 LIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDN----LEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDGEKLKSEIEGLILENQKLK 589
            L ISP  EL F    +    + + LTN T + V FKV+TTAP++Y V+P++ + +P  + DI V            ++ +F++ +  + ++       L Q WK   ++ +M+ +LRC      +S   N ++ K +  T++++   E L  ++  L+  N+KL+
Sbjct:  328 LHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHG---GLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRCH---TVESSKPNSLMLKDSISTMSDKT-SEDLYLQLNRLLESNRKLE 485          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Mouse
Match: Mospd2 (motile sperm domain containing 2 [Source:MGI Symbol;Acc:MGI:1924013])

HSP 1 Score: 54.6842 bits (130), Expect = 6.687e-8
Identity = 35/118 (29.66%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  107 LIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDN----LEQVWKNAQQSDIMDFKLRC 448
            L ISP  EL F    +    + + LTN T + V FKV+TTAP++Y V+P++ + +P  + DI V            ++ +F++ +  + ++       L Q WK   ++ +M+ +LRC
Sbjct:  328 LHISPAEELYFGSIESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHG---GLTVSAQDRFLIMAAEMEQSSGTGPAELSQFWKEVPRNKVMEHRLRC 442          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. UniProt/SwissProt
Match: sp|Q5R601|VAPA_PONAB (Vesicle-associated membrane protein-associated protein A OS=Pongo abelii OX=9601 GN=VAPA PE=2 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 4.058e-58
Identity = 100/249 (40.16%), Postives = 144/249 (57.83%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +  K EQ L++ P  +LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +N++           + DG                      ++L+ E+  L  EN+ L+   +RLR++A  +K  + S+ S   NV     +   +IAA+        +G  LGKF+
Sbjct:    7 AMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAI-------FIGFFLGKFI 248          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. UniProt/SwissProt
Match: sp|Q9P0L0|VAPA_HUMAN (Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3)

HSP 1 Score: 190.274 bits (482), Expect = 4.058e-58
Identity = 100/249 (40.16%), Postives = 144/249 (57.83%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +  K EQ L++ P  +LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +N++           + DG                      ++L+ E+  L  EN+ L+   +RLR++A  +K  + S+ S   NV     +   +IAA+        +G  LGKF+
Sbjct:    7 AMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAI-------FIGFFLGKFI 248          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. UniProt/SwissProt
Match: sp|Q0VCY1|VAPA_BOVIN (Vesicle-associated membrane protein-associated protein A OS=Bos taurus OX=9913 GN=VAPA PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.061e-57
Identity = 102/249 (40.96%), Postives = 149/249 (59.84%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEV----------------VEKSNFYTLTEE------NDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +  K EQ L++ P  +LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +N++                V K +  +L++        + ++L+ E+  L  EN+ L+   +RLR++A  EK  + S+ S   NV     +   +IAA+        +G  LGKF+
Sbjct:    7 TMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGLTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNAAKQDGPVPKPHSVSLSDTETRKLVEECKRLQGEMMKLSEENRLLRDEGLRLRKVAHSEKPGSTSAVSFRENVTSPLPSLLVVIAAI-------FIGFFLGKFI 248          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. UniProt/SwissProt
Match: sp|Q9Z270|VAPA_RAT (Vesicle-associated membrane protein-associated protein A OS=Rattus norvegicus OX=10116 GN=Vapa PE=1 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 2.309e-57
Identity = 100/249 (40.16%), Postives = 145/249 (58.23%), Query Frame = 2
Query:   83 SQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +  K EQ L++ P ++LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     ++VMLQPF YDP EKSKHKFMVQ++  P    ++E VWK A+  ++MD KLRC FE+P ++  +N++           + DG                      ++L+ E+  L  EN+ L+   +RLR++A  +K  + S+ S   NV     +   +IAA+        +G  LGKF+
Sbjct:    7 AMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAI-------FIGFFLGKFI 248          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. UniProt/SwissProt
Match: sp|Q9Z269|VAPB_RAT (Vesicle-associated membrane protein-associated protein B OS=Rattus norvegicus OX=10116 GN=Vapb PE=1 SV=3)

HSP 1 Score: 187.963 bits (476), Expect = 2.525e-57
Identity = 103/243 (42.39%), Postives = 147/243 (60.49%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSG-----DINEVVEKSNFYT--------LTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEK-------NVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKF 760
            K EQ L + P +ELKF GPFT VVT++LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS+  P    ++E VWK A+  D+MD KLRC FE+P ++      +IN+++  S   T        LT   D     +E++ ++ E ++L+    RLR+ + Q K         AL S S +  +    + +      L L +  F++G+I+GK 
Sbjct:    3 KVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIMPTSASKTEAPVAAKPLTSPLD----DAEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRARKALPSNSPMAALAASGKEEGLSARLLALVVLFFIVGVIIGKI 241          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. TrEMBL
Match: A0A1A8JZR2 (VAMP (Vesicle-associated membrane protein)-associated protein B and C OS=Nothobranchius kuhntae OX=321403 GN=VAPB PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 4.679e-60
Identity = 103/229 (44.98%), Postives = 153/229 (66.81%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINE--VVEKSNFYTLTEENDGE--KLKSEIEGLILENQKLKTNEVRLRQ-IAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            ++EQ L++ P +ELKF GPFT VVT+ LKLTNPT+ +VCFKVKTTAP++YCVRPNSG IEP  + +++VMLQPF YDP EKSKHKFMVQS++ P    ++E VWK A+  ++MD KLRC+FE+P ++    E  V+ KS+  +L   +DGE  K+  E + L +E Q+L+    ++R+   ++++ V   + S    +   ++ +      L L L  F++G I+GK +
Sbjct:    3 RQEQVLVLEPQHELKFRGPFTDVVTATLKLTNPTDRNVCFKVKTTAPRRYCVRPNSGIIEPGTSINVSVMLQPFDYDPNEKSKHKFMVQSMLAPRDMTDMEGVWKEAKPEELMDSKLRCSFEMPLENDKTTEHSVLPKSSSASL---DDGEVKKIMEECKHLQMEVQRLREENKQIREDDGLRKRKVTPLAASHSSTMMTMSKDEGLSTRVLALCLLFFVIGAIIGKLV 228          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. TrEMBL
Match: A0A2C9K1J7 (MSP domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106077924 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 7.397e-59
Identity = 106/238 (44.54%), Postives = 148/238 (62.18%), Query Frame = 2
Query:   95 KEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPE-TYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGD-INEVV---EKSNFYTLTEENDGE----------KLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            +EQ LI+ P  EL+F GPFT VVT+ L LTNPT+  +CFKVKTTAPK+YCVRPNSG +EPKK+  +AVMLQPF+YDP EK+KHKFMVQS+  P+   DN E +W++A    +MD KL+C FE+P+     + E V   E S  Y +   N G+          K++ E++ +  EN +LK +  RLR++AM +   A  S     +    N  Q F    ++  +   LLG+++GKF+
Sbjct:    4 REQALILEPAGELRFRGPFTDVVTADLNLTNPTDKRICFKVKTTAPKRYCVRPNSGILEPKKSIVVAVMLQPFEYDPTEKNKHKFMVQSMFAPDHVVDNQEVLWRDAPPESLMDTKLKCVFEMPDAPQPFVAETVKHSEASAHYKMPSVNSGDEVKKLQLELKKVQQELQMVRSENNQLKEDGARLRKVAMADTVSATPSHPPPSST---NTVQAF--PPVVYIVVAILLGLLIGKFV 236          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. TrEMBL
Match: A0A5N5Q5M1 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00001820 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.615e-58
Identity = 105/250 (42.00%), Postives = 158/250 (63.20%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEV--------------------------VEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            K EQ LI+ P ++LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG+I+P  +  I+VMLQPF YDP EKSKHKFMVQ++  P    +LE VWK+A+  D+MD KLRC FE+P ++  +N+V                          ++ +    L EE   ++L+SE+  L  EN++LK   +R+R+ A + +NV +S+ + ++  + G+++    I +L++ +    +G  LGKF+
Sbjct:    3 KPEQVLILDPPSDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGSIDPGSSVIISVMLQPFDYDPNEKSKHKFMVQTIYAPPNITDLEAVWKDAKPEDLMDSKLRCVFELPSENDKMNDVDPTKAAPVLNSSKADSTSAAKPSSMALDDTEMRKLMEE--CKRLQSEVSKLGDENRQLKDEGLRMRK-AQRSENV-VSNTAAMVRKETGSKS----IPSLLVVIAAVFIGFFLGKFV 244          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. TrEMBL
Match: A0A5N5L0E9 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00121670 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 3.037e-58
Identity = 104/249 (41.77%), Postives = 150/249 (60.24%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEV--VEKSNFYTLTEENDG-----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            K EQ LI+ P  +LKF GPFT VVT++LKLTNP++  VCFKVKTTAP++YCVRPNSG I+P  +  I+VMLQPF YDP EKSKHKFMVQ++  P T  + E +WK+A+  ++MD KLRC FE+P ++  +N+V  V K+     + + +G                       ++L++EI  L  EN++LK + +RLR+    E   + SS        IG +     + +L++ +    +G  LGKF+
Sbjct:    3 KLEQVLILDPPTDLKFKGPFTDVVTANLKLTNPSDKRVCFKVKTTAPRRYCVRPNSGAIDPGASISISVMLQPFDYDPNEKSKHKFMVQTIFAPATITDTETMWKDAKPDELMDSKLRCVFELPSENDKMNDVDAVNKTAPVLASSKVEGPAAPKPASVALEDTEMKKVLEECKRLQTEISKLQEENRQLKDDGLRLRKAQRPEHTASNSSSL------IGREVATSSLPSLLVVIAAIFIGFFLGKFI 245          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. TrEMBL
Match: A0A1A8J119 (VAMP (Vesicle-associated membrane protein)-associated protein B and C OS=Nothobranchius kuhntae OX=321403 GN=VAPB PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 5.576e-58
Identity = 102/242 (42.15%), Postives = 154/242 (63.64%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINE---VVEKSNFYTLTEE------------NDGE--KLKSEIEGLILENQKLKTNEVRLRQ-IAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            ++EQ L++ P +ELKF GPFT VVT+ LKLTNPT+ +VCFKVKTTAP++YCVRPNSG IEP  + +++VMLQPF YDP EKSKHKFMVQS++ P    ++E VWK A+  ++MD KLRC+FE+P ++   +E   +   S+F ++  E            +DGE  K+  E + L +E Q+L+    ++R+   ++++ V   + S    +   ++ +      L L L  F++G I+GK +
Sbjct:    3 RQEQVLVLEPQHELKFRGPFTDVVTATLKLTNPTDRNVCFKVKTTAPRRYCVRPNSGIIEPGTSINVSVMLQPFDYDPNEKSKHKFMVQSMLAPRDMTDMEGVWKEAKPEELMDSKLRCSFEMPLENDKTHESESIKTVSSFTSVKTEHSVLPKSSSASLDDGEVKKIMEECKHLQMEVQRLREENKQIREDDGLRKRKVTPLAASHSSTMMTMSKDEGLSTRVLALCLLFFVIGAIIGKLV 244          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Cavefish
Match: vapb (VAMP associated protein B and C [Source:NCBI gene;Acc:103028744])

HSP 1 Score: 189.119 bits (479), Expect = 9.562e-59
Identity = 104/248 (41.94%), Postives = 153/248 (61.69%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIP---EQSGDINE---------------VVEKSNFYTLTEENDGE--KLKSEIEGLILENQKLKTNEVRLRQ----IAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            + EQ L++ P +ELKF GPFT VVT+ LKL NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQSLI P    ++E VWK A+  ++MD KLRC F++P   E++ DI+                +  KS   +L   +DGE  ++  E + L +E Q+L+    ++RQ    + M++  V  +  S   +V +  +     + ALI  +  F++G+I+GK +
Sbjct:    3 RPEQVLLLEPQHELKFRGPFTDVVTTTLKLANPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGTSINVSVMLQPFDYDPNEKSKHKFMVQSLIAPPDMTDMEGVWKEAKPEELMDSKLRCVFDMPIDNEKTHDIDSNKMMSSSLLKSESSTLSMKSMVSSL---DDGEVKRIMEECKRLQMEVQRLREENKQIRQEDDGLRMRKSTVMAAQHSSSSSVTVKEEGLSIRVIALI--VLFFVIGVIVGKLL 245          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Cavefish
Match: VAPA (VAMP associated protein A [Source:NCBI gene;Acc:103039029])

HSP 1 Score: 186.422 bits (472), Expect = 1.186e-57
Identity = 100/250 (40.00%), Postives = 151/250 (60.40%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEV--------------------------VEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            K EQ LI+ P ++LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+   +  I+VMLQPF YDP EKSKHKFMVQ++  P    +LE +WK+A+  D+MD KLRC FE+P ++  +N++                          ++ +    L EE   ++L+SE+  L  EN++LK   +R+R+    +++  ++S +  I  K   +T    + +L++ +    +G  LGKF+
Sbjct:    3 KLEQILILDPPSDLKFRGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGVIDSGASVTISVMLQPFDYDPNEKSKHKFMVQTIFAPPNAADLEAMWKDAKPEDLMDSKLRCVFELPSENDKMNDIDPTKAAPVLNTSKGDSTSGAKPSSLSLDDTEMRKLMEE--CKRLQSEMGKLADENRQLKDEGLRMRK---AQRSDNMTSNTSAIMRK---ETSSKSLPSLLVVIAAIFIGFFLGKFV 244          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Cavefish
Match: vapal (vesicle-associated membrane protein-associated protein A-like [Source:NCBI gene;Acc:103025147])

HSP 1 Score: 174.481 bits (441), Expect = 5.074e-53
Identity = 94/232 (40.52%), Postives = 140/232 (60.34%), Query Frame = 2
Query:  143 GPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEV--VEKSNFYTLTEENDG-----------------------EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            GPFT VVT++LKLTNP++  VCFKVKTTAP++YCVRPNSG I+P  +  I+VMLQPF YDP EKSKHKFMVQ++  P    + E +WK+A+  ++MD KLRC FE+P ++  +N+V  V K+     + + DG                       + L++E+  L  EN++LK + +RLR+ A +  ++A +S S      +G       + +L++ +    +G  LGKF+
Sbjct:   19 GPFTDVVTANLKLTNPSDKKVCFKVKTTAPRRYCVRPNSGAIDPGASIIISVMLQPFDYDPNEKSKHKFMVQTIFAPAAVADTESMWKDAKPDELMDSKLRCVFELPSENDKMNDVDAVSKAAPMLNSSKVDGPVAAKPTSAALDDTEMKKVFEECKWLQTEVGKLQEENRQLKDDGLRLRK-AQRPDHIASNSSS-----LMGRDVSTSSLPSLLVVIAAIFIGFFLGKFI 244          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Cavefish
Match: vapal (vesicle-associated membrane protein-associated protein A-like [Source:NCBI gene;Acc:103025147])

HSP 1 Score: 172.94 bits (437), Expect = 1.220e-51
Identity = 76/126 (60.32%), Postives = 97/126 (76.98%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQ 469
            K EQ LI+ P  +LKF GPFT VVT++LKLTNP++  VCFKVKTTAP++YCVRPNSG I+P  +  I+VMLQPF YDP EKSKHKFMVQ++  P    + E +WK+A+  ++MD KLRC FE+P +
Sbjct:    3 KLEQILILDPPADLKFRGPFTDVVTANLKLTNPSDKKVCFKVKTTAPRRYCVRPNSGAIDPGASIIISVMLQPFDYDPNEKSKHKFMVQTIFAPAAVADTESMWKDAKPDELMDSKLRCVFELPSE 128          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Cavefish
Match: vapal (vesicle-associated membrane protein-associated protein A-like [Source:NCBI gene;Acc:103025147])

HSP 1 Score: 157.532 bits (397), Expect = 1.054e-45
Identity = 67/109 (61.47%), Postives = 86/109 (78.90%), Query Frame = 2
Query:  143 GPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQ 469
            GPFT VVT++LKLTNP++  VCFKVKTTAP++YCVRPNSG I+P  +  I+VMLQPF YDP EKSKHKFMVQ++  P    + E +WK+A+  ++MD KLRC FE+P +
Sbjct:   19 GPFTDVVTANLKLTNPSDKKVCFKVKTTAPRRYCVRPNSGAIDPGASIIISVMLQPFDYDPNEKSKHKFMVQTIFAPAAVADTESMWKDAKPDELMDSKLRCVFELPSE 127          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Sea Lamprey
Match: vapb (VAMP (vesicle-associated membrane protein)-associated protein B and C [Source:ZFIN;Acc:ZDB-GENE-030131-2348])

HSP 1 Score: 119.013 bits (297), Expect = 3.378e-34
Identity = 52/86 (60.47%), Postives = 68/86 (79.07%), Query Frame = 2
Query:  143 GPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQV 400
            GPFT VVT++LKLTNP+   V FKVKTTAP++YCVRPNSG +E   + +++VMLQPF YDP EKSKHKFMVQ++  P+   +++ V
Sbjct:    2 GPFTDVVTTNLKLTNPSERRVVFKVKTTAPRRYCVRPNSGILEAGSSINVSVMLQPFDYDPNEKSKHKFMVQTMFAPQDTSDMDAV 87          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007085.1 (pep scaffold:Pmarinus_7.0:GL480831:649:8171:1 gene:ENSPMAG00000006399.1 transcript:ENSPMAT00000007085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 5.829e-10
Identity = 38/113 (33.63%), Postives = 62/113 (54.87%), Query Frame = 2
Query:  116 SPNNELKFYGPFTQVVTSHLK-LTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFM---VQSLILPETYDNLEQVWKNAQQSDIMDFKL 442
            SP  EL+F    +   T  L  LTN T + V FKVKTTAP++Y VRP++GN+EP  + D+ + L    Y+  +  K + +   V+  ++     +L   WKN  +  +++ +L
Sbjct:  152 SPAEELQFGSRESGGDTKCLMVLTNATQAPVAFKVKTTAPEKYRVRPSNGNLEPGASCDVQIALL-SSYEASQLDKFQVIAAEVKEEVVGAVPFDLSAFWKNVPRQSLVEHRL 263          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Yeast
Match: SCS2 (Integral ER membrane protein, regulates phospholipid metabolism; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PI4P levels by controlling access of Sac1p phosphatase to substrate PI4P in the PM; interacts with FFAT motifs in Opi1p, Swh1p, Osh2p, and Osh3p; involved in telomeric silencing; VAP homolog; SCS2 has a paralog, SCS22, that arose from the whole genome duplication [Source:SGD;Acc:S000000922])

HSP 1 Score: 61.6178 bits (148), Expect = 1.360e-11
Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  113 ISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKE--KSKHKFMVQSLILPETYD----NLEQVWKN 409
            ISP+  L +  P T+  T +  ++N ++ ++ FKVKTTAPK YCVRPN+  + P +   + V+      +P    K + KF+V  + LP  YD     +  VW +
Sbjct:    6 ISPDV-LVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLV--ITLPSPYDLNGKAVADVWSD 107          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Yeast
Match: SCS22 (Protein involved in regulation of phospholipid metabolism; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect the ER and plasma membrane (PM); regulates PM PI4P levels by controlling access of the Sac1p phosphatase to its substrate, PI4P; human VAP homolog; similar to D. melanogaster inturned protein; SWAT-GFP and mCherry fusion proteins localize to the cytosol; SCS22 has a paralog, SCS2, that arose from the whole genome duplication [Source:SGD;Acc:S000007228])

HSP 1 Score: 56.9954 bits (136), Expect = 1.934e-10
Identity = 29/93 (31.18%), Postives = 51/93 (54.84%), Query Frame = 2
Query:  128 ELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVML----QPFKYDPKEKSKHKFMVQSLILPETYDNLE 394
            +L F  P  +  T ++KL N     V FKV+T+AP +YCVRPN   I   ++ ++ ++     +    D  ++ + KF++ +L +P  Y N+E
Sbjct:    7 KLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVE 99          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Nematostella
Match: EDO39251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAN7])

HSP 1 Score: 166.007 bits (419), Expect = 1.082e-51
Identity = 74/124 (59.68%), Postives = 95/124 (76.61%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIP 463
            K+EQ L + P  ELKF GPFT+VVTS L+L NP+   VCFKVKTTAPK+YCVRPNSG +EP    ++AVMLQPF+YDPKEK+KHKFMVQ++  P+   + E +W+ A  + +MD KL+C FE+P
Sbjct:    3 KQEQVLKLDPAIELKFRGPFTEVVTSSLRLANPSEKRVCFKVKTTAPKRYCVRPNSGIVEPNGAVEVAVMLQPFEYDPKEKAKHKFMVQTMFAPDNITDQENLWREADANTLMDSKLKCVFELP 126          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Nematostella
Match: EDO44504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVS8])

HSP 1 Score: 74.3294 bits (181), Expect = 6.853e-15
Identity = 46/131 (35.11%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  107 LIISPNNELKFYGPFTQV-VTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYD-------PKEKSKHKFMVQSLILPETYDNLE--QVWKNAQQSDIMDFKLRCAFEIPEQ 469
            L I P  EL F G  +   +   L L N +++ V +KVKTT+P+ Y VRP+SG I    + +++V LQP               S+ KF+V S+ +     N E   +WK   +S IM+ +LRC F   EQ
Sbjct:  333 LTIRPAEELVFIGSMSSAEILQTLTLKNTSSTQVAYKVKTTSPESYRVRPSSGVINQGSSAEVSVYLQPGNITIAMTTGLATTVSRDKFLVMSMRVTGANTNAEVASLWKKVHKSSIMEHRLRCKFMTSEQ 463          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Medaka
Match: VAPB (vesicle-associated membrane protein-associated protein B/C [Source:NCBI gene;Acc:101163410])

HSP 1 Score: 189.119 bits (479), Expect = 1.224e-58
Identity = 103/251 (41.04%), Postives = 153/251 (60.96%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLT-------------EENDGE---------KLKSEIEGLILENQKLKTNE-VRLRQI----AMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            + EQ L++ P +ELKF GPFT VVT+ LKLTNPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF+YDP EKSKHKFMVQS+++P    ++E VWK A+  ++MD KLRCAFE+P ++   +E   K N    T               +DGE         +L+ E++ L  EN+++K ++ +R R++    A    N+A+++  D          +      L   L  F++G+I+GK +
Sbjct:    3 RPEQVLVLEPQHELKFRGPFTDVVTATLKLTNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGTSINVSVMLQPFEYDPNEKSKHKFMVQSVLVPYDMTDMEGVWKEAKPEELMDSKLRCAFEMPLENDKTHEGESKKNETPSTSVKSEHPAKQGSVSMDDGEVKKIMEECKRLQMEVQRLREENKQIKEDDGLRKRRVTSAAAPHSSNMAMTAVKD----------EGLSTRVLAFCLLFFVIGVIIGKMV 243          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Medaka
Match: vapal (VAMP associated protein A [Source:NCBI gene;Acc:101173498])

HSP 1 Score: 184.496 bits (467), Expect = 2.816e-57
Identity = 98/235 (41.70%), Postives = 145/235 (61.70%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGD-INEV----------VEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            K EQ LI+ P ++LKF GPFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     I+VMLQPF+YDP EKSKHKFMVQ++  P    +++ +WK ++  D+MD KLRC FE+P ++   +N V          VE S    + E+    +L++EI  L  EN+++K + VR+R++   +               + N T +  + +L++ +    +G  LGKF+
Sbjct:    3 KLEQVLILDPPSDLKFKGPFTDVVTTNLKLKNPSDRRVCFKVKTTAPRRYCVRPNSGVIDPGATVVISVMLQPFEYDPNEKSKHKFMVQTIFAPSHVSDMDSLWKESKPDDLMDSKLRCVFELPSENDKLVNAVDSVPVKAEPTVEDSELKKMQEK--CRRLQAEISKLNEENRQIKEDGVRMRKMPPPDH-------------MMSNSTAF--LPSLLVVIAAIFIGFFLGKFI 220          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Medaka
Match: vapb (vesicle-associated membrane protein-associated protein B [Source:NCBI gene;Acc:101174096])

HSP 1 Score: 185.267 bits (469), Expect = 3.563e-57
Identity = 103/248 (41.53%), Postives = 158/248 (63.71%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIP---EQSGD------INEVVEKSNFYTLTEE------NDGE--KLKSEIEGLILENQKLKTNEVRLRQ---IAMQEKNVALSSQSDVINVK----IGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            + EQ L++ P +ELKF GPF+ VVT++LKL+NPT+ +VCFKVKTTAP++YCVRPNSG I+   + +++VMLQPF YDP EKSKHKFMVQS++ P    ++E VWK A+  ++MD KLRC FE+P   E++ D      ++  + KS    L  +      ++GE  ++  E + L +E Q+L+    ++R+   + M++ NV +SSQ   + +K    +  +T  FII         F++G+I+GK +
Sbjct:    3 RPEQVLLLEPQHELKFRGPFSDVVTANLKLSNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGTSINVSVMLQPFDYDPNEKSKHKFMVQSMVAPPDMTDMEGVWKEAKPDELMDSKLRCVFEMPVDNEKTHDMEFSKIMSTSLLKSESSALPTKAASSTLDNGEVKRIMEECKRLQMEAQRLREENKQIREDDGLRMRKSNV-MSSQHASVAMKKEEGLSTRTMAFII-------LFFVVGVIVGKLV 242          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Medaka
Match: vapal (VAMP associated protein A [Source:NCBI gene;Acc:101173498])

HSP 1 Score: 163.696 bits (413), Expect = 4.083e-49
Identity = 86/222 (38.74%), Postives = 130/222 (58.56%), Query Frame = 2
Query:  146 PFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDI----------------NEVVEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            PFT VVT++LKL NP++  VCFKVKTTAP++YCVRPNSG I+P     I+VMLQPF+YDP EKSKHKFMVQ++  P    +++ +WK ++  D+MD KLRC FE+P ++  +                   VE S    + E+    +L++EI  L  EN+++K + VR+R++   +               + N T +  + +L++ +    +G  LGKF+
Sbjct:   21 PFTDVVTTNLKLKNPSDRRVCFKVKTTAPRRYCVRPNSGVIDPGATVVISVMLQPFEYDPNEKSKHKFMVQTIFAPSHVSDMDSLWKESKPDDLMDSKLRCVFELPSENDKLIRHPEPNAVDSVPVKAEPTVEDSELKKMQEK--CRRLQAEISKLNEENRQIKEDGVRMRKMPPPDH-------------MMSNSTAF--LPSLLVVIAAIFIGFFLGKFI 225          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Medaka
Match: mospd2 (motile sperm domain containing 2 [Source:NCBI gene;Acc:101169399])

HSP 1 Score: 62.7734 bits (151), Expect = 1.178e-10
Identity = 41/114 (35.96%), Postives = 62/114 (54.39%), Query Frame = 2
Query:  113 ISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQ-PFKYDPKEKSKHKFMVQSLILPETYDN-LEQVWKNAQQSDIMDFKLRC 448
            +SP  EL F G         + LTN T + V FKV+TTAP++Y V+P+S + EP  + DI V L   F+  P++    +F+V +  +       L Q WK   ++ IM+ +LRC
Sbjct:  334 VSPAEELSF-GSGETERKCLIVLTNVTKNVVAFKVRTTAPEKYRVKPSSSSCEPGASVDIVVSLHGGFQASPQD----RFLVMAAEMDGAGSQELAQFWKEVPKNKIMEHRLRC 442          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Planmine SMEST
Match: SMESG000062111.1 (SMESG000062111.1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.635e-168
Identity = 228/228 (100.00%), Postives = 228/228 (100.00%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 763
            MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM
Sbjct:    1 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTMFLLGIILGKFM 228          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Planmine SMEST
Match: SMESG000078130.1 (SMESG000078130.1)

HSP 1 Score: 181.8 bits (460), Expect = 3.412e-56
Identity = 99/230 (43.04%), Postives = 143/230 (62.17%), Query Frame = 2
Query:   98 EQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPE-TYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEENDG-----EKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFIIAALILGLTM---FLLGIILGKF 760
            +  L I+P+NELKF GP+T VVTSHL L N  N S+C+KVKTTAPK YCVRPNSG IEP K   ++VMLQPF+++P EKSKHKF++QS +  +   +N EQ+WK+  +  I + KL+C F+  + +GD+  V E            G     E+LK+++  L  EN+KLK  E RLR++A+Q+     + ++  I +   +  Q  +   L+LG+     FL+G I+ KF
Sbjct:    6 DHKLDINPSNELKFKGPYTSVVTSHLTLKNVGNKSLCYKVKTTAPKMYCVRPNSGLIEPSKEILVSVMLQPFEFNPGEKSKHKFLIQSTVADDKNLENFEQLWKSVDKELIKEIKLKCVFDYDKSAGDVKSVSETETVNVSNSAQPGLATTVEELKNQLFELKNENEKLKIAEARLRKVALQD-----TLENSTIPISNSDSKQNMMNNILLLGIICFISFLIGFIIAKF 230          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Planmine SMEST
Match: SMESG000004858.1 (SMESG000004858.1)

HSP 1 Score: 125.561 bits (314), Expect = 5.249e-34
Identity = 83/261 (31.80%), Postives = 135/261 (51.72%), Query Frame = 2
Query:   98 EQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILP-ETYDNLEQVWKNAQQSDIMDFKLRCAF-EIPEQSGDINEVVEKSNFYTLTEENDGEKLKS---------------------------EIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIGNQTQWFII-----------AALILGLTMFLLGIILGKF 760
            +Q L I+P+N +KF G F +++T  L + NP + +V FK+KTT PKQYCVRP+ G + P+   +I+++LQP +Y   EK++HKFM+QSLI+  E  +N++ VWKNA  ++IM  KL     + PE   +    +E  +F +    ++ E L+S                           +++ L  EN+KLK   + L+ +         S+Q++  N++     +  II             +I  L  F LG+I+GKF
Sbjct:    4 QQLLEITPSNSIKFEGTFKEIITKKLTIRNPLDKNVAFKIKTTTPKQYCVRPSVGFVAPQDTKEISIILQPMQYTITEKARHKFMIQSLIISEEEANNIDLVWKNAAPTNIMCTKLLSVLIQTPELITETEAPLEIKSFSSTEMTSNFESLESPMDSPLNGISELGDITMVGSSISQDSHKVDKLDEENKKLKDQVLTLKNMVFDLTYKLESTQTESSNIETDKSIKEEIIHKPELNGQLGLPLIIYQLLAFFLGLIIGKF 264          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Planmine SMEST
Match: SMESG000016201.1 (SMESG000016201.1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.380e-17
Identity = 69/250 (27.60%), Postives = 123/250 (49.20%), Query Frame = 2
Query:   92 KKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSS-VCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETY----------DNLEQVWKNAQQSDIMDFKLRCAFE----IPEQSGDINEVVE----KSNFYTLTEENDGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKN--VALSSQSDVINVKIGNQT-------QWFIIAALILGLTMFLLGIILGK 757
            K + +++I+P +EL F GPF +   S + +TN   S  V FK+KTTA K+Y V+P  G I P  +  I V+L+PF Y+   K K+KF+++   +PE            D   Q     +   I   KL+C F      PE+  D    V+     ++  T +     +KL++ I   I EN  ++   + LR++   + N  + ++ Q +   +K+ ++        Q ++I A+ L +T  ++G++ G+
Sbjct:    2 KIDSHVVINPVHELIFVGPFDKNTISFVDITNNFESEFVYFKLKTTAVKRYYVQPTRGIIPPSCSSRIKVILKPFTYNSSMKLKNKFLIEFFQMPENVQLKIFNKNRTDQFIQKCFEDRVHKIYQKKLKCVFTGVQMRPEE--DYPSAVDCKRPSTDMSTDSTVMKADKLRTTIRWFINENIHIQKQIIDLRKVLDNKDNLPIQINFQENRFCLKLDSENEGALKIPQKYVIGAIALVITTTIVGMLSGR 249          
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Planmine SMEST
Match: SMESG000021536.1 (SMESG000021536.1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.420e-14
Identity = 43/143 (30.07%), Postives = 75/143 (52.45%), Query Frame = 2
Query:   80 MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTAPKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPETYDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNF 508
            ++++  E  L ++P ++L F G F   +   + L N +   V FK+KTTAP  Y V PNSG I   +   I V LQPF Y  ++  +HKF V +++  +  D  +  W+  + S   ++K+RC  +  E    ++ + +  +F
Sbjct:  415 LTRQTSEPYLEVTPTDKLLFQGSFRHSINESIVLKNISEDMVRFKIKTTAPASYKVYPNSGVITSNEIAIINVALQPFVYREEQIYRHKFKVFTVLASDRNDTAD--WEFLRDSSYREYKIRCVIDHVENDDQVSTLSQNPSF 555          
The following BLAST results are available for this feature:
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAPA8.451e-5940.16VAMP associated protein A [Source:HGNC Symbol;Acc:... [more]
VAPB7.106e-5539.68VAMP associated protein B and C [Source:HGNC Symbo... [more]
VAPA1.675e-5052.74VAMP associated protein A [Source:HGNC Symbol;Acc:... [more]
VAPB6.622e-2260.29VAMP associated protein B and C [Source:HGNC Symbo... [more]
VAPB2.638e-2160.29VAMP associated protein B and C [Source:HGNC Symbo... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vpr-11.874e-3537.25Major sperm protein [Source:UniProtKB/TrEMBL;Acc:... [more]
F42G2.51.571e-2344.55Major sperm protein [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vap338.204e-3546.92gene:FBgn0029687 transcript:FBtr0070617[more]
Vap331.407e-3446.92gene:FBgn0029687 transcript:FBtr0342739[more]
Vap331.407e-3446.92gene:FBgn0029687 transcript:FBtr0070618[more]
Vap331.407e-3446.92gene:FBgn0029687 transcript:FBtr0070616[more]
fan1.461e-1524.22gene:FBgn0028379 transcript:FBtr0076683[more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapal1.920e-6040.32VAMP (vesicle-associated membrane protein)-associa... [more]
vapb3.230e-5740.08VAMP (vesicle-associated membrane protein)-associa... [more]
vapb3.230e-5740.08VAMP (vesicle-associated membrane protein)-associa... [more]
top1mt4.677e-4354.17DNA topoisomerase I mitochondrial [Source:ZFIN;Acc... [more]
mospd23.679e-1034.19motile sperm domain containing 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oprl12.977e-5940.98opiate receptor-like 1 [Source:Xenbase;Acc:XB-GENE... [more]
VAPB1.516e-4662.39VAMP associated protein B and C [Source:HGNC Symbo... [more]
VAPB1.795e-4662.39VAMP associated protein B and C [Source:HGNC Symbo... [more]
VAPB3.702e-4662.39VAMP associated protein B and C [Source:HGNC Symbo... [more]
mospd21.359e-932.76motile sperm domain containing 2 [Source:NCBI gene... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vapb2.421e-5842.39vesicle-associated membrane protein, associated pr... [more]
Vapa4.466e-5840.16vesicle-associated membrane protein, associated pr... [more]
Vapa2.111e-2756.25vesicle-associated membrane protein, associated pr... [more]
Mospd29.139e-927.27motile sperm domain containing 2 [Source:MGI Symbo... [more]
Mospd26.687e-829.66motile sperm domain containing 2 [Source:MGI Symbo... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R601|VAPA_PONAB4.058e-5840.16Vesicle-associated membrane protein-associated pro... [more]
sp|Q9P0L0|VAPA_HUMAN4.058e-5840.16Vesicle-associated membrane protein-associated pro... [more]
sp|Q0VCY1|VAPA_BOVIN1.061e-5740.96Vesicle-associated membrane protein-associated pro... [more]
sp|Q9Z270|VAPA_RAT2.309e-5740.16Vesicle-associated membrane protein-associated pro... [more]
sp|Q9Z269|VAPB_RAT2.525e-5742.39Vesicle-associated membrane protein-associated pro... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1A8JZR24.679e-6044.98VAMP (Vesicle-associated membrane protein)-associa... [more]
A0A2C9K1J77.397e-5944.54MSP domain-containing protein OS=Biomphalaria glab... [more]
A0A5N5Q5M12.615e-5842.00Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A5N5L0E93.037e-5841.77Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A1A8J1195.576e-5842.15VAMP (Vesicle-associated membrane protein)-associa... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapb9.562e-5941.94VAMP associated protein B and C [Source:NCBI gene;... [more]
VAPA1.186e-5740.00VAMP associated protein A [Source:NCBI gene;Acc:10... [more]
vapal5.074e-5340.52vesicle-associated membrane protein-associated pro... [more]
vapal1.220e-5160.32vesicle-associated membrane protein-associated pro... [more]
vapal1.054e-4561.47vesicle-associated membrane protein-associated pro... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vapb3.378e-3460.47VAMP (vesicle-associated membrane protein)-associa... [more]
ENSPMAT00000007085.15.829e-1033.63pep scaffold:Pmarinus_7.0:GL480831:649:8171:1 gene... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SCS21.360e-1134.29Integral ER membrane protein, regulates phospholip... [more]
SCS221.934e-1031.18Protein involved in regulation of phospholipid met... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO392511.082e-5159.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445046.853e-1535.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAPB1.224e-5841.04vesicle-associated membrane protein-associated pro... [more]
vapal2.816e-5741.70VAMP associated protein A [Source:NCBI gene;Acc:10... [more]
vapb3.563e-5741.53vesicle-associated membrane protein-associated pro... [more]
vapal4.083e-4938.74VAMP associated protein A [Source:NCBI gene;Acc:10... [more]
mospd21.178e-1035.96motile sperm domain containing 2 [Source:NCBI gene... [more]
back to top
BLAST of VAMP (vesicle-associated membrane protein)-associated protein A, like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062111.11.635e-168100.00SMESG000062111.1[more]
SMESG000078130.13.412e-5643.04SMESG000078130.1[more]
SMESG000004858.15.249e-3431.80SMESG000004858.1[more]
SMESG000016201.14.380e-1727.60SMESG000016201.1[more]
SMESG000021536.11.420e-1430.07SMESG000021536.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024958 ID=SMED30024958|Name=VAMP (vesicle-associated membrane protein)-associated protein A, like|organism=Schmidtea mediterranea sexual|type=transcript|length=920bp
TTTCGTTTACACATTTCATTTCGATATTTCAAAATTAGTGGAAAAATAAT
ATTTTCGAAGTTCGAAACTACTGTATTTAATGTCTCAAGAGAAAAAAGAA
CAAAATTTAATTATTAGCCCAAATAATGAACTTAAATTTTATGGACCATT
TACACAAGTTGTAACATCTCATCTGAAATTAACAAATCCTACCAACAGTA
GTGTTTGTTTTAAAGTTAAAACTACAGCTCCAAAGCAATATTGTGTGAGA
CCAAATTCCGGAAATATTGAACCCAAGAAAAATTTTGATATAGCAGTAAT
GTTACAACCATTTAAATATGACCCAAAAGAAAAAAGTAAGCATAAATTTA
TGGTCCAGTCTTTAATTTTGCCAGAAACATATGATAATCTTGAACAAGTT
TGGAAAAACGCTCAACAATCTGATATAATGGATTTCAAACTAAGATGCGC
TTTTGAAATACCCGAGCAATCTGGAGATATCAACGAAGTTGTAGAGAAAT
CAAATTTCTATACTTTAACAGAAGAAAATGATGGTGAAAAATTAAAATCA
GAAATCGAAGGATTAATATTGGAAAATCAAAAACTAAAGACAAATGAAGT
TCGTCTTCGACAAATAGCCATGCAAGAAAAAAACGTTGCTTTATCAAGCC
AATCTGATGTTATTAATGTTAAAATTGGAAATCAGACACAGTGGTTTATT
ATTGCAGCACTGATACTTGGTTTAACCATGTTTTTGCTTGGTATTATATT
AGGAAAATTTATGTGATTATAAGCAGATACTTATTATAAAGTGGAGAAGT
ACATCTGCTTCGTTTTGCACTTAATACAAATATGTGATTAACATGTTTAT
ATTTGCTATTTAAAATACATGACAGTCATTACATTTTTTATGGCAAATAC
ACTCTTTAATCTTAAAAAAA
back to top

protein sequence of SMED30024958-orf-1

>SMED30024958-orf-1 ID=SMED30024958-orf-1|Name=SMED30024958-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=229bp
MSQEKKEQNLIISPNNELKFYGPFTQVVTSHLKLTNPTNSSVCFKVKTTA
PKQYCVRPNSGNIEPKKNFDIAVMLQPFKYDPKEKSKHKFMVQSLILPET
YDNLEQVWKNAQQSDIMDFKLRCAFEIPEQSGDINEVVEKSNFYTLTEEN
DGEKLKSEIEGLILENQKLKTNEVRLRQIAMQEKNVALSSQSDVINVKIG
NQTQWFIIAALILGLTMFLLGIILGKFM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016763VAP
IPR013783Ig-like_fold
IPR030229VAPA
IPR008962PapD-like_sf
IPR000535MSP_dom
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005923bicellular tight junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0031965nuclear membrane
GO:0005634nucleus
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0008219cell death
GO:0031175neuron projection development
GO:0070972protein localization to endoplasmic reticulum
Vocabulary: molecular function
TermDefinition
GO:0033149FFAT motif binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 152..172
NoneNo IPR availableTMHMMTMhelixcoord: 205..224
IPR016763Vesicle-associated membrane-protein-associated proteinPIRSFPIRSF019693VAMP_assoc_protcoord: 2..158
e-value: 1.9E-53
score: 180.0
coord: 134..228
e-value: 3.8
score: 5.2
IPR016763Vesicle-associated membrane-protein-associated proteinPANTHERPTHR10809VESICLE-ASSOCIATED MEMBRANE PROTEIN-ASSOCIATED PROTEINcoord: 6..141
IPR000535Major sperm protein (MSP) domainPFAMPF00635Motile_Spermcoord: 10..111
e-value: 6.1E-30
score: 103.3
IPR000535Major sperm protein (MSP) domainPROSITEPS50202MSPcoord: 9..126
score: 30.58
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1..127
e-value: 5.7E-52
score: 176.8
IPR030229Vesicle-associated membrane protein-associated protein APANTHERPTHR10809:SF40VESICLE-ASSOCIATED MEMBRANE PROTEIN-ASSOCIATED PROTEIN Acoord: 6..141
IPR008962PapD-like superfamilySUPERFAMILYSSF49354PapD-likecoord: 5..132