Coiled-coil domain containing 60

Overview
NameCoiled-coil domain containing 60
Smed IDSMED30024952
Length (bp)2026
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 60 (SMED30024952) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 60 (SMED30024952) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 60 (SMED30024952) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 60 (SMED30024952) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024952

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024952SMESG000038986.1 SmedASXL_013638SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024952SMESG000038986.1 dd_Smed_v4_14286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024952SMESG000038986.1 dd_Smed_v4_14286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024952SMESG000038986.1 dd_Smed_v6_14286_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024952SMESG000038986.1 dd_Smed_v4_14286_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 60 vs. Ensembl Human
Match: CCDC60 (coiled-coil domain containing 60 [Source:HGNC Symbol;Acc:HGNC:28610])

HSP 1 Score: 68.1662 bits (165), Expect = 2.960e-11
Identity = 117/544 (21.51%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  431 NLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMS-DNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQ--ESFFRQLTSLQWLLEAM-INENVENMPRITLSWIVRKENNNLTSLK---NQKEIKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSK-----TKETNEININ------TSIQLSKASSQEISVKEXXXXXX------------XXXXXXXPKSTV----GLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGRF-----------PVDRK---RISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNL--RDNVRNMAEYK-LIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTNFENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWFR 1909
            NLKK++ +S  L  +V+ G+ +F IL++E  KK      ++ +  +   + +P  + S+   G  L  + D+ +       + R     RPFTPI+S I                           ++P   E   E  FRQL +L WLLEA+ I+     M  +   W  +    + +++K     K +   WE +IT + +  K +       + + ++  ST  LS+     + +++ I++N       S+     SS++I   E SS+                +     + TV    G+QR+       S+   ++++ ++  YK+    ++               PV +K   R +    +  +    + ++   Y    ++   + DK+  L  R   R + +++  ++ SN  KDI        ++K    +     +F +L +             L E+LK     K+I   L K++ F  N   ++    L  VL  L  WE+  PDI+ +I+FV +H++ + +EDY  W +
Sbjct:   48 NLKKDLIRSRFLIQSVKIGRGYFAILREETAKKKKQQQLQKLKEEERN-KFQPAEKISEIHYGDTLLSTYDDEKLKTLGARVTR-----RPFTPIHSCI---------------------------ISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEHFIT-APKTKKFKIPTMRVTNRKPSRRGSTLSLSRASGGSSPQSSMISVNPGSDEPPSVNTQVTSSKDIEDNESSSTKPDEEPLYMNLQKLLEMVREDARRTVTIENGMQRK-----APSILSVLKQNKSNSAYKEMQTTLKSSERSSSTSAESHIQPVQKKSKNRTNCDINIHYKSGVCNTMRAKFYSVAQEAGFCLQDKMEILMKRQEERGIQKFRAFVLVSNFQKDIAKMRHHISVVKGDAEEIADHWYFDLLSK-------------LPEDLKNFRPAKKI---LVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVREHIIHMPQEDYISWLQ 536          
BLAST of Coiled-coil domain containing 60 vs. Ensembl Xenopus
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:Xenbase;Acc:XB-GENE-995324])

HSP 1 Score: 101.679 bits (252), Expect = 9.753e-22
Identity = 150/658 (22.80%), Postives = 264/658 (40.12%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHP--LELDKCLEISDLSDHREQVKKPEDVE--VNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNK-NLKKEINKSEMLTFNVRTGQHFFDILKKENEKK-----------YMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMSDNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQKEIK------VAWE--------KYITKSDQQSKHRATISAAVSTQATKISSTNQLSK-TKETNEININTS-IQLSKASSQEISVKEXXXXXXXXXXXXXPKSTVGLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGR-----FPV-----------DRKRISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTN-FENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWF 1906
            S   +K+QAR+  + +     RE V +ANY RR+ QL+ +G+ S + KPY  +G P  LE  K +  S   D +E   + E +E    +D   +   + ++  M+A        +  + +K N   E   +  L   VR G+ +F +L +E E K           Y     E Q    +  EI    E   +E   +L +++ +E  R  +   R     RPFTPI+ ++  L+   F                         + E+ FRQL +L WLLE++  E    +  ++  W + K ++   S    K+I       + W+        K   K+ +Q        + +S +++ I S + L+  ++E     +++S   L  A + E +V           +   P S    +   MIA      E I+ D ++ E +KN  L+R        FPV            R + S +T L   +  + K Q +  +  D   ++  D      D V         +   KY+ + +   FHQ L+  R      N +  + + ++     NWF+ L   +     +N +I N + K+         ++        L  L  WE+  PD+S +I+FV +H++ +  E+Y  W 
Sbjct:   23 SQKGLKIQARSPTYYSCWEANREGVFRANYLRRQKQLSQQGYNSPINKPYEDLGQPLILEAKKFILHSLGQDEQEPKSEKEAIENYSAEDSNAESIPKISKGEMAASFGTTFYLRQRKKDKTNFNNEFQHTRQLMSRVRQGRGYFYLLHEEEEAKNRDLKEKQRFQYEKHRTEPQPPSYNVEEISEEDEAVTNEQADKLFLTEVKEKRRKESKSMR-----RPFTPIHHSL--LSSHIF-----------------------DADLETLFRQLCALHWLLESLTLEPSSAIRPVSSCWNLSKCSDAGGSKTPVKKITRENNADLKWDQLQAGKGKKMSQKTSRQCSASFRSISRISGRSSAIGSESSLTPNSEEMAAGGVSSSDCNLEGADAIESAVT-SVHGKLSKEADKEPLSEYLQKLIEMIA------ESIKADLDEEESQKNCTLLRAPSAQTEDFPVREDQQSNRILLQRPKSSPATTLYPSNLVTKKKQAVFSQMRDMFFEVAADADTIFHDKVEARERRCQEVNIQKYRSLDSMQNFHQDLEKMR------NAYHYVKEDRDYKDKNNWFVVLMSRIPQEMMKNHKIHNIVNKLEKLEEKLFVRIRPSAFLKFLEGLRTWELCSPDVSVAIEFVREHLIQMPLEEYTAWL 637          
BLAST of Coiled-coil domain containing 60 vs. Ensembl Xenopus
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:Xenbase;Acc:XB-GENE-995324])

HSP 1 Score: 67.0106 bits (162), Expect = 6.418e-11
Identity = 86/397 (21.66%), Postives = 160/397 (40.30%), Query Frame = 2
Query:  815 DSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQKEIK------VAWE--------KYITKSDQQSKHRATISAAVSTQATKISSTNQLSK-TKETNEININTS-IQLSKASSQEISVKEXXXXXXXXXXXXXPKSTVGLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGR-----FPV-----------DRKRISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTN-FENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWF 1906
            +  ++E+ FRQL +L WLLE++  E    +  ++  W + K ++   S    K+I       + W+        K   K+ +Q        + +S +++ I S + L+  ++E     +++S   L  A + E +V           +   P S    +   MIA      E I+ D ++ E +KN  L+R        FPV            R + S +T L   +  + K Q +  +  D   ++  D      D V         +   KY+ + +   FHQ L+  R      N +  + + ++     NWF+ L   +     +N +I N + K+         ++        L  L  WE+  PD+S +I+FV +H++ +  E+Y  W 
Sbjct:  216 EQADKETLFRQLCALHWLLESLTLEPSSAIRPVSSCWNLSKCSDAGGSKTPVKKITRENNADLKWDQLQAGKGKKMSQKTSRQCSASFRSISRISGRSSAIGSESSLTPNSEEMAAGGVSSSDCNLEGADAIESAVT-SVHGKLSKEADKEPLSEYLQKLIEMIA------ESIKADLDEEESQKNCTLLRAPSAQTEDFPVREDQQSNRILLQRPKSSPATTLYPSNLVTKKKQAVFSQMRDMFFEVAADADTIFHDKVEARERRCQEVNIQKYRSLDSMQNFHQDLEKMR------NAYHYVKEDRDYKDKNNWFVVLMSRIPQEMMKNHKIHNIVNKLEKLEEKLFVRIRPSAFLKFLEGLRTWELCSPDVSVAIEFVREHLIQMPLEEYTAWL 599          

HSP 2 Score: 50.447 bits (119), Expect = 8.644e-6
Identity = 45/155 (29.03%), Postives = 75/155 (48.39%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHP--LELDKCLEISDLSDHREQVKKPEDVE--VNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNK-NLKKEINKSEMLTFNVRTGQHFFDILKKENEKK 529
            S   +K+QAR+  + +     RE V +ANY RR+ QL+ +G+ S + KPY  +G P  LE  K +  S   D +E   + E +E    +D   +   + ++  M+A        +  + +K N   E   +  L   VR G+ +F +L +E E K
Sbjct:   23 SQKGLKIQARSPTYYSCWEANREGVFRANYLRRQKQLSQQGYNSPINKPYEDLGQPLILEAKKFILHSLGQDEQEPKSEKEAIENYSAEDSNAESIPKISKGEMAASFGTTFYLRQRKKDKTNFNNEFQHTRQLMSRVRQGRGYFYLLHEEEEAK 177          
BLAST of Coiled-coil domain containing 60 vs. Ensembl Mouse
Match: Ccdc60 (coiled-coil domain containing 60 [Source:MGI Symbol;Acc:MGI:2141043])

HSP 1 Score: 51.2174 bits (121), Expect = 3.333e-6
Identity = 55/230 (23.91%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  431 NLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMS-DNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAM-INENVENMPRITLSWIVRKENNNLTSLK---NQKEIKVAWEKYITKS-DQQSKHRATISAAVSTQATKISSTNQLSKT 1102
            NLKK++ +S  L   V+ G+ +F+IL++EN  K      ++ +  +   + +P  + SD      L  + D  +  +   GI      IRPFTPI+S +                         M+ +      +  FRQL +L WLLEA+ I+     M  +   W  +    + +++K     K +   W+ ++T    ++ K  A  +A  S + ++  ST  L++T
Sbjct:   49 NLKKDLMRSRFLIQCVKIGRGYFNILREENAMKKKQQLLQKLKEEELN-KFQPAKKFSDIHCRDNLLATYDCEKLKKLEAGI-----IIRPFTPIHSCL-------------------------MAPSLPESHVDPLFRQLCALHWLLEALTIDHTHHTMRPLIACWNPKDPGGSKSTIKKINKDKSMGQRWDHFVTAPKTKKYKAPAIRTAMASRKPSRRGSTLSLTRT 247          

HSP 2 Score: 50.447 bits (119), Expect = 6.311e-6
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 2
Query: 1652 IYTNWFLSLEENLKTNFENKR-IENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWFR 1909
            I  +W+  L   L  + ++ R  +  L K++ F  N   ++    L  VL  L  WE+  PDI+ +I+FV +H++ + +EDY  W +
Sbjct:  445 IADHWYFDLLSKLPEDLKSFRPAKKILMKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVREHIIHMPQEDYINWLQ 531          
BLAST of Coiled-coil domain containing 60 vs. UniProt/SwissProt
Match: sp|Q8IWA6|CCD60_HUMAN (Coiled-coil domain-containing protein 60 OS=Homo sapiens OX=9606 GN=CCDC60 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.422e-10
Identity = 117/544 (21.51%), Postives = 223/544 (40.99%), Query Frame = 2
Query:  431 NLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMS-DNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQ--ESFFRQLTSLQWLLEAM-INENVENMPRITLSWIVRKENNNLTSLK---NQKEIKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSK-----TKETNEININ------TSIQLSKASSQEISVKEXXXXXX------------XXXXXXXPKSTV----GLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGRF-----------PVDRK---RISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNL--RDNVRNMAEYK-LIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTNFENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWFR 1909
            NLKK++ +S  L  +V+ G+ +F IL++E  KK      ++ +  +   + +P  + S+   G  L  + D+ +       + R     RPFTPI+S I                           ++P   E   E  FRQL +L WLLEA+ I+     M  +   W  +    + +++K     K +   WE +IT + +  K +       + + ++  ST  LS+     + +++ I++N       S+     SS++I   E SS+                +     + TV    G+QR+       S+   ++++ ++  YK+    ++               PV +K   R +    +  +    + ++   Y    ++   + DK+  L  R   R + +++  ++ SN  KDI        ++K    +     +F +L +             L E+LK     K+I   L K++ F  N   ++    L  VL  L  WE+  PDI+ +I+FV +H++ + +EDY  W +
Sbjct:   48 NLKKDLIRSRFLIQSVKIGRGYFAILREETAKKKKQQQLQKLKEEERN-KFQPAEKISEIHYGDTLLSTYDDEKLKTLGARVTR-----RPFTPIHSCI---------------------------ISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEHFIT-APKTKKFKIPTMRVTNRKPSRRGSTLSLSRASGGSSPQSSMISVNPGSDEPPSVNTQVTSSKDIEDNESSSTKPDEEPLYMNLQKLLEMVREDARRTVTIENGMQRK-----APSILSVLKQNKSNSAYKEMQTTLKSSERSSSTSAESHIQPVQKKSKNRTNCDINIHYKSGVCNTMRAKFYSVAQEAGFCLQDKMEILMKRQEERGIQKFRAFVLVSNFQKDIAKMRHHISVVKGDAEEIADHWYFDLLSK-------------LPEDLKNFRPAKKI---LVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVREHIIHMPQEDYISWLQ 536          
BLAST of Coiled-coil domain containing 60 vs. TrEMBL
Match: A0A1L8I1A5 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18007907mg PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.333e-21
Identity = 146/663 (22.02%), Postives = 277/663 (41.78%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELD-KCLEISDLSDHREQVKKPED-VE--VNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNK-NLKKEINKSEMLTFNVRTGQHFFDILKKENE-KKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMSDNREFSRPSTGINRK-----KLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKN---QKEIKVAWEKY-----ITKSDQQSKHRAT---ISAA------VSTQATKISSTNQLSKTKETNEININTSIQLS-KASSQEISVKEXXXXXXXXXXXXXPKSTVGLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRI-----------------GRFPVDRKRISESTKLQSQDQFSDK-------LQHMLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTN-FENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWF 1906
            S   +K+QAR+  + +   P RE + +ANY R++ QL+ +G+ S   KPY  +G PL L+ K L +  L    ++ K  +D +E  +++D   +   + ++  M+A        +  + +K N   E   +  L   VR G+ +F IL +E E KK+   +K+  Q  K+  E +P     +  S  E ++++ R  +   T +  K     K   RPFTPI++++                         +S +   ++ ES FRQL +L WLLE++  E    +  ++  W +     +   +K    +  + + W++        K++Q      T    SA+      +S +++ I S + L    E   +   +S+  + + +    S            +   P S    +   MIA      E ++ D ++ E +K   L+R                   R  + R + S +T L   +  + K       +++M ++   ++  +  DK+   R+  R     +      KY+ +     FHQ L+  R      N +  + + K+     NWF+ L   +  +  +N +I N ++K+         ++        L+ L  WE+  PDIS +I+FV +H++ +  EDY  W 
Sbjct:   23 SQKGLKIQARSPTYYSCWEPNREALFRANYLRQQKQLSQQGYNSPNNKPYEDLGQPLILEAKKLILHSLGQDEQETKSEKDEIENSISEDSNAEAIPKISKGEMAASLGTTVYLRQRKKDKINFNNEFQHTRQLISRVRQGRGYFYILHEEEERKKWDLQEKQRLQYEKNRTEPQPPSYHVEESSNEEDKITNERADNLFLTEVKEKRRKENKATRRPFTPIHNSL-------------------------LSSHIIDVDLESLFRQLCALHWLLESLTLEPSSAIRPVSSCWNLSDPGGSKAPVKKITRENNLDLKWDQLSLPGKAKKTNQNHPFNPTRRQCSASLRTISRISGRSSAIGSMSSLIPNSEEMAVGGTSSLDANLEGADVTASGANSVHGKLSKEADEEPLSEYMQKLIEMIA------ESVKMDLDEEERQKECTLLRAPMVAQIDVPLLREDQQSNRILLHRPKSSPATTLYPSNLVTKKKPIVFSEMRNMFFEVAAEADTIFHDKV-EARERRRQEVNIQ------KYQSLDKMQNFHQDLEKMR------NAYHYVKEDKDHKDKNNWFVVLMSRIPQDAMKNHKIRNIMDKLEKLEEKLFVRIRPNAFLRFLSGLRTWELCSPDISVAIEFVREHLIQMPLEDYTAWL 641          
BLAST of Coiled-coil domain containing 60 vs. TrEMBL
Match: A0A267DIW0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003796g3 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.404e-20
Identity = 113/406 (27.83%), Postives = 190/406 (46.80%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLEL-DKCLEISDLSDHREQVKKPEDVEVNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQ-QIIKDTPEIRPVIE------DSDSESGSEL----------QMSDNREFSRP--STGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQ----ESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQK---EIKVAWEKYITKSDQQSKHRATISAAVSTQATKI------------SSTNQLSKTKETNEININTSIQLSKASSQEISVKE 1180
            S+  VK++AR     +P  PTR+ VR  NY+RR  QL+ +GF +  WKPY CIG  + L D+ L +S L       K+PE V+  + +  +   E+  A     SL   S+K  ++  +LK E+ KSE +   +  G+ +F+ L++E EK+     + +Q + ++   E RP  E      D D E  + +             D R+ SR        ++    RP+TP+++NI    G+    P            S  S + D+ EQ    ES F+QL +L WLLEAM+ E+   M  I+ SW ++       S ++++    +K  W+  ++    + +HR  I    + ++T+I            S+ ++ S      +  +  S   S+ASS  +SV+E
Sbjct:   38 SHVGVKMRARTAQLYDPSEPTRDQVRHQNYSRRYRQLSSQGFRTPAWKPYECIGEEVCLDDRQLILSTLGQ-----KEPERVQAPEAEDGK--AEDKVAKHVNPSLFIASRKAVKV--DLKAELQKSEGIRKRMNIGKSYFEYLQQEKEKRVAEKIRLDQLERLRARTEARPPPETEESTDDEDKEDFAAVNSVHLECFRSAAPDPRQSSRSRQDCRRKKRTRPPRPYTPLHANI----GEHPDEP------------SWCSTHEDAGEQPEFLESLFKQLCALHWLLEAMLQEDPTLMNPISSSWSLKNIGGTWVSARDKERSTAVKKEWDSLVSG---RGRHR--IGGLAARRSTRIWSSMRTDLTNRSSARSRASTAGSGADGGLGESRATSRASS--VSVEE 411          
BLAST of Coiled-coil domain containing 60 vs. TrEMBL
Match: W5M5U2 (Coiled-coil domain containing 60 OS=Lepisosteus oculatus OX=7918 GN=CCDC60 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.632e-20
Identity = 96/374 (25.67%), Postives = 167/374 (44.65%), Query Frame = 2
Query:   86 ASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELDKCLEISDLSDHREQVKKPEDVEVNKD----KF--VQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIK-----DTPEIRPVIEDSDSESGSE--LQMSDNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKN---QKEIKVAWEKYITKS-DQQSKHRATISAAVSTQATKISSTNQLSKTKETNEININTSIQLSKAS 1156
            A +K+QAR+    NP  P RE V + NY RR+ QL  +G+ +  W+PY  IG PL L+    I       EQ+ K E     K+     F   Q+D+     ++ ++ L    +K     + L++ + ++  L   V+ GQ +F IL+KE +       +E+Q++ +       P      E S+S+  +E   + +   E S+      R+    RPFTP++ ++                     TS Q    P    QE+ FRQL  L WLLEA+  E +  M  +   W ++    + T +K    +K I++ W+++IT+S  ++   R     +V  + T    ++ LS+        + ++  L+  S
Sbjct:   26 AGIKLQARSSTVFNPCEPNREQVFRENYRRRQKQLTRQGYRAVNWRPYEEIGEPLVLEPKRLILHSLGQPEQICKDEPSGGPKEDQESAFNKAQLDSAEESKNVPSRVLP--IEKTGDDGRALRRHLTRTRCLVSAVKQGQGYFHILQKEAQDLQKAHLEEQQRLAELRRSACKPPSFSTEEGSESDETTEGFFRTALPAEHSQLYKKHARRASPARPFTPLHCSL---------------------TSPQ----PSEASQETIFRQLCCLNWLLEALTLEPLGRMGPVFSCWDIKDPGRSKTMIKTLNKEKAIEIKWDQFITQSKSKKPPSRVLRKLSVKPRKTSFLGSSCLSEVSSAVTPTMGSASSLAPGS 372          
BLAST of Coiled-coil domain containing 60 vs. TrEMBL
Match: V4B778 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237703 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 8.981e-20
Identity = 116/420 (27.62%), Postives = 189/420 (45.00%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELD-KCLEISDLSD-HREQVKKPEDVEVNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKK-------YMTDDKEEQQIIK-------------DTPEIRPVIEDSDSESGSE------LQMSDNREFSRPSTGIN---RKKLNI--RPFTPIYSNISNLTGKTF---------IRPKSEYGYREGGTSSQMSLNPDS-------------IEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKEN--NNLTS---LKNQKEIKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSKTKETNEININTSIQLSKASS 1159
            S   +K+QAR +   NPI P+R+ VR ANY RR+ QL  +GF +  ++PY+ IG P  LD K L +S L                  ++ +++  +    S +   LR+   K  +LN NL KE+     L  NV+ G   FD++K+E + K       Y    +E +   +             D P+   +  DS   SG E       Q +   + SRP++  +   +KK NI  RPFTP Y+++S +T  T          + P  +         S + ++PDS             + ++S FRQL  L W+LEAM  E    M  IT  W + K +   N  S   ++NQK  +  W++++T +   +K   +  + +S Q  +     + S +   + I++NT+ Q S + S
Sbjct:   19 SQKGLKLQARCDTVYNPIHPSRDIVRSANYRRRQEQLVTQGFNALNYRPYVGIGDPFYLDEKRLVLSALGQWEESDESCYSSSSDEDERGLEVTKQKKSNSAANFMLRR---KKRELN-NLNKEVRHGRNLIRNVKLGHGLFDLIKQERQAKKAAIAEAYRKKAEEARNAWQQPKSDSSSDESENDIPQDTEL--DSSYFSGGEQDSIFLTQPNTPGDGSRPNSSKSTPRKKKKNIPPRPFTPKYTSLSEVTDHTADFEANITSSLNPSRDVS---PDNRSVVPIDPDSMNTAVDNSVISFDVSRDSLFRQLCVLNWILEAMNIEQGCTMSSITTCWKLSKSDMGGNKVSKGRIQNQKTAQTKWDQFVTNTGAHAK--ISKRSRLSRQYNRRVQLTRTSLSPSNSSIHLNTTNQSSVSHS 427          
BLAST of Coiled-coil domain containing 60 vs. TrEMBL
Match: A0A1I8JBM8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.682e-19
Identity = 115/407 (28.26%), Postives = 189/407 (46.44%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLEL-DKCLEISDLSD-HREQVKKPEDVEVNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQ-QIIKDTPEIRPVIE------DSDSESGSEL----------QMSDNREFSRP--STGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQ----ESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQK---EIKVAWEKYITKSDQQSKHRATISAAVSTQATKI------------SSTNQLSKTKETNEININTSIQLSKASSQEISVKE 1180
            S+  VK++AR     +P  PTR+ VR  NY+RR  QL+ +GF +  WKPY CIG  + L D+ L +S L     E+V+ PE  E  K        E+  A     SL   S+K  ++  +LK E+ KSE +   +  G+ +F+ L++E EK+     + +Q + ++   E RP  E      D D E  + +             D R+ SR        ++    RP+TP+++NI    G+    P            S  S + D+ EQ    ES F+QL +L WLLEAM+ E+   M  I+ SW ++       S ++++    +K  W+  ++    + +HR  I    + ++T+I            S+ ++ S      +  +  S   S+ASS  +SV+E
Sbjct:   32 SHVGVKMRARTAQLYDPSEPTRDQVRHQNYSRRYRQLSSQGFRTPAWKPYECIGEEVCLDDRQLILSTLGQKEPERVQAPE-AEDGK-------AEDKVAKHVNPSLFIASRKAVKV--DLKAELQKSEGIRKRMNIGKSYFEYLQQEKEKRVAEKIRLDQLERLRARTEARPPPETEESTDDEDKEDFAAVNSVHLECFRSAAPDPRQSSRSRQDCRRKKRTRPPRPYTPLHANI----GEHPDEP------------SWCSTHEDAGEQPEFLESLFKQLCALHWLLEAMLQEDPTLMNPISSSWSLKNIGGTWVSARDKERSTAVKKEWDSLVSG---RGRHR--IGGLAARRSTRIWSSMRTDLTNRSSARSRASTAGSGADGGLGESRATSRASS--VSVEE 405          
BLAST of Coiled-coil domain containing 60 vs. Ensembl Nematostella
Match: EDO45458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSQ3])

HSP 1 Score: 60.077 bits (144), Expect = 2.620e-9
Identity = 39/118 (33.05%), Postives = 57/118 (48.31%), Query Frame = 2
Query: 1604 TYQNFFKILDQSK-NKIIYTN---------------WFLSLEENLKTNFENKRIEN-ALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWF 1906
            T+ N +K LDQ + N +I  N               W+  L +NL    +N    N  L KI  +      K +  +   VL+ L  WEI  PDISA+++FV + VV +SE +Y+ WF
Sbjct:  705 TFNNMYKALDQMRSNSVIPDNETSEEMRQRVSEECKWYKDLNDNLPPEVKNDMYCNLVLNKIASYGSLEGRKASSSQFLKVLSTLRMWEICAPDISAALEFVREKVVGMSEIEYEDWF 822          

HSP 2 Score: 53.9138 bits (128), Expect = 1.914e-7
Identity = 53/190 (27.89%), Postives = 97/190 (51.05%), Query Frame = 2
Query:   80 SNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELDKCLEISDLSDH-REQVKKPED---VEVNKDKFVQIDT-ENNRASMSAQS-------LRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTP--EIRPVIEDSD 607
            S+  +K+ AR+       +PTR +V + NY RR++Q+   G+ S ++KPY  +G     DK L +S L     EQV + +D      +  +  +I T +N+R+   +++        +  + K E +N +++ ++NK   +   VR G   + ++K E EKK    D EEQ+  ++    E++P   DS+
Sbjct:   20 SHQGLKITARSARVYTCEVPTRREVARENYERRKHQMTKCGYRSVIYKPYQSVGEVFLNDKKLILSALGQQASEQVTQFQDNSSSSSSDSEDDEIRTFKNSRSPTKSKADHQKPVVPQATAYKPEVIN-DIRVQVNKGRKMVNAVRLGFGLYRLVKDEQEKKQAKAD-EEQRKKEEAARREMKPPTSDSE 207          
BLAST of Coiled-coil domain containing 60 vs. Planmine SMEST
Match: SMESG000038986.1 (SMESG000038986.1)

HSP 1 Score: 1226.85 bits (3173), Expect = 0.000e+0
Identity = 610/611 (99.84%), Postives = 610/611 (99.84%), Query Frame = 2
Query:   77 MSNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELDKCLEISDLSDHREQVKKPEDVEVNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMSDNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQKEIKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSKTKETNEININTSIQLSKASSQEISVKEXXXXXXXXXXXXXPKSTVGLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGRFPVDRKRISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTNFENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWFR 1909
            MSNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELDKCLEISDLSDHREQVKKPEDVEVNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMSDNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQKEIKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSKTKETNEININTSIQLSKASSQEISVKEISSSHRGN SSSRPKSTVGLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGRFPVDRKRISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTNFENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWFR
Sbjct:    1 MSNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKPYICIGHPLELDKCLEISDLSDHREQVKKPEDVEVNKDKFVQIDTENNRASMSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEKKYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMSDNREFSRPSTGINRKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIEQESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQKEIKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSKTKETNEININTSIQLSKASSQEISVKEISSSHRGNSSSSRPKSTVGLQRRRMIAQVRSVCEEIEKDNNDYEYKKNLHLMRIGRFPVDRKRISESTKLQSQDQFSDKLQHMLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQMLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTNFENKRIENALEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVSVSEEDYQIWFR 611          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 60 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC602.960e-1121.51coiled-coil domain containing 60 [Source:HGNC Symb... [more]
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrps99.753e-2222.80mitochondrial ribosomal protein S9 [Source:Xenbase... [more]
mrps96.418e-1121.66mitochondrial ribosomal protein S9 [Source:Xenbase... [more]
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc603.333e-623.91coiled-coil domain containing 60 [Source:MGI Symbo... [more]
back to top
BLAST of Coiled-coil domain containing 60 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8IWA6|CCD60_HUMAN1.422e-1021.51Coiled-coil domain-containing protein 60 OS=Homo s... [more]
back to top
BLAST of Coiled-coil domain containing 60 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8I1A57.333e-2122.02Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A267DIW08.404e-2027.83Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
W5M5U28.632e-2025.67Coiled-coil domain containing 60 OS=Lepisosteus oc... [more]
V4B7788.981e-2027.62Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1I8JBM81.682e-1928.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO454582.620e-933.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain containing 60 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 60 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000038986.10.000e+099.84SMESG000038986.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024952 ID=SMED30024952|Name=Coiled-coil domain containing 60|organism=Schmidtea mediterranea sexual|type=transcript|length=2026bp
TTCAATTTTGAGAATAAAGTTTTATTGTAAATCACAATAATAAATTTTTA
TCTGATTATTTTTCTAAATTGCGGCAATGTCAAATGCAAGTGTAAAAGTT
CAGGCTCGAAATGAATATTTTATAAATCCAATAATACCTACAAGAGAAGA
TGTTCGAAAAGCGAATTACACGAGAAGAGAAAATCAGTTAAATTTCGAAG
GGTTCTATTCAAAATTATGGAAACCTTATATCTGTATCGGTCATCCACTT
GAATTAGATAAATGTTTAGAAATATCTGATTTATCTGATCACAGAGAACA
GGTGAAAAAACCAGAAGATGTCGAAGTTAATAAAGACAAATTTGTTCAGA
TTGATACTGAAAATAATCGAGCTTCCATGAGTGCTCAAAGTTTAAGAAAG
TGTTCACAAAAAATGGAACAGCTAAATAAAAATTTGAAGAAAGAAATAAA
TAAATCAGAAATGCTCACTTTCAACGTTCGAACGGGACAACATTTCTTTG
ATATTCTAAAAAAAGAAAATGAAAAAAAATATATGACGGATGACAAAGAA
GAGCAACAAATAATAAAAGACACACCAGAAATTCGACCAGTAATTGAAGA
TAGTGACAGTGAATCTGGATCTGAGTTACAGATGTCTGACAATAGAGAAT
TCTCTAGACCTTCAACTGGAATTAACCGAAAAAAATTAAACATTCGACCA
TTTACACCGATATATAGTAACATAAGTAATTTGACTGGCAAAACCTTTAT
TAGACCTAAGAGTGAATATGGATACAGGGAAGGTGGAACTTCGTCACAAA
TGAGTTTAAATCCAGATAGCATAGAGCAAGAAAGTTTTTTCCGCCAGTTA
ACATCATTACAATGGTTATTAGAAGCGATGATTAATGAAAACGTTGAAAA
CATGCCTAGGATTACTCTTTCGTGGATCGTAAGAAAAGAAAATAATAACT
TAACCTCATTAAAAAATCAAAAAGAAATAAAAGTTGCTTGGGAGAAATAC
ATTACGAAATCAGACCAACAGAGCAAACACCGCGCTACAATTAGTGCTGC
AGTCTCAACACAAGCTACGAAGATCTCGAGCACAAATCAGCTGTCTAAAA
CAAAAGAAACAAATGAAATTAATATTAACACTTCAATACAATTATCAAAG
GCGAGCTCCCAGGAAATATCTGTCAAAGAAATTTCATCTAGTCATCGAGG
AAATATTAGTTCTAGTCGTCCAAAATCTACAGTCGGCCTTCAAAGAAGAC
GAATGATTGCACAAGTTAGGTCCGTTTGTGAAGAAATCGAAAAAGATAAC
AATGATTATGAATATAAGAAAAACCTACATCTGATGAGAATCGGGAGGTT
TCCAGTTGACAGGAAAAGGATATCAGAATCAACTAAACTTCAGTCACAAG
ACCAATTCAGTGATAAATTGCAACACATGTTGTATAAACATCATGACCAG
TCCACTCAAATGATTGACGACAAGTTGAATAATTTACGGGACAATGTCCG
CAACATGGCAGAATACAAATTGATCATTTGTTCAAACAAATACAAAGACA
TCCAAACTAAGGGAGAGTTCCATCAAATGCTCAAGAATTTCAGAGGCAAA
AACACTTATCAGAACTTCTTTAAAATTCTTGATCAGTCTAAAAATAAAAT
AATTTACACAAATTGGTTTTTATCACTGGAAGAAAATTTAAAAACTAATT
TTGAAAATAAAAGAATTGAAAATGCTTTGGAAAAAATTCGACCCTTCGCT
CTAAACACAATTACGAAGCTAAACAGAAAGAGATTATTCTCGGTATTAAC
ATATCTGTCAGACTGGGAGATCAGACATCCGGATATAAGTGCAAGCATAA
AGTTTGTCACTGACCACGTTGTTTCTGTTTCAGAGGAAGACTATCAAATA
TGGTTTCGACAAAATTTTAATTAATAATATTTCTTTCAGTACAGTCCAAT
TATATTTATCAATAGCTATTTCATTTTTCAAATCATGCTATATATTAGTT
CAACTATATTCCAAACTCGTTTTTGA
back to top

protein sequence of SMED30024952-orf-1

>SMED30024952-orf-1 ID=SMED30024952-orf-1|Name=SMED30024952-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=616bp
MSNASVKVQARNEYFINPIIPTREDVRKANYTRRENQLNFEGFYSKLWKP
YICIGHPLELDKCLEISDLSDHREQVKKPEDVEVNKDKFVQIDTENNRAS
MSAQSLRKCSQKMEQLNKNLKKEINKSEMLTFNVRTGQHFFDILKKENEK
KYMTDDKEEQQIIKDTPEIRPVIEDSDSESGSELQMSDNREFSRPSTGIN
RKKLNIRPFTPIYSNISNLTGKTFIRPKSEYGYREGGTSSQMSLNPDSIE
QESFFRQLTSLQWLLEAMINENVENMPRITLSWIVRKENNNLTSLKNQKE
IKVAWEKYITKSDQQSKHRATISAAVSTQATKISSTNQLSKTKETNEINI
NTSIQLSKASSQEISVKEISSSHRGNISSSRPKSTVGLQRRRMIAQVRSV
CEEIEKDNNDYEYKKNLHLMRIGRFPVDRKRISESTKLQSQDQFSDKLQH
MLYKHHDQSTQMIDDKLNNLRDNVRNMAEYKLIICSNKYKDIQTKGEFHQ
MLKNFRGKNTYQNFFKILDQSKNKIIYTNWFLSLEENLKTNFENKRIENA
LEKIRPFALNTITKLNRKRLFSVLTYLSDWEIRHPDISASIKFVTDHVVS
VSEEDYQIWFRQNFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR031526DUF4698
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 103..130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..338
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 178..199
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..386
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 171..199
IPR031526Protein of unknown function DUF4698PFAMPF15769DUF4698coord: 243..612
e-value: 9.6E-21
score: 74.4
IPR031526Protein of unknown function DUF4698PANTHERPTHR34754FAMILY NOT NAMEDcoord: 3..217
coord: 446..614
coord: 246..428