Histone-lysine N-methyltransferase 2C

Overview
NameHistone-lysine N-methyltransferase 2C
Smed IDSMED30024921
Length (bp)8321
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase 2C (SMED30024921) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase 2C (SMED30024921) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase 2C (SMED30024921) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase 2C (SMED30024921) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024921

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30024921SMESG000000381.1 SMESG000040592.1 SmedASXL_017991SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30024921SMESG000040592.1 dd_Smed_v4_5165_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024921SMESG000040592.1 Contig47362uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024921SMESG000040592.1 Contig47362newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30024921SMESG000040592.1 LPTsmed_ncbi_20200123PMID:30194301
Mihaylova et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30024921SMESG000040592.1 LPTsmed_ncbi_20200123PMID:30194301
Mihaylova et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024921SMESG000040592.1 LPTsmed_ncbi_20200123PMID:30194301
Mihaylova et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024921SMESG000040592.1 dd_Smed_v4_5165_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 256.529 bits (654), Expect = 2.958e-67
Identity = 185/526 (35.17%), Postives = 274/526 (52.09%), Query Frame = 2
Query: 2267 NVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRAR--------STRVSQVKKSALAAVNNQ------NFDQNNPQYTIENFTA-----KQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKS 3781
            ++  +K++EE   H +TVVL  + D F L QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQNNYT CAPCAS + CPVCY NY + DL+L C  C+R  HA C +LNTE E+E + +  G+ C +CR              ++ A++   V  +   + S+ + ++    E                     DP K +  D V L+ESG+  ++ ++  + PRR ++  K   K  +Q+++         +  T P + ++ S        D +   S EGE+   D KS           +S P   A +     +  +  + K    R R+    GIGGF  R         T+ S ++K +  +++ Q       + +  P   ++   +     ++ ++R  K+K++++E FP YL +AF G  LL    +TS++S
Sbjct:  928 DISSNKDDEENSMH-NTVVLFSSSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVAD-IGFDCSMCRP-------------YMPASN---VPSSDCCESSLVAQIVTKVKEL--------------------DPPKTYTQDGVCLTESGMTQLQ-SLTVTVPRRKRSKPKLKLKIINQNSVA--------VLQTPPDIQSEHS-------RDGEMDDSREGELMDCDGKS-----------ESSPEREAVDDETKGVEGTDGVKK----RKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDDGWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLL----DTSRQS 1379          

HSP 2 Score: 235.343 bits (599), Expect = 8.702e-61
Identity = 145/447 (32.44%), Postives = 212/447 (47.43%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYI--W------SKDVNSNKRSDRIKLKDCQEYCCLDTNK-RLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +    P +I  W       KD++ N      K+++          K R  +  I+      C++       D++     L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF    L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG         T +S+Q     WH+N  +CD C Q +    ++C  C + +   L   K+          C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRIT----PGFILPWRNQPSNKKDIDDNSNGTYEKMQNSAPRKQRGQRKERSPQQNIVS-----CVSVSTQTASDDQA--GKLWDELSLVGLPDAIDIQA------------LFDSTGTC----------------------------WAHHRCVEWSLGVCQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECG---------TRSSSQ-----WHHNCLICDNCYQQQ---DNLCPFCGKCYHPEL--QKDM-------LHCNMCKRWVHLECD 497          

HSP 3 Score: 115.161 bits (287), Expect = 2.036e-24
Identity = 57/158 (36.08%), Postives = 78/158 (49.37%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L+ + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G    W NNYT C  CA       S C VC R +R
Sbjct:  955 LNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGA-----------TSAGLRCEWQNNYTQCAPCASL-----SSCPVCYRNYR 1095          

HSP 4 Score: 102.449 bits (254), Expect = 1.388e-20
Identity = 66/193 (34.20%), Postives = 94/193 (48.70%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCD-----HLNTEAELEFIFEGGGYHCILCRDKGIDI 2917
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD      L+T+ + E+I       C+ C+  G ++
Sbjct:  344 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---SSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYI-------CMYCKHLGAEM 524          

HSP 5 Score: 70.0922 bits (170), Expect = 9.109e-11
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1631 NAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1707          

HSP 6 Score: 56.225 bits (134), Expect = 1.480e-6
Identity = 36/127 (28.35%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  740 FYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSH----TQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHS 1108
             +VH +C  WS   ++  +   G   NVE  +R GL   C FC + GAT  C  +  C + +H+ CA  A C   F    + CP H      E +LS       +  ++  V  + S    G+  H+
Sbjct: 4426 LWVHLNCALWS---TEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCH-RFRCTNIYHFTCAIKAQCM-FFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHT 4547          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 256.529 bits (654), Expect = 2.958e-67
Identity = 185/526 (35.17%), Postives = 274/526 (52.09%), Query Frame = 2
Query: 2267 NVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRAR--------STRVSQVKKSALAAVNNQ------NFDQNNPQYTIENFTA-----KQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKS 3781
            ++  +K++EE   H +TVVL  + D F L QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQNNYT CAPCAS + CPVCY NY + DL+L C  C+R  HA C +LNTE E+E + +  G+ C +CR              ++ A++   V  +   + S+ + ++    E                     DP K +  D V L+ESG+  ++ ++  + PRR ++  K   K  +Q+++         +  T P + ++ S        D +   S EGE+   D KS           +S P   A +     +  +  + K    R R+    GIGGF  R         T+ S ++K +  +++ Q       + +  P   ++   +     ++ ++R  K+K++++E FP YL +AF G  LL    +TS++S
Sbjct:  928 DISSNKDDEENSMH-NTVVLFSSSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVAD-IGFDCSMCRP-------------YMPASN---VPSSDCCESSLVAQIVTKVKEL--------------------DPPKTYTQDGVCLTESGMTQLQ-SLTVTVPRRKRSKPKLKLKIINQNSVA--------VLQTPPDIQSEHS-------RDGEMDDSREGELMDCDGKS-----------ESSPEREAVDDETKGVEGTDGVKK----RKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDDGWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLL----DTSRQS 1379          

HSP 2 Score: 235.343 bits (599), Expect = 8.702e-61
Identity = 145/447 (32.44%), Postives = 212/447 (47.43%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYI--W------SKDVNSNKRSDRIKLKDCQEYCCLDTNK-RLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +    P +I  W       KD++ N      K+++          K R  +  I+      C++       D++     L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF    L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG         T +S+Q     WH+N  +CD C Q +    ++C  C + +   L   K+          C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRIT----PGFILPWRNQPSNKKDIDDNSNGTYEKMQNSAPRKQRGQRKERSPQQNIVS-----CVSVSTQTASDDQA--GKLWDELSLVGLPDAIDIQA------------LFDSTGTC----------------------------WAHHRCVEWSLGVCQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECG---------TRSSSQ-----WHHNCLICDNCYQQQ---DNLCPFCGKCYHPEL--QKDM-------LHCNMCKRWVHLECD 497          

HSP 3 Score: 115.161 bits (287), Expect = 2.036e-24
Identity = 57/158 (36.08%), Postives = 78/158 (49.37%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L+ + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G    W NNYT C  CA       S C VC R +R
Sbjct:  955 LNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGA-----------TSAGLRCEWQNNYTQCAPCASL-----SSCPVCYRNYR 1095          

HSP 4 Score: 102.449 bits (254), Expect = 1.388e-20
Identity = 66/193 (34.20%), Postives = 94/193 (48.70%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCD-----HLNTEAELEFIFEGGGYHCILCRDKGIDI 2917
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD      L+T+ + E+I       C+ C+  G ++
Sbjct:  344 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---SSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYI-------CMYCKHLGAEM 524          

HSP 5 Score: 70.0922 bits (170), Expect = 9.109e-11
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1631 NAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1707          

HSP 6 Score: 56.225 bits (134), Expect = 1.480e-6
Identity = 36/127 (28.35%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  740 FYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSH----TQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHS 1108
             +VH +C  WS   ++  +   G   NVE  +R GL   C FC + GAT  C  +  C + +H+ CA  A C   F    + CP H      E +LS       +  ++  V  + S    G+  H+
Sbjct: 4426 LWVHLNCALWS---TEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCH-RFRCTNIYHFTCAIKAQCM-FFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHT 4547          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 225.713 bits (574), Expect = 6.045e-60
Identity = 142/447 (31.77%), Postives = 209/447 (46.76%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYI--W------SKDVNSNKRSDRIKLKDCQEYCCLDTNK-RLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +    P +I  W       KD++ N      K+++          K R  +  I+      C++       D++     L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF    L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG                S+ +WH+N  +CD C Q +    ++C  C + +   L         +     C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRIT----PGFILPWRNQPSNKKDIDDNSNGTYEKMQNSAPRKQRGQRKERSPQQNIVS-----CVSVSTQTASDDQAG--KLWDELSLVGLPDAIDIQA------------LFDSTGTC----------------------------WAHHRCVEWSLGVCQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTR--------------SSSQWHHNCLICDNCYQQQ---DNLCPFCGKCYHPEL---------QKDMLHCNMCKRWVHLECD 497          

HSP 2 Score: 98.5969 bits (244), Expect = 1.068e-19
Identity = 72/232 (31.03%), Postives = 106/232 (45.69%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCD-----HLNTEAELEFIFEGGGYHCILCRDKGIDIG----AGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGN 3022
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD      L+T+ + E+I       C+ C+  G ++         ++  L   + + +      D+ VFS    N
Sbjct:  344 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---SSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYI-------CMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAAN 563          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Human
Match: KMT2D (lysine methyltransferase 2D [Source:HGNC Symbol;Acc:HGNC:7133])

HSP 1 Score: 211.846 bits (538), Expect = 1.082e-53
Identity = 116/294 (39.46%), Postives = 157/294 (53.40%), Query Frame = 2
Query:  599 SSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGA-SQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCER 1477
            S  G+   N ++L     S     E L  AHL         +   SC + HH C  WS G   Q   +L G    V+  + +G++Q CS C R GA+I CRS   C   +H+PCA A+G F    + QL CP H++ A    E   C++CE  G + DL  CTSCG HYH  CL+    L+   RAGWQC ECK C  C +  ++ KMLVC+ CDKG+HT+CL+PPM  +P + WKC +CRVC  CG          G++    N  W  NY+LC RC + +  G +I +V E+
Sbjct:   98 SPGGSPGPNEAVLPSEDLSQIGFPEGLTPAHL--------GEPGGSC-WAHHWCAAWSAGVWGQEGPELCG----VDKAIFSGISQRCSHCTRLGASIPCRS-PGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAYLEE-ARCAVCEGPGELCDLFFCTSCGHHYHGACLD--TALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKACRVCRACG---------AGSAELNPNSEWFENYSLCHRCHKAQ-GGQTIRSVAEQ 364          

HSP 2 Score: 200.675 bits (509), Expect = 2.977e-50
Identity = 109/197 (55.33%), Postives = 134/197 (68.02%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG   +  LL C QC QCYH YC   SK+TKV++ KGWRC++C VCE CGQA++   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C  CG   PG +  WQN+YT C PCAS   CP+C+  Y + DL++ C  CER  HA C+ L TE ++E   +  G+ C+ C+
Sbjct: 1363 TVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVN-SKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAAD-EGFDCVSCQ 1557          

HSP 3 Score: 102.449 bits (254), Expect = 1.346e-20
Identity = 52/147 (35.37%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G +  W N+YT C  CA
Sbjct: 1368 SNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNS-KITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGA-----------ASPGFHCEWQNSYTHCGPCA 1502          

HSP 4 Score: 86.2705 bits (212), Expect = 9.889e-16
Identity = 53/133 (39.85%), Postives = 71/133 (53.38%), Query Frame = 2
Query: 2351 LEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFC--GKRDPGPNGTWQNNYTTCAPCASKAQ 2743
            LE+  C  C   G    L  C  CG  YH  C + +   +     GW+C +C VC+ C +  N+  +L+C+ CD  YHTFCL PP+ E+P  SWKC+ C VC+ C  G  +  PN  W  NY+ C  C  KAQ
Sbjct:  224 LEEARCAVCEGPGELCDLFFCTSCGHHYHGACLDTALTARK--RAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRC-HKAQ 353          

HSP 5 Score: 63.1586 bits (152), Expect = 1.097e-8
Identity = 26/70 (37.14%), Postives = 46/70 (65.71%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            +W++DE LG  STI+PVL+AN    N++    D  SR ++I KLWRK+ + ++  ++ K++ N++  + N
Sbjct: 2005 RWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRIN 2074          

HSP 6 Score: 53.9138 bits (128), Expect = 6.029e-6
Identity = 38/129 (29.46%), Postives = 56/129 (43.41%), Query Frame = 2
Query:  731 DSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQ----EADLSNEHCICSLCERKGGVNDLISCTSCGQHYH 1105
            D   +VH +C  WS   ++  +   G   NVE  +  GL   CS C R GAT SC ++  C + +H+ CA  A C   F    + CP H      E +LS+      +   +  V  + S    G+  H
Sbjct: 5053 DLDLWVHLNCALWS---TEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSC-NRMRCPNVYHFACAIRAKCM-FFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLH 5176          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 153.68 bits (387), Expect = 4.386e-41
Identity = 86/147 (58.50%), Postives = 104/147 (70.75%), Query Frame = 2
Query: 2267 NVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQ 2701
            ++  +K++EE   H +TVVL  + D F L QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQ
Sbjct:   84 DISSNKDDEENSMH-NTVVLFSSSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQ 228          

HSP 2 Score: 93.5893 bits (231), Expect = 3.857e-20
Identity = 43/115 (37.39%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCG 1336
            S + +  L+ + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG
Sbjct:  104 SSSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIK-ITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCG 217          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 142.895 bits (359), Expect = 2.576e-33
Identity = 75/191 (39.27%), Postives = 115/191 (60.21%), Query Frame = 2
Query: 2294 EKDEHPSTVVLCRADDLFVLEQDICVSCGSFGI--DTPLLCCVQCGQCYHSYCAEI-SKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELE 2857
            ++ E+  T ++CR +D F+ +  +C+ CGS G   +  ++ C  C Q YH+YC  +  KL   ++ +GWRCLDCTVCEGCG   +E  LLLCD+CD+SYH +C+ P L+++P+G W+CQ C  C+ C  +    +G    +   C PCAS  +CP C  NY   + ++ C  C +  H  C+ L T+ +LE
Sbjct:  404 DEPEYIRTAIVCRVNDEFLQKACMCLVCGSIGKGPEGSMVACSNCAQTYHTYCVTLHDKLNSAVVGRGWRCLDCTVCEGCGTGGDEANLLLCDECDVSYHIYCMKPLLDKIPQGPWRCQWCSRCRRCNHK--AASGNDLTSQGLCFPCASLRKCPRCERNYQLNEKLIRCSQCSKWQHGACEGLYTDEQLE 592          

HSP 2 Score: 86.6557 bits (213), Expect = 2.874e-16
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query: 1028 CICSLCER--KGGVNDLISCTSCGQHYHSNCLEPPLIL-SPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKW 1528
            C+C +C    KG    +++C++C Q YH+ C+     L S  V  GW+C +C  C  C    DE  +L+CD CD  +H YC++P +  IP+  W+C  C  C  C +    G  LT   +QG          LC  CA  ++     C  CER ++ +    +    SKW
Sbjct:  426 CMCLVCGSIGKGPEGSMVACSNCAQTYHTYCVTLHDKLNSAVVGRGWRCLDCTVCEGCGTGGDEANLLLCDECDVSYHIYCMKPLLDKIPQGPWRCQWCSRCRRCNHKAASGNDLT---SQG----------LCFPCASLRK-----CPRCERNYQLNEKLIRCSQCSKW 577          

HSP 3 Score: 58.5362 bits (140), Expect = 8.982e-8
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKS 6139
            +W+EDE  G ++T A VL++N  H  +R Q  +   R ++IQKLWR L  E R ++VN++R N++
Sbjct:  936 RWEEDEPNGLQATTAAVLYSNEKHGYLRQQFPNWVDRVKQIQKLWRTLNHEVRLDYVNRARDNRT 1000          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Celegans
Match: dpff-1 (Zinc finger protein dpff-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09477])

HSP 1 Score: 82.8037 bits (203), Expect = 5.431e-16
Identity = 36/86 (41.86%), Postives = 55/86 (63.95%), Query Frame = 2
Query: 1067 DLISCTSCGQHYHSNCLEPPLILSPTV-RAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRV 1321
            DL+SC  CG+  H +CL     ++  + R+GWQC ECK+C +C  S+++ K+L CD CD+G+H YCL P +   P + + C  C+V
Sbjct:  275 DLVSCHDCGRSGHPSCLNFNQNVTKIIKRSGWQCLECKSCTICGTSENDDKLLFCDDCDRGYHLYCLTPALEKAPDDEYSCRLCQV 360          

HSP 2 Score: 56.9954 bits (136), Expect = 1.309e-7
Identity = 36/85 (42.35%), Postives = 50/85 (58.82%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISK-LTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVV 2653
            L+ C  CG+  H  C   ++ +TK+I   GW+CL+C  C  CG + N+D LL CDDCD  YH +CL P L + P   + C+ C V
Sbjct:  276 LVSCHDCGRSGHPSCLNFNQNVTKIIKRSGWQCLECKSCTICGTSENDDKLLFCDDCDRGYHLYCLTPALEKAPDDEYSCRLCQV 360          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Celegans
Match: phf-10 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2A949])

HSP 1 Score: 78.5666 bits (192), Expect = 2.298e-14
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 2
Query: 1034 CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTG 1369
            C  CE+ GG  ++I C +C   YH  C+E P  ++  V+   W C +C+ C +C++ + E +++ CD CD+GFHTYC+   +  +P+  W CD+     +  ++ +   A  G
Sbjct:  335 CDSCEKTGG--EMICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSICNKPEKEDEIVFCDRCDRGFHTYCVG--LKKLPQGTWICDTYCAIENMKFNRRASAAAVG 443          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Celegans
Match: phf-10 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2A949])

HSP 1 Score: 78.5666 bits (192), Expect = 2.298e-14
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 2
Query: 1034 CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTG 1369
            C  CE+ GG  ++I C +C   YH  C+E P  ++  V+   W C +C+ C +C++ + E +++ CD CD+GFHTYC+   +  +P+  W CD+     +  ++ +   A  G
Sbjct:  335 CDSCEKTGG--EMICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSICNKPEKEDEIVFCDRCDRGFHTYCVG--LKKLPQGTWICDTYCAIENMKFNRRASAAAVG 443          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Celegans
Match: phf-10 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2A949])

HSP 1 Score: 68.5514 bits (166), Expect = 2.415e-13
Identity = 29/82 (35.37%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1070 LISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDS 1312
            +I C +C   YH  C+E P  ++  V+   W C +C+ C +C++ + E +++ CD CD+GFHTYC+   +  +P+  W CD+
Sbjct:    1 MICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSICNKPEKEDEIVFCDRCDRGFHTYCVG--LKKLPQGTWICDT 80          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Fly
Match: Lpt (gene:FBgn0263667 transcript:FBtr0343298)

HSP 1 Score: 208.764 bits (530), Expect = 2.072e-53
Identity = 114/283 (40.28%), Postives = 160/283 (56.54%), Query Frame = 2
Query:  740 FYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADL--SNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVC-SESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
             YVH  C+ WS   SQ SD  DG +    +     L Q C+FC R+GA+I+C  K NC+   H+PCAAAAGC     SF ++C  H  +  +  S+ +  C  C   G ++ LI C++CG H+HS C+   L   P  R+GW CA C  C +C  +  ++ K + C+ C K +H  CL+P ++AIPK GWKC+ CRVC DCG S  PG         GS+ RWH++YT+CD C Q + +G S C +C++A+R         ++S     KCS C+K VH  CD
Sbjct:  111 VYVHRMCIMWSLRKSQISDA-DGAY--FATHFAEFLEQKCNFCGRYGASINC--KMNCRQVHHWPCAAAAGCLLILESFTVFCTEHLSQVPVICSDNNVECLSCSSLGDLSKLIMCSTCGDHFHSTCIG--LANLPDTRSGWNCARCTKCQICRQQDSNDTKYVKCEQCQKTYHASCLRPVISAIPKYGWKCNRCRVCTDCG-SRTPG--------GGSSSRWHSHYTICDSCYQQRNKGFS-CPICQKAYR---------AASHKEMVKCSWCNKFVHSTCD 367          

HSP 2 Score: 189.119 bits (479), Expect = 2.054e-47
Identity = 119/325 (36.62%), Postives = 173/325 (53.23%), Query Frame = 2
Query: 2273 CESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGI--DTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR-----------------DKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRR 3190
            C S++ E        ++LC A D F+  QDICV CGS GI  D+ ++ C QCGQCYH YCA + K ++ I++KGWRCLDCTVCEGCG+  +E  LLLCD+CDISYH +C++PPL  VP G+WKC  C +CQ CG+     +    +N   C  C S++ CPVC  +Y++G++++ C+ CE  +H  CD +N +  ++  ++   Y C  CR                 D       G K  +H+ A+ G S      A+++    L G                   D P S  P    ++D V LSESGL  I++   + + +R
Sbjct:  500 CLSRSMETDLTSDKKLLLCSARDKFIQAQDICVMCGSLGIESDSVMITCAQCGQCYHPYCAGV-KPSRGILQKGWRCLDCTVCEGCGKKNDEARLLLCDECDISYHIYCVNPPLETVPTGNWKCSFCTLCQKCGRNPTEKSEFGDSNMLECPSCTSQSSCPVCKVSYSNGEMIIQCEHCELWAHFHCDSVNAQLTIDH-YDNNVYKCFKCRCSTRSTNSLADAKFGNEDSLAITPQGSKPFVHITASSGPSFDSKSGAERN-HPTLSG-------------------DMPESA-PEALHWIDGVCLSESGLGMIKSLSTEIKRKR 801          

HSP 3 Score: 98.5969 bits (244), Expect = 7.287e-20
Identity = 61/172 (35.47%), Postives = 85/172 (49.42%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQA-TNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGT--WQNNYTTCAPCASKA----QCPVCYNNYNDG--DLMLICDVCERSSHATCDHLNTEAEL 2854
            C+SC S G  + L+ C  CG  +HS C  ++ L       GW C  CT C+ C Q  +N+   + C+ C  +YH  CL P ++ +PK  WKC  C VC  CG R PG   +  W ++YT C  C  +      CP+C   Y       M+ C  C +  H+TCD    EA+L
Sbjct:  206 CLSCSSLGDLSKLIMCSTCGDHFHSTCIGLANLPDT--RSGWNCARCTKCQICRQQDSNDTKYVKCEQCQKTYHASCLRPVISAIPKYGWKCNRCRVCTDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAASHKEMVKCSWCNKFVHSTCDE---EADL 372          

HSP 4 Score: 89.7373 bits (221), Expect = 4.144e-17
Identity = 40/106 (37.74%), Postives = 60/106 (56.60%), Query Frame = 2
Query: 1031 ICSLCERKGGVND--LISCTSCGQHYHSNC--LEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCG 1336
            IC +C   G  +D  +I+C  CGQ YH  C  ++P   +   ++ GW+C +C  C  C +  DE ++L+CD CD  +H YC+ PP+  +P   WKC  C +C  CG
Sbjct:  530 ICVMCGSLGIESDSVMITCAQCGQCYHPYCAGVKPSRGI---LQKGWRCLDCTVCEGCGKKNDEARLLLCDECDISYHIYCVNPPLETVPTGNWKCSFCTLCQKCG 632          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Fly
Match: Lpt (gene:FBgn0263667 transcript:FBtr0072134)

HSP 1 Score: 208.764 bits (530), Expect = 2.118e-53
Identity = 114/283 (40.28%), Postives = 160/283 (56.54%), Query Frame = 2
Query:  740 FYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADL--SNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVC-SESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
             YVH  C+ WS   SQ SD  DG +    +     L Q C+FC R+GA+I+C  K NC+   H+PCAAAAGC     SF ++C  H  +  +  S+ +  C  C   G ++ LI C++CG H+HS C+   L   P  R+GW CA C  C +C  +  ++ K + C+ C K +H  CL+P ++AIPK GWKC+ CRVC DCG S  PG         GS+ RWH++YT+CD C Q + +G S C +C++A+R         ++S     KCS C+K VH  CD
Sbjct:  111 VYVHRMCIMWSLRKSQISDA-DGAY--FATHFAEFLEQKCNFCGRYGASINC--KMNCRQVHHWPCAAAAGCLLILESFTVFCTEHLSQVPVICSDNNVECLSCSSLGDLSKLIMCSTCGDHFHSTCIG--LANLPDTRSGWNCARCTKCQICRQQDSNDTKYVKCEQCQKTYHASCLRPVISAIPKYGWKCNRCRVCTDCG-SRTPG--------GGSSSRWHSHYTICDSCYQQRNKGFS-CPICQKAYR---------AASHKEMVKCSWCNKFVHSTCD 367          

HSP 2 Score: 189.119 bits (479), Expect = 1.976e-47
Identity = 119/325 (36.62%), Postives = 173/325 (53.23%), Query Frame = 2
Query: 2273 CESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGI--DTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR-----------------DKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRR 3190
            C S++ E        ++LC A D F+  QDICV CGS GI  D+ ++ C QCGQCYH YCA + K ++ I++KGWRCLDCTVCEGCG+  +E  LLLCD+CDISYH +C++PPL  VP G+WKC  C +CQ CG+     +    +N   C  C S++ CPVC  +Y++G++++ C+ CE  +H  CD +N +  ++  ++   Y C  CR                 D       G K  +H+ A+ G S      A+++    L G                   D P S  P    ++D V LSESGL  I++   + + +R
Sbjct:  500 CLSRSMETDLTSDKKLLLCSARDKFIQAQDICVMCGSLGIESDSVMITCAQCGQCYHPYCAGV-KPSRGILQKGWRCLDCTVCEGCGKKNDEARLLLCDECDISYHIYCVNPPLETVPTGNWKCSFCTLCQKCGRNPTEKSEFGDSNMLECPSCTSQSSCPVCKVSYSNGEMIIQCEHCELWAHFHCDSVNAQLTIDH-YDNNVYKCFKCRCSTRSTNSLADAKFGNEDSLAITPQGSKPFVHITASSGPSFDSKSGAERN-HPTLSG-------------------DMPESA-PEALHWIDGVCLSESGLGMIKSLSTEIKRKR 801          

HSP 3 Score: 98.5969 bits (244), Expect = 6.994e-20
Identity = 61/172 (35.47%), Postives = 85/172 (49.42%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQA-TNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGT--WQNNYTTCAPCASKA----QCPVCYNNYNDGD--LMLICDVCERSSHATCDHLNTEAEL 2854
            C+SC S G  + L+ C  CG  +HS C  ++ L       GW C  CT C+ C Q  +N+   + C+ C  +YH  CL P ++ +PK  WKC  C VC  CG R PG   +  W ++YT C  C  +      CP+C   Y       M+ C  C +  H+TCD    EA+L
Sbjct:  206 CLSCSSLGDLSKLIMCSTCGDHFHSTCIGLANLPDT--RSGWNCARCTKCQICRQQDSNDTKYVKCEQCQKTYHASCLRPVISAIPKYGWKCNRCRVCTDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAASHKEMVKCSWCNKFVHSTCDE---EADL 372          

HSP 4 Score: 89.7373 bits (221), Expect = 4.218e-17
Identity = 40/106 (37.74%), Postives = 60/106 (56.60%), Query Frame = 2
Query: 1031 ICSLCERKGGVND--LISCTSCGQHYHSNC--LEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCG 1336
            IC +C   G  +D  +I+C  CGQ YH  C  ++P   +   ++ GW+C +C  C  C +  DE ++L+CD CD  +H YC+ PP+  +P   WKC  C +C  CG
Sbjct:  530 ICVMCGSLGIESDSVMITCAQCGQCYHPYCAGVKPSRGI---LQKGWRCLDCTVCEGCGKKNDEARLLLCDECDISYHIYCVNPPLETVPTGNWKCSFCTLCQKCG 632          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0111115)

HSP 1 Score: 82.8037 bits (203), Expect = 5.511e-16
Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 2
Query: 1067 DLISCTSCGQHYHSNCLE--PPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            +L+SC+ CG+  H +CL+    +I+S   R  WQC ECK C +C  S ++ ++L CD CD+G+H YCL PP+   P+  W C  C
Sbjct:  248 ELVSCSDCGRSGHPSCLQFTANMIIS-VKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 331          

HSP 2 Score: 57.7658 bits (138), Expect = 8.120e-8
Identity = 34/84 (40.48%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISKLTKVIIEK-GWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            L+ C  CG+  H  C + +    + +++  W+C++C  C  CG + N+D LL CDDCD  YH +CL PPL   P+GSW C+ C+
Sbjct:  249 LVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLCM 332          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0335258)

HSP 1 Score: 83.1889 bits (204), Expect = 1.478e-15
Identity = 40/113 (35.40%), Postives = 61/113 (53.98%), Query Frame = 2
Query: 1004 EADLSNEHCICSLC-------ERKGGVNDLISCTSCGQHYHSNCLE--PPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            E D++     C  C       ++     +L+SC+ CG+  H +CL+    +I+S   R  WQC ECK C +C  S ++ ++L CD CD+G+H YCL PP+   P+  W C  C
Sbjct:  377 ERDIAQPSPYCDFCLGDQRENKKTNMPEELVSCSDCGRSGHPSCLQFTANMIIS-VKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 488          

HSP 2 Score: 57.3806 bits (137), Expect = 1.733e-7
Identity = 34/84 (40.48%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISKLTKVIIEK-GWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            L+ C  CG+  H  C + +    + +++  W+C++C  C  CG + N+D LL CDDCD  YH +CL PPL   P+GSW C+ C+
Sbjct:  406 LVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLCM 489          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0086083)

HSP 1 Score: 83.1889 bits (204), Expect = 1.510e-15
Identity = 40/113 (35.40%), Postives = 61/113 (53.98%), Query Frame = 2
Query: 1004 EADLSNEHCICSLC-------ERKGGVNDLISCTSCGQHYHSNCLE--PPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            E D++     C  C       ++     +L+SC+ CG+  H +CL+    +I+S   R  WQC ECK C +C  S ++ ++L CD CD+G+H YCL PP+   P+  W C  C
Sbjct:  376 ERDIAQPSPYCDFCLGDQRENKKTNMPEELVSCSDCGRSGHPSCLQFTANMIIS-VKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 487          

HSP 2 Score: 57.3806 bits (137), Expect = 1.775e-7
Identity = 34/84 (40.48%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISKLTKVIIEK-GWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            L+ C  CG+  H  C + +    + +++  W+C++C  C  CG + N+D LL CDDCD  YH +CL PPL   P+GSW C+ C+
Sbjct:  405 LVSCSDCGRSGHPSCLQFTANMIISVKRYRWQCIECKYCSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLCM 488          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Zebrafish
Match: kmt2d (lysine (K)-specific methyltransferase 2D [Source:ZFIN;Acc:ZDB-GENE-060223-2])

HSP 1 Score: 213.772 bits (543), Expect = 3.020e-60
Identity = 105/247 (42.51%), Postives = 149/247 (60.32%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEAD-LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERA 1480
            +VHH C  WSEG  Q   ++     NV+  V +G+ + C +C R GATI CR++  C   +H+PC+AA+G FQ      L CP H  +A+ ++ E   C++C+  G ++ L+ CT CGQHYH  CLE  +  +P  R+GWQC ECK C  C +  ++ KMLVCD CDKG+HT+CL P M ++P + WKC  CRVC DCG     G+ L G+       +W  +YT+C+ C   +RR  S+C VC +A
Sbjct:  125 WVHHWCAVWSEGVEQTEGEV---LINVDKAVVSGIQRPCDYCKRMGATIRCRAE-GCSRFYHFPCSAASGSFQSMKQLALLCPEHIDKAEEIAGEEARCAVCDSVGDLSGLLYCTGCGQHYHDACLE--ISATPLQRSGWQCPECKVCQTCRQPGEDSKMLVCDACDKGYHTFCLLPAMDSVPPDSWKCKRCRVCIDCGMR---GLKLPGSE------QWFESYTVCEGC---QRRRTSVCGVCSKA 353          

HSP 2 Score: 86.6557 bits (213), Expect = 4.722e-17
Identity = 58/138 (42.03%), Postives = 74/138 (53.62%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGT--WQNNYTTCAPCASK--AQCPVC 2755
            E+  C  C S G  + LL C  CGQ YH  C EIS     +   GW+C +C VC+ C Q   +  +L+CD CD  YHTFCL P ++ VP  SWKC+ C VC  CG R     G+  W  +YT C  C  +  + C VC
Sbjct:  215 EEARCAVCDSVGDLSGLLYCTGCGQHYHDACLEISATP--LQRSGWQCPECKVCQTCRQPGEDSKMLVCDACDKGYHTFCLLPAMDSVPPDSWKCKRCRVCIDCGMRGLKLPGSEQWFESYTVCEGCQRRRTSVCGVC 350          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 220.32 bits (560), Expect = 1.838e-56
Identity = 123/241 (51.04%), Postives = 155/241 (64.32%), Query Frame = 2
Query: 2282 KNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDI-GAGHKQLLHLRATHGDSVAQTLVADK 2995
            K  EE   H +TVV+    D F L+QD+CV CGSFG   +  LL C QCGQCYH +C  I K+TKV++ KGWRCL+CTVCE CGQA++   LLLCDDCDISYHT+CLDPPL  VPKGSWKC+ CV+C  CG   PG    WQNNYT C PCAS   CPVC  +Y + +L+L C  C+R  H +C  LN++ ++E   +  G+ C LCR   +   GA   +L+ +  +    VAQ L   K
Sbjct:  954 KEEEENSMH-NTVVMFSTSDSFTLKQDMCVVCGSFGRGAEGRLLSCSQCGQCYHPFCVNI-KITKVVLSKGWRCLECTVCEACGQASDPGRLLLCDDCDISYHTYCLDPPLQNVPKGSWKCKWCVLCTHCGATSPGLRCEWQNNYTQCGPCASLTVCPVCTRSYREEELILQCRQCDRWVHGSCQGLNSDEDVENAAD-EGFDCTLCRMHTVPTPGAAVPKLVEI--SEPPMVAQILTKVK 1189          

HSP 2 Score: 213.001 bits (541), Expect = 2.849e-54
Identity = 109/278 (39.21%), Postives = 156/278 (56.12%), Query Frame = 2
Query:  746 VHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCI-CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDC 1576
             H  C  WSEG  +   Q   +   V+  + +G  + C++C R GA+I C  + +C   FHYPCAAAAG FQD  ++ L CP + Q+A + ++  + C +C+  G + D + C +CGQHYH  CL+  + ++P  RAGWQC ECK CL C    D+ KMLVCD+CDKG+HT+CLQP M  IP NGW+C +CR C  CG  M+P            N +W +N  +C+ C Q +     +C +C ++     P  K+          C TC + VH+DC
Sbjct:  267 AHLRCAAWSEGVCRGEGQ---SLLYVDKAIDSGSTECCAYCKRLGASIKC-CEESCGRSFHYPCAAAAGTFQDIKTYTLLCPDYIQQALVRSKDGVKCLVCDSSGDLLDQLFCCTCGQHYHGTCLD--VTVTPLKRAGWQCPECKVCLSCKNPGDDSKMLVCDMCDKGYHTFCLQPIMETIPTNGWRCKNCRTCAQCG--MRP------------NGQWSSNGVMCEGCQQ-QHESALLCLICGQSQDSGSPADKH---------TCCTCKRWVHVDC 514          

HSP 3 Score: 113.235 bits (282), Expect = 5.389e-24
Identity = 57/158 (36.08%), Postives = 80/158 (50.63%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L  + C+      +G    L+SC+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK  WKC  C +C  CG +  PG+             W NNYT C  CA       ++C VC R++R
Sbjct:  976 LKQDMCVVCGSFGRGAEGRLLSCSQCGQCYHPFCVNI-KITKVVLSKGWRCLECTVCEACGQASDPGRLLLCDDCDISYHTYCLDPPLQNVPKGSWKCKWCVLCTHCG-ATSPGL----------RCEWQNNYTQCGPCASL-----TVCPVCTRSYR 1116          

HSP 4 Score: 86.6557 bits (213), Expect = 5.058e-16
Identity = 61/187 (32.62%), Postives = 88/187 (47.06%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ----CPVCYNNYNDGDLM--LICDVCERSSHATC---DHLNTEAELEFIFEGGGYHCILCR 2899
            C+ C S G     L C  CGQ YH  C +++     +   GW+C +C VC  C    ++  +L+CD CD  YHTFCL P +  +P   W+C+NC  C  CG R   PNG W +N   C  C  + +    C +C  + + G       C  C+R  H  C   +  N + +L+      GY C  C+
Sbjct:  360 CLVCDSSGDLLDQLFCCTCGQHYHGTCLDVT--VTPLKRAGWQCPECKVCLSCKNPGDDSKMLVCDMCDKGYHTFCLQPIMETIPTNGWRCKNCRTCAQCGMR---PNGQWSSNGVMCEGCQQQHESALLCLICGQSQDSGSPADKHTCCTCKRWVHVDCVRQEGTNPDTQLQ-----DGYTCRACK 536          

HSP 5 Score: 69.707 bits (169), Expect = 8.106e-11
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1670 NAQRSTLKWEKEETLGEMATVAPVLYTNMNFPNLQDEFPDWATRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1746          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 210.305 bits (534), Expect = 1.908e-56
Identity = 111/278 (39.93%), Postives = 153/278 (55.04%), Query Frame = 2
Query:  746 VHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCI-CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDC 1576
             H  C  WSEG  +   Q   +   V+  + +G  + C++C R GA+I C  + +C   FHYPCAAAAG FQD  ++ L CP + Q+A + ++  + C +C+  G + D + C +CGQHYH  CL+  + ++P  RAGWQC ECK CL C    D+ KMLVCD+CDKG+HT+CLQP M  IP NGW+C +CR C  CG  M+P            N +W +N  +C+ C Q            E A  C + G    S S      C TC + VH+DC
Sbjct:  267 AHLRCAAWSEGVCRGEGQ---SLLYVDKAIDSGSTECCAYCKRLGASIKC-CEESCGRSFHYPCAAAAGTFQDIKTYTLLCPDYIQQALVRSKDGVKCLVCDSSGDLLDQLFCCTCGQHYHGTCLD--VTVTPLKRAGWQCPECKVCLSCKNPGDDSKMLVCDMCDKGYHTFCLQPIMETIPTNGWRCKNCRTCAQCG--MRP------------NGQWSSNGVMCEGCQQQH----------ESALLCLICGQSQDSGSPADKHTCCTCKRWVHVDC 514          

HSP 2 Score: 85.8853 bits (211), Expect = 4.591e-16
Identity = 61/187 (32.62%), Postives = 88/187 (47.06%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ----CPVCYNNYNDGDLM--LICDVCERSSHATC---DHLNTEAELEFIFEGGGYHCILCR 2899
            C+ C S G     L C  CGQ YH  C +++     +   GW+C +C VC  C    ++  +L+CD CD  YHTFCL P +  +P   W+C+NC  C  CG R   PNG W +N   C  C  + +    C +C  + + G       C  C+R  H  C   +  N + +L+      GY C  C+
Sbjct:  360 CLVCDSSGDLLDQLFCCTCGQHYHGTCLDVT--VTPLKRAGWQCPECKVCLSCKNPGDDSKMLVCDMCDKGYHTFCLQPIMETIPTNGWRCKNCRTCAQCGMR---PNGQWSSNGVMCEGCQQQHESALLCLICGQSQDSGSPADKHTCCTCKRWVHVDCVRQEGTNPDTQLQ-----DGYTCRACK 536          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Zebrafish
Match: kmt2cb (lysine (K)-specific methyltransferase 2Cb [Source:ZFIN;Acc:ZDB-GENE-070705-340])

HSP 1 Score: 216.083 bits (549), Expect = 3.543e-55
Identity = 132/313 (42.17%), Postives = 180/313 (57.51%), Query Frame = 2
Query: 2282 KNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTL-VADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRN-AMLKSQPRRAQNAMK 3208
            K  EE   H STVV+  + D F ++QD+CV CGSFG  ++  L+ C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CGQA++   LLLCDDCDISYHT+CLDPPL  VP GSWKC+ CV C  CG    G    WQNNYT CAPCAS A CP+C   Y + +++L C  C+R  HA+C  +++E E+E + +   + C LC+        GH   + L    G     +L  AD       +  + ++                    D  + +  D V L+ESGL+ +++ A   S+ RR++  +K
Sbjct:  927 KEEEETAMH-STVVIFSSADTFTMKQDMCVVCGSFGQGVEGRLIACAQCGQCYHPYCVNI-KITKVVLSKGWRCLECTVCEACGQASDPGRLLLCDDCDISYHTYCLDPPLQNVPNGSWKCKWCVSCTQCGATSAGLRCEWQNNYTQCAPCASLASCPLCQQEYKEEEIILQCRQCDRWMHASCQGIHSEEEVEKVAD-TSFDCNLCQ--------GH---IPLSPAPGTPSKSSLDFADSVFMPQRVTKTRDH--------------------DLMRTYTQDGVCLTESGLSQLQSLANAASRRRRSKPKLK 1205          

HSP 2 Score: 194.512 bits (493), Expect = 1.398e-48
Identity = 96/231 (41.56%), Postives = 127/231 (54.98%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            + H SC  WS    Q  DQ   +   V+  + +G  + C++C R GA+I C  +  C   +HYPC  AAG FQDF    + C  H + A     E   C LC+  G + D   CTSCG HYH  CL+  + ++P  RAGWQC ECK C  C E  ++ KMLVCDVCDKG+HT+CL+P M +IP NGW+C +CR+C  CG                S+ +WH+N  LC  C 
Sbjct:  239 WAHQSCALWSNFVCQAEDQ---SLLYVDKAIHSGSTEHCAYCKRLGASIKC-CEEGCDRSYHYPCVGAAGTFQDFRRRSVLCTEHIELAISKYEEEANCILCDSPGDLLDQFFCTSCGLHYHGMCLD--ISVTPLKRAGWQCPECKVCQTCKEPGEDTKMLVCDVCDKGYHTFCLKPAMDSIPTNGWRCKNCRMCVQCGTR--------------SSEQWHHNSLLCQNCG 449          

HSP 3 Score: 100.523 bits (249), Expect = 3.262e-20
Identity = 54/154 (35.06%), Postives = 76/154 (49.35%), Query Frame = 2
Query: 1031 ICSLCERKG-GVND-LISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            +C +C   G GV   LI+C  CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +P   WKC  C  C  CG            ++ G    W NNYT C  CA       + C +C++ ++
Sbjct:  953 MCVVCGSFGQGVEGRLIACAQCGQCYHPYCVNI-KITKVVLSKGWRCLECTVCEACGQASDPGRLLLCDDCDISYHTYCLDPPLQNVPNGSWKCKWCVSCTQCGA-----------TSAGLRCEWQNNYTQCAPCASL-----ASCPLCQQEYK 1089          

HSP 4 Score: 80.4925 bits (197), Expect = 3.630e-14
Identity = 62/200 (31.00%), Postives = 90/200 (45.00%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ------CPVCYNNYNDGDLMLICDVCERSSHATCD-----HLNTEAELEFIFEGGGYHCILCRDKGIDIG 2920
            E+  C+ C S G       C  CG  YH  C +IS     +   GW+C +C VC+ C +   +  +L+CD CD  YHTFCL P ++ +P   W+C+NC +C  CG R    +  W +N   C  C  +        CP         DL L C  C+R  +  C+     H + + + + I       C  CR  GI+ G
Sbjct:  329 EEANCILCDSPGDLLDQFFCTSCGLHYHGMCLDIS--VTPLKRAGWQCPECKVCQTCKEPGEDTKMLVCDVCDKGYHTFCLKPAMDSIPTNGWRCKNCRMCVQCGTRS---SEQWHHNSLLCQNCGDQQDTTLSCLCPSNVVPDIQKDL-LSCHQCKRWFNPECERPSEGHTHPQPKEDHI-------CSTCRTTGIESG 515          

HSP 5 Score: 67.0106 bits (162), Expect = 4.629e-10
Identity = 28/73 (38.36%), Postives = 49/73 (67.12%), Query Frame = 2
Query: 5936 NNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S++R  +V K+R N++  + N
Sbjct: 1673 STLKWEKEETLGELATVAPVLYTNVNFPNLKEEYPDWSTRVKQIAKLWRKASSQDRAPYVQKARDNRAALRIN 1745          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Zebrafish
Match: kmt2cb (lysine (K)-specific methyltransferase 2Cb [Source:ZFIN;Acc:ZDB-GENE-070705-340])

HSP 1 Score: 192.971 bits (489), Expect = 1.825e-49
Identity = 96/231 (41.56%), Postives = 127/231 (54.98%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            + H SC  WS    Q  DQ   +   V+  + +G  + C++C R GA+I C  +  C   +HYPC  AAG FQDF    + C  H + A     E   C LC+  G + D   CTSCG HYH  CL+  + ++P  RAGWQC ECK C  C E  ++ KMLVCDVCDKG+HT+CL+P M +IP NGW+C +CR+C  CG                S+ +WH+N  LC  C 
Sbjct:  239 WAHQSCALWSNFVCQAEDQ---SLLYVDKAIHSGSTEHCAYCKRLGASIKC-CEEGCDRSYHYPCVGAAGTFQDFRRRSVLCTEHIELAISKYEEEANCILCDSPGDLLDQFFCTSCGLHYHGMCLD--ISVTPLKRAGWQCPECKVCQTCKEPGEDTKMLVCDVCDKGYHTFCLKPAMDSIPTNGWRCKNCRMCVQCGTR--------------SSEQWHHNSLLCQNCG 449          

HSP 2 Score: 79.337 bits (194), Expect = 5.428e-14
Identity = 62/200 (31.00%), Postives = 90/200 (45.00%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ------CPVCYNNYNDGDLMLICDVCERSSHATCD-----HLNTEAELEFIFEGGGYHCILCRDKGIDIG 2920
            E+  C+ C S G       C  CG  YH  C +IS     +   GW+C +C VC+ C +   +  +L+CD CD  YHTFCL P ++ +P   W+C+NC +C  CG R    +  W +N   C  C  +        CP         DL L C  C+R  +  C+     H + + + + I       C  CR  GI+ G
Sbjct:  329 EEANCILCDSPGDLLDQFFCTSCGLHYHGMCLDIS--VTPLKRAGWQCPECKVCQTCKEPGEDTKMLVCDVCDKGYHTFCLKPAMDSIPTNGWRCKNCRMCVQCGTRS---SEQWHHNSLLCQNCGDQQDTTLSCLCPSNVVPDIQKDL-LSCHQCKRWFNPECERPSEGHTHPQPKEDHI-------CSTCRTTGIESG 515          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Xenopus
Match: rab9b (RAB9B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-491211])

HSP 1 Score: 234.187 bits (596), Expect = 1.938e-60
Identity = 185/530 (34.91%), Postives = 251/530 (47.36%), Query Frame = 2
Query: 2264 INVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTT---DMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARS-TRVSQVKK-------------SALAAVNNQNFDQNNPQYTIEN-FTAKQGRR----RPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKS 3781
             +V   K  EE   H +TVVL    D F L QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKVI+ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHTFCLDPPL  VPKG WKC+ CV C  C    PG    WQNNYT CAPCAS + CPVC  NY + +L+L C  C R SHA+C +LNTEAE+E   +  G+ C  C+   +  G  +   +         V +T   D                                            V L+ESGL+ +++  +  Q         R ++S  +  +  ++   + +  T P   ++                S +GE++ +   D+    V+SD   E + +   S S  V + L            R R+    GIGGF  R  +R  Q K              S L    ++++ +  P+  +E+      G      R  KKK++++E FP YL +AF G +LL  T+  SK S
Sbjct:  689 FDVSSYKEEEETSMH-NTVVLFSRSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVILRKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTFCLDPPLQTVPKGGWKCKWCVSCTNCKAITPGLRCEWQNNYTQCAPCASLSACPVCCQNYIEEELILQCRQCIRWSHASCQNLNTEAEVELAAD-SGFDCAACKPFVVSHGKINVLCVSFLILFLIYVLKTFTQD-------------------------------------------GVCLTESGLSQLQSLTITVQ---------RKKRSKPKLKLKIINQNSVAVLQTPPYPQSE---------------HSRDGEMDDSREVDLMDCDVKSDSSPEREPIDDDSKSTEVMDGLKK----------RKRKPYRPGIGGFMVRQRSRTGQGKSRRSLSRKDSSGSVSELLPGKDESWSEQLPETPLEDCIPGSDGTEKIKKRYRKKKNKLEETFPAYLQEAFFGRNLLD-TSRQSKAS 1137          

HSP 2 Score: 216.083 bits (549), Expect = 5.517e-55
Identity = 114/305 (37.38%), Postives = 163/305 (53.44%), Query Frame = 2
Query:  668 DENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            DE  +   L  + + A  + +  C + H  C  WS G  Q  +Q      +V+  V +G  + C++C   GATI C  +T C   +HYPCAA AG FQD     L CP H  +A + S E   C+LC+  G + D + CT+CGQHYH  CL+  + ++P  RAGWQC +CK C  C  S D+ +MLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG                ++  WH N  LCD C Q  ++    C +C++  +  L   K+          C  C + +H+DC+
Sbjct:  123 DELCQVGLLDDFHIQALFEPSGHC-WAHLRCAQWSPGVHQNEEQ---ELVSVDKAVLSGSTERCAYCKHLGATIKCCEET-CTQTYHYPCAAGAGTFQDLNCLTLLCPEHIDQALERSKEDANCALCDSSGDLLDQLFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPDCKVCQNCKHSGDDNQMLVCDTCDKGYHTFCLQPVMDSVPTNGWKCKNCRICTECGTR--------------TSSLWHLNCLLCDPCFQ--QQVSLPCPICDKPLQPEL--QKDM-------LHCHVCKRWIHLDCE 395          

HSP 3 Score: 110.923 bits (276), Expect = 3.466e-23
Identity = 56/160 (35.00%), Postives = 81/160 (50.62%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVC 1471
            S + +  L+ + C+      +G    L++C+ CGQ YH  C+    I    +R GW+C EC  C  C ++ D  ++L+CD CD  +HT+CL PP+  +PK GWKC  C  C +C  ++ PG+             W NNYT C  CA       S C VC
Sbjct:  710 SRSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVILRKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTFCLDPPLQTVPKGGWKCKWCVSCTNC-KAITPGL----------RCEWQNNYTQCAPCASL-----SACPVC 852          

HSP 4 Score: 98.9821 bits (245), Expect = 1.304e-19
Identity = 66/183 (36.07%), Postives = 91/183 (49.73%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKA---QCPVCYNNYND--GDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            C  C S G     L C  CGQ YH  C +I+     +   GW+C DC VC+ C  + +++ +L+CD CD  YHTFCL P ++ VP   WKC+NC +C  CG R    +  W  N   C PC  +     CP+C           ML C VC+R  H  C+   TE +++   +   Y C LC+
Sbjct:  241 CALCDSSGDLLDQLFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPDCKVCQNCKHSGDDNQMLVCDTCDKGYHTFCLQPVMDSVPTNGWKCKNCRICTECGTRT---SSLWHLNCLLCDPCFQQQVSLPCPICDKPLQPELQKDMLHCHVCKRWIHLDCEKC-TENDIDDQLK-EDYACTLCK 416          

HSP 5 Score: 70.4774 bits (171), Expect = 6.023e-11
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1388 NAQRSTLKWEKEEALGEMATVAPVLYTNVNFPNLKDEFPDWATRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1464          

HSP 6 Score: 53.9138 bits (128), Expect = 6.906e-6
Identity = 36/129 (27.91%), Postives = 57/129 (44.19%), Query Frame = 2
Query:  731 DSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGC--FQDFVSF-QLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHS 1108
            D   +VH +C  WS   ++  +   G   NVE  +R GL   C FC + GAT SC  +  C + +H+ CA  A C  F+D      +  P    E +L+       +  ++  V  + S    G+  H+
Sbjct: 4039 DLDLWVHLNCALWS---TEVYETQAGALINVELALRRGLQMKCGFCHKTGATSSCH-RLRCTNIYHFTCAIKAQCMFFKDKTMLCTMHKPKGLHEQELTYFAVFRRVYVQRDEVRQIASIVQRGERDHT 4163          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 210.69 bits (535), Expect = 2.412e-53
Identity = 113/197 (57.36%), Postives = 136/197 (69.04%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFGIDTP--LLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG  +   LL C QC QCYH YC   S++TKV++ KGWRC++C VCE CG+AT+   LLLCDDCDISYHT+CLDPPL+ VPKG WKC+ CV C  CG   PG    WQNNYT CAPCAS   CPVC+  Y +GDL++ C  CER  HA C++L TE E+E   +  G+ C  C+
Sbjct:  705 TVVLFSNTDKFVLMQDMCVVCGSFGRGSEGHLLACSQCSQCYHPYCVN-SRITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDDCDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCGAVTPGFRSEWQNNYTHCAPCASLVSCPVCHLKYLEGDLLIQCRHCERWLHAVCENLFTEEEVEQAAD-EGFDCSSCQ 899          

HSP 2 Score: 203.371 bits (516), Expect = 3.731e-51
Identity = 105/273 (38.46%), Postives = 148/273 (54.21%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKM 1561
            + HH C +WS G             NV+  V +G++Q C +C R GATI C S T C  ++H+PCAAA+G FQ   + +L C  H  EA ++  H +  +    G + DL+ CTSCG HYH  CLE  + +SP  R+GWQC ECK C  C +  ++  MLVCD CDKG+HT+CL+P +  +P + WKC +CRVC  CG       + T +   GS  +W++NY++C +C Q KR     C +C  A                P  KC  C ++
Sbjct:   91 WAHHWCASWSAGVIHVEG---TGLINVDKAVYSGISQKCEYCNRMGATIQCHS-TGCLRRYHFPCAAASGSFQSMKTLKLLCTEHLGEA-IAMAHWL--VLGGPGDLIDLLFCTSCGLHYHGTCLE--ITVSPLKRSGWQCPECKVCQTCRQPGEDTMMLVCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICG-------SRTAHMEPGS--QWYDNYSVCSKC-QEKRNRAETCVLCSHA---------------LPKEKCPNCQRL 329          

HSP 3 Score: 104.76 bits (260), Expect = 2.610e-21
Identity = 54/147 (36.73%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG ++ PG              W NNYT C  CA
Sbjct:  710 SNTDKFVLMQDMCVVCGSFGRGSEGHLLACSQCSQCYHPYCVNS-RITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDDCDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCG-AVTPGF----------RSEWQNNYTHCAPCA 844          

HSP 4 Score: 87.0409 bits (214), Expect = 5.885e-16
Identity = 48/114 (42.11%), Postives = 64/114 (56.14%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPG--PNGTWQNNYTTCAPCASK 2737
            LL C  CG  YH  C EI+     +   GW+C +C VC+ C Q   + ++L+CD CD  YHTFCL P +  +P  SWKC+ C VC+ CG R     P   W +NY+ C+ C  K
Sbjct:  193 LLFCTSCGLHYHGTCLEIT--VSPLKRSGWQCPECKVCQTCRQPGEDTMMLVCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICGSRTAHMEPGSQWYDNYSVCSKCQEK 304          

HSP 5 Score: 60.4622 bits (145), Expect = 6.471e-8
Identity = 25/68 (36.76%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG+ STI+PVL+AN    N++ +  D  SR ++I KLWRK+ + ++  ++ K++ N++  +
Sbjct: 1229 RWEKDEELGELSTISPVLYANKNFPNLKLEYPDWTSRCKQIMKLWRKVPAPDKAPYLQKAKDNRAAHR 1296          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 209.92 bits (533), Expect = 3.379e-53
Identity = 113/197 (57.36%), Postives = 136/197 (69.04%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFGIDTP--LLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG  +   LL C QC QCYH YC   S++TKV++ KGWRC++C VCE CG+AT+   LLLCDDCDISYHT+CLDPPL+ VPKG WKC+ CV C  CG   PG    WQNNYT CAPCAS   CPVC+  Y +GDL++ C  CER  HA C++L TE E+E   +  G+ C  C+
Sbjct:  622 TVVLFSNTDKFVLMQDMCVVCGSFGRGSEGHLLACSQCSQCYHPYCVN-SRITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDDCDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCGAVTPGFRSEWQNNYTHCAPCASLVSCPVCHLKYLEGDLLIQCRHCERWLHAVCENLFTEEEVEQAAD-EGFDCSSCQ 816          

HSP 2 Score: 179.104 bits (453), Expect = 8.481e-44
Identity = 89/226 (39.38%), Postives = 126/226 (55.75%), Query Frame = 2
Query:  884 TISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKM 1561
            T S    T C  ++H+PCAAA+G FQ   + +L C  H  EA ++ +   C LC++ G + DL+ CTSCG HYH  CLE  + +SP  R+GWQC ECK C  C +  ++  MLVCD CDKG+HT+CL+P +  +P + WKC +CRVC  CG       + T +   GS  +W++NY++C +C Q KR     C +C  A                P  KC  C ++
Sbjct:   91 TFSTCHSTGCLRRYHFPCAAASGSFQSMKTLKLLCTEHLGEA-IAMDDSRCVLCDKPGDLIDLLFCTSCGLHYHGTCLE--ITVSPLKRSGWQCPECKVCQTCRQPGEDTMMLVCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICG-------SRTAHMEPGS--QWYDNYSVCSKC-QEKRNRAETCVLCSHA---------------LPKEKCPNCQRL 288          

HSP 3 Score: 105.145 bits (261), Expect = 2.103e-21
Identity = 54/147 (36.73%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG ++ PG              W NNYT C  CA
Sbjct:  627 SNTDKFVLMQDMCVVCGSFGRGSEGHLLACSQCSQCYHPYCVNS-RITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDDCDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCG-AVTPGF----------RSEWQNNYTHCAPCA 761          

HSP 4 Score: 90.5077 bits (223), Expect = 5.047e-17
Identity = 52/135 (38.52%), Postives = 71/135 (52.59%), Query Frame = 2
Query: 2339 DLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPG--PNGTWQNNYTTCAPCASK 2737
            +   ++   CV C   G    LL C  CG  YH  C EI+     +   GW+C +C VC+ C Q   + ++L+CD CD  YHTFCL P +  +P  SWKC+ C VC+ CG R     P   W +NY+ C+ C  K
Sbjct:  131 EAIAMDDSRCVLCDKPGDLIDLLFCTSCGLHYHGTCLEIT--VSPLKRSGWQCPECKVCQTCRQPGEDTMMLVCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICGSRTAHMEPGSQWYDNYSVCSKCQEK 263          

HSP 5 Score: 60.4622 bits (145), Expect = 7.282e-8
Identity = 25/68 (36.76%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG+ STI+PVL+AN    N++ +  D  SR ++I KLWRK+ + ++  ++ K++ N++  +
Sbjct: 1136 RWEKDEELGELSTISPVLYANKNFPNLKLEYPDWTSRCKQIMKLWRKVPAPDKAPYLQKAKDNRAAHR 1203          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 209.92 bits (533), Expect = 3.718e-53
Identity = 113/197 (57.36%), Postives = 136/197 (69.04%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFGIDTP--LLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG  +   LL C QC QCYH YC   S++TKV++ KGWRC++C VCE CG+AT+   LLLCDDCDISYHT+CLDPPL+ VPKG WKC+ CV C  CG   PG    WQNNYT CAPCAS   CPVC+  Y +GDL++ C  CER  HA C++L TE E+E   +  G+ C  C+
Sbjct:  626 TVVLFSNTDKFVLMQDMCVVCGSFGRGSEGHLLACSQCSQCYHPYCVN-SRITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDDCDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCGAVTPGFRSEWQNNYTHCAPCASLVSCPVCHLKYLEGDLLIQCRHCERWLHAVCENLFTEEEVEQAAD-EGFDCSSCQ 820          

HSP 2 Score: 141.354 bits (355), Expect = 2.288e-32
Identity = 87/273 (31.87%), Postives = 123/273 (45.05%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKM 1561
            + HH C +WS G             NV+  V +G++Q       F   +S     N    +  P +A         + Q  CP                     G + DL+ CTSCG HYH  CLE  + +SP  R+GWQC ECK C  C +  ++  MLVCD CDKG+HT+CL+P +  +P + WKC +CRVC  CG       + T +   GS  +W++NY++C +C Q KR     C +C  A                P  KC  C ++
Sbjct:   91 WAHHWCASWSAGVIHVEGT---GLINVDKAVYSGISQWF-----FNCALSSYRNVNTVIGWVLPFSA---------TRQGVCP---------------------GDLIDLLFCTSCGLHYHGTCLE--ITVSPLKRSGWQCPECKVCQTCRQPGEDTMMLVCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICG-------SRTAHMEPGS--QWYDNYSVCSKC-QEKRNRAETCVLCSHA---------------LPKEKCPNCQRL 298          

HSP 3 Score: 104.76 bits (260), Expect = 2.340e-21
Identity = 54/147 (36.73%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG ++ PG              W NNYT C  CA
Sbjct:  631 SNTDKFVLMQDMCVVCGSFGRGSEGHLLACSQCSQCYHPYCVNS-RITKVMLLKGWRCVECIVCEVCGKATDPSRLLLCDDCDISYHTYCLDPPLHTVPKGGWKCRWCVSCMQCG-AVTPGF----------RSEWQNNYTHCAPCA 765          

HSP 4 Score: 87.0409 bits (214), Expect = 6.336e-16
Identity = 48/114 (42.11%), Postives = 64/114 (56.14%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDP--GPNGTWQNNYTTCAPCASK 2737
            LL C  CG  YH  C EI+     +   GW+C +C VC+ C Q   + ++L+CD CD  YHTFCL P +  +P  SWKC+ C VC+ CG R     P   W +NY+ C+ C  K
Sbjct:  162 LLFCTSCGLHYHGTCLEIT--VSPLKRSGWQCPECKVCQTCRQPGEDTMMLVCDACDKGYHTFCLKPAIECLPTDSWKCKTCRVCRICGSRTAHMEPGSQWYDNYSVCSKCQEK 273          

HSP 5 Score: 60.4622 bits (145), Expect = 6.976e-8
Identity = 25/68 (36.76%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG+ STI+PVL+AN    N++ +  D  SR ++I KLWRK+ + ++  ++ K++ N++  +
Sbjct: 1142 RWEKDEELGELSTISPVLYANKNFPNLKLEYPDWTSRCKQIMKLWRKVPAPDKAPYLQKAKDNRAAHR 1209          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Xenopus
Match: vps37a (vacuolar protein sorting 37 homolog A [Source:Xenbase;Acc:XB-GENE-969334])

HSP 1 Score: 92.8189 bits (229), Expect = 7.634e-19
Identity = 46/112 (41.07%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  998 TQEADLSNEHC-IC----SLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            T  A LSN +C  C    S+ ++ G   +L+SC  CG+  H  CL+  + ++  V+   WQC ECK+C+VC  S++++++L CD CD+G+H YCL PPMA  P+  W C  C
Sbjct:  244 TDGAILSNNYCDFCLGDSSINKKSGQPEELVSCADCGRSGHPTCLQFTVNMTEAVKTYQWQCIECKSCIVCGTSENDEQLLFCDDCDRGYHMYCLIPPMAEPPEGSWSCHLC 355          

HSP 2 Score: 60.8474 bits (146), Expect = 1.504e-8
Identity = 39/102 (38.24%), Postives = 56/102 (54.90%), Query Frame = 2
Query: 2360 DICVSCGSF----GIDTPLLCCVQCGQCYHSYCAEIS-KLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            D C+   S     G    L+ C  CG+  H  C + +  +T+ +    W+C++C  C  CG + N++ LL CDDCD  YH +CL PP+ E P+GSW C  CV
Sbjct:  255 DFCLGDSSINKKSGQPEELVSCADCGRSGHPTCLQFTVNMTEAVKTYQWQCIECKSCIVCGTSENDEQLLFCDDCDRGYHMYCLIPPMAEPPEGSWSCHLCV 356          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 252.677 bits (644), Expect = 1.368e-66
Identity = 181/512 (35.35%), Postives = 262/512 (51.17%), Query Frame = 2
Query: 2279 SKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRAR--------STRVSQVKKSALAAVNNQ------NFDQNNPQYTIENFTA-----KQGRRRPVKKKSEIDENFPDYLMQAFLGSSLL 3751
            S  +EE++   +TVVL  + D F L+QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQNNYT CAPCAS + CPVC  NY + DL+L C  C+R  HA C +LNTE E+E + +  G+ C +CR              ++  ++   V  +   D S+ + ++    E                     DP K +  D V L+ESG++ +++  + + PRR +   K   K  +Q+++         +  T P + ++ S        D +   S EGE+   D KS           +S P   A +     +  +  I K    R R+    GIGGF  R          + S V+K +  +++ Q       + +  P   ++   +      + ++R  K+K++++E FP YL +AF G  LL
Sbjct:  885 SNKDEEENSMHNTVVLFSSSDKFTLQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVAD-IGFDCSMCRP-------------YMPVSN---VPSSDCCDSSLVAQIVTKVKEL--------------------DPPKTYTQDGVCLTESGMSQLQSLTVTA-PRRKRTKPKLKLKIINQNSVA--------VLQTPPDIQSEHS-------RDGEMDDSREGELMDCDGKS-----------ESSPEREAGDDETKGIEGTDAIKK----RKRKPYRPGIGGFMVRQRSRTGQGKAKRSVVRKDSSGSISEQLPSRDDGWREQLPDTLVDEPVSVAENTDKIKKRYRKRKNKLEETFPAYLQEAFFGKDLL 1327          

HSP 2 Score: 233.032 bits (593), Expect = 1.564e-60
Identity = 144/438 (32.88%), Postives = 205/438 (46.80%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +  P  +  W KD  SNK  D      C++       K+  + K             V+     E +   L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF  F L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG                S+ +WH+N  +CD C Q +    ++C  C + +   L               C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRVT--PGLTLPW-KDQPSNKDIDDNSSGTCEKIQNYAPRKQRGQRKERPPQQSAVSCVSVSTQTACEDQAGKLWDELSLVGLPDAIDVQA------------LFDSTGTC----------------------------WAHHRCVEWSLGICQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTR--------------SSTQWHHNCLICDTCYQQQ---DNLCPFCGKCYHPELQKDMLH---------CNMCKRWVHLECD 496          

HSP 3 Score: 111.309 bits (277), Expect = 1.835e-23
Identity = 57/158 (36.08%), Postives = 77/158 (48.73%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L  + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G    W NNYT C  CA       S C VC R +R
Sbjct:  909 LQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIK-ITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGA-----------TSAGLRCEWQNNYTQCAPCASL-----SSCPVCCRNYR 1049          

HSP 4 Score: 102.064 bits (253), Expect = 9.303e-21
Identity = 68/192 (35.42%), Postives = 94/192 (48.96%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGH 2929
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD   T+ EL+   +   Y C+ C+  G +I   H
Sbjct:  343 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---STQWHHNCLICDTCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDK-PTDQELDSQLK-EDYICMYCKHLGAEIDPLH 527          

HSP 5 Score: 67.3958 bits (163), Expect = 3.477e-10
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1546 NAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1622          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 251.521 bits (641), Expect = 7.700e-66
Identity = 184/518 (35.52%), Postives = 262/518 (50.58%), Query Frame = 2
Query: 2267 NVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRAR--------STRVSQVKKSALAAVNNQNFDQNN-------------PQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLL 3751
            ++  +K+ EE   H +TVVL  + D F L+QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQNNYT CAPCAS + CPVC  NY + DL+L C  C+R  HA C +LNTE E+E + +  G+ C +CR              ++  ++   V  +   D S+ + ++    E                     DP K +  D V L+ESG++ +++  + + PRR +   K   K  +Q+++         +  T P + ++ S        D +   S EGE+   D KS           +S P   A +     +  +  I K    R R+    GIGGF  R          + S V+K +  +++ Q   +++             P    EN    + R    K+K++++E FP YL +AF G  LL
Sbjct:  922 DISSNKDEEENSMH-NTVVLFSSSDKFTLQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVAD-IGFDCSMCRP-------------YMPVSN---VPSSDCCDSSLVAQIVTKVKEL--------------------DPPKTYTQDGVCLTESGMSQLQSLTVTA-PRRKRTKPKLKLKIINQNSVA--------VLQTPPDIQSEHS-------RDGEMDDSREGELMDCDGKS-----------ESSPEREAGDDETKGIEGTDAIKK----RKRKPYRPGIGGFMVRQRSRTGQGKAKRSVVRKDSSGSISEQLPSRDDGWREQLPDTLVDEPVSVAENTDKIKKRY--RKRKNKLEETFPAYLQEAFFGKDLL 1367          

HSP 2 Score: 236.884 bits (603), Expect = 2.218e-61
Identity = 148/441 (33.56%), Postives = 207/441 (46.94%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDC---QEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +  P  +  W KD  SNK  D      C   Q Y       + KE     +           A  D  G+   L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF  F L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG                S+ +WH+N  +CD C Q +    ++C  C + +   L   K+          C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRVT--PGLTLPW-KDQPSNKDIDDNSSGTCEKIQNYAPRKQRGQRKERPPQQSAVSCVSVSTQTACEDQAGK---LWDELSLVGLPDAIDVQA------------LFDSTGTC----------------------------WAHHRCVEWSLGICQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTR--------------SSTQWHHNCLICDTCYQQQ---DNLCPFCGKCYHPEL--QKDM-------LHCNMCKRWVHLECD 496          

HSP 3 Score: 112.849 bits (281), Expect = 7.990e-24
Identity = 57/158 (36.08%), Postives = 77/158 (48.73%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L  + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G    W NNYT C  CA       S C VC R +R
Sbjct:  949 LQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGA-----------TSAGLRCEWQNNYTQCAPCASL-----SSCPVCCRNYR 1089          

HSP 4 Score: 103.219 bits (256), Expect = 5.342e-21
Identity = 68/192 (35.42%), Postives = 94/192 (48.96%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGH 2929
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD   T+ EL+   +   Y C+ C+  G +I   H
Sbjct:  343 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---STQWHHNCLICDTCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDK-PTDQELDSQLK-EDYICMYCKHLGAEIDPLH 527          

HSP 5 Score: 70.0922 bits (170), Expect = 6.201e-11
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1621 NAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1697          

HSP 6 Score: 55.0694 bits (131), Expect = 2.349e-6
Identity = 36/127 (28.35%), Postives = 54/127 (42.52%), Query Frame = 2
Query:  740 FYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSH----TQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHS 1108
             +VH +C  WS   ++  +   G   NVE  +R GL   C FC + GAT  C  +  C + +H+ CA  A C   F    + CP H      E  LS       +  ++  V  + S    G+  H+
Sbjct: 4419 LWVHLNCALWS---TEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCH-RFRCTNIYHFTCATKAQCM-FFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHT 4540          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 228.409 bits (581), Expect = 4.057e-61
Identity = 144/438 (32.88%), Postives = 206/438 (47.03%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +  P  +  W KD  SNK  D      C++       K+  + K             V+     E +   L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF  F L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG                S+ +WH+N  +CD C Q +    ++C  C + +   L         +     C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRVT--PGLTLPW-KDQPSNKDIDDNSSGTCEKIQNYAPRKQRGQRKERPPQQSAVSCVSVSTQTACEDQAGKLWDELSLVGLPDAIDVQA------------LFDSTGTC----------------------------WAHHRCVEWSLGICQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTR--------------SSTQWHHNCLICDTCYQQQ---DNLCPFCGKCYHPEL---------QKDMLHCNMCKRWVHLECD 496          

HSP 2 Score: 98.5969 bits (244), Expect = 7.842e-20
Identity = 68/192 (35.42%), Postives = 94/192 (48.96%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGH 2929
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD   T+ EL+   +   Y C+ C+  G +I   H
Sbjct:  343 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---STQWHHNCLICDTCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDK-PTDQELDSQLK-EDYICMYCKHLGAEIDPLH 527          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Mouse
Match: Kmt2d (lysine (K)-specific methyltransferase 2D [Source:MGI Symbol;Acc:MGI:2682319])

HSP 1 Score: 209.92 bits (533), Expect = 3.232e-53
Identity = 119/312 (38.14%), Postives = 159/312 (50.96%), Query Frame = 2
Query:  563 WVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGA-SQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRC--AQTKRRGHSIC----AVCER 1477
            W G P +      S G      ++L K   S     E L  AHL         +    C + HH C  WS G   Q   +L G    V+  + +G++Q CS C RFGA++ CRS   C   +H+PCA A+G F    + QL CP H+  A    E   C++CE  G + DL+ CTSCG HYH  CL+    L+   RA WQC ECK C  C +  ++ KMLVC+ CDKG+HT+CL+PPM  +P + WKC +CR+C  CG          G++    N  W  NY+LC RC  AQ  +   S+     AVC R
Sbjct:   91 WPGFPVV-----PSGGNSGPCEAVLPKEDASQIGFPEGLTPAHL--------GEPGGHC-WAHHWCAAWSAGVWGQEGPELCG----VDKAIFSGISQRCSHCARFGASVPCRS-PGCSRLYHFPCATASGSFLSMKTLQLLCPEHSDGA-AHLEEARCAVCEGPGQLCDLLFCTSCGHHYHGACLD--TALTARKRASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCRACG---------AGSAELNPNSEWFENYSLCHRCHKAQGSQPVTSVAEQHPAVCSR 371          

HSP 2 Score: 207.994 bits (528), Expect = 1.064e-52
Identity = 111/197 (56.35%), Postives = 134/197 (68.02%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG   +  LL C QC QCYH YC   SK+TKV++ KGWRC++C VCE CGQA++   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C  CG   PG +  WQN+YT C PCAS   CPVC+  Y + DL++ C  CER  HA C+ L TE E+E   +  G+ C+ C+
Sbjct: 1319 TVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVN-SKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPVCHAPYVEEDLLIQCRHCERWMHAGCESLFTEDEVEQAAD-EGFDCVSCQ 1513          

HSP 3 Score: 107.457 bits (267), Expect = 2.977e-22
Identity = 55/164 (33.54%), Postives = 79/164 (48.17%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAW 1483
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G +  W N+YT C  CA         C VC   +
Sbjct: 1324 SNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNS-KITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGA-----------ASPGFHCEWQNSYTHCGPCASL-----VTCPVCHAPY 1470          

HSP 4 Score: 86.2705 bits (212), Expect = 8.238e-16
Identity = 54/145 (37.24%), Postives = 76/145 (52.41%), Query Frame = 2
Query: 2321 VLC--RADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFC--GKRDPGPNGTWQNNYTTCAPCASKAQ 2743
            +LC   +D    LE+  C  C   G    LL C  CG  YH  C + +   +      W+C +C VC+ C +  N+  +L+C+ CD  YHTFCL PP+ ++P  SWKC+ C +C+ C  G  +  PN  W  NY+ C  C  KAQ
Sbjct:  212 LLCPEHSDGAAHLEEARCAVCEGPGQLCDLLFCTSCGHHYHGACLDTALTARK--RASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCRACGAGSAELNPNSEWFENYSLCHRC-HKAQ 353          

HSP 5 Score: 62.003 bits (149), Expect = 1.576e-8
Identity = 25/68 (36.76%), Postives = 45/68 (66.18%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG  STI+PVL+AN    N++    D  SR ++I KLWRK+ + ++  ++ K++ N++  +
Sbjct: 1962 RWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHR 2029          

HSP 6 Score: 55.0694 bits (131), Expect = 1.998e-6
Identity = 38/129 (29.46%), Postives = 56/129 (43.41%), Query Frame = 2
Query:  731 DSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQ----EADLSNEHCICSLCERKGGVNDLISCTSCGQHYH 1105
            D   +VH +C  WS   ++  +   G   NVE  +  GL   CS C R GAT SC ++  C + +H+ CA  A C   F    + CP H      E +LS+      +   +  V  + S    G+  H
Sbjct: 5104 DLDLWVHLNCALWS---TEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSC-NRMRCPNVYHFACAIRAKCM-FFKDKTMLCPVHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLH 5227          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Mouse
Match: Kmt2d (lysine (K)-specific methyltransferase 2D [Source:MGI Symbol;Acc:MGI:2682319])

HSP 1 Score: 209.92 bits (533), Expect = 3.314e-53
Identity = 119/312 (38.14%), Postives = 159/312 (50.96%), Query Frame = 2
Query:  563 WVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGA-SQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRC--AQTKRRGHSIC----AVCER 1477
            W G P +      S G      ++L K   S     E L  AHL         +    C + HH C  WS G   Q   +L G    V+  + +G++Q CS C RFGA++ CRS   C   +H+PCA A+G F    + QL CP H+  A    E   C++CE  G + DL+ CTSCG HYH  CL+    L+   RA WQC ECK C  C +  ++ KMLVC+ CDKG+HT+CL+PPM  +P + WKC +CR+C  CG          G++    N  W  NY+LC RC  AQ  +   S+     AVC R
Sbjct:   91 WPGFPVV-----PSGGNSGPCEAVLPKEDASQIGFPEGLTPAHL--------GEPGGHC-WAHHWCAAWSAGVWGQEGPELCG----VDKAIFSGISQRCSHCARFGASVPCRS-PGCSRLYHFPCATASGSFLSMKTLQLLCPEHSDGA-AHLEEARCAVCEGPGQLCDLLFCTSCGHHYHGACLD--TALTARKRASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCRACG---------AGSAELNPNSEWFENYSLCHRCHKAQGSQPVTSVAEQHPAVCSR 371          

HSP 2 Score: 207.994 bits (528), Expect = 1.091e-52
Identity = 111/197 (56.35%), Postives = 134/197 (68.02%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG   +  LL C QC QCYH YC   SK+TKV++ KGWRC++C VCE CGQA++   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C  CG   PG +  WQN+YT C PCAS   CPVC+  Y + DL++ C  CER  HA C+ L TE E+E   +  G+ C+ C+
Sbjct: 1319 TVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVN-SKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPVCHAPYVEEDLLIQCRHCERWMHAGCESLFTEDEVEQAAD-EGFDCVSCQ 1513          

HSP 3 Score: 107.457 bits (267), Expect = 3.027e-22
Identity = 55/164 (33.54%), Postives = 79/164 (48.17%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAW 1483
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G +  W N+YT C  CA         C VC   +
Sbjct: 1324 SNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNS-KITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGA-----------ASPGFHCEWQNSYTHCGPCASL-----VTCPVCHAPY 1470          

HSP 4 Score: 86.2705 bits (212), Expect = 8.448e-16
Identity = 54/145 (37.24%), Postives = 76/145 (52.41%), Query Frame = 2
Query: 2321 VLC--RADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFC--GKRDPGPNGTWQNNYTTCAPCASKAQ 2743
            +LC   +D    LE+  C  C   G    LL C  CG  YH  C + +   +      W+C +C VC+ C +  N+  +L+C+ CD  YHTFCL PP+ ++P  SWKC+ C +C+ C  G  +  PN  W  NY+ C  C  KAQ
Sbjct:  212 LLCPEHSDGAAHLEEARCAVCEGPGQLCDLLFCTSCGHHYHGACLDTALTARK--RASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCRACGAGSAELNPNSEWFENYSLCHRC-HKAQ 353          

HSP 5 Score: 62.003 bits (149), Expect = 1.576e-8
Identity = 25/68 (36.76%), Postives = 45/68 (66.18%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG  STI+PVL+AN    N++    D  SR ++I KLWRK+ + ++  ++ K++ N++  +
Sbjct: 1962 RWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHR 2029          

HSP 6 Score: 55.0694 bits (131), Expect = 1.998e-6
Identity = 38/129 (29.46%), Postives = 56/129 (43.41%), Query Frame = 2
Query:  731 DSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQ----EADLSNEHCICSLCERKGGVNDLISCTSCGQHYH 1105
            D   +VH +C  WS   ++  +   G   NVE  +  GL   CS C R GAT SC ++  C + +H+ CA  A C   F    + CP H      E +LS+      +   +  V  + S    G+  H
Sbjct: 5104 DLDLWVHLNCALWS---TEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSC-NRMRCPNVYHFACAIRAKCM-FFKDKTMLCPVHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLH 5227          
BLAST of Histone-lysine N-methyltransferase 2C vs. UniProt/SwissProt
Match: sp|Q8NEZ4|KMT2C_HUMAN (Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3)

HSP 1 Score: 256.529 bits (654), Expect = 1.420e-66
Identity = 185/526 (35.17%), Postives = 274/526 (52.09%), Query Frame = 2
Query: 2267 NVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRAR--------STRVSQVKKSALAAVNNQ------NFDQNNPQYTIENFTA-----KQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKS 3781
            ++  +K++EE   H +TVVL  + D F L QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQNNYT CAPCAS + CPVCY NY + DL+L C  C+R  HA C +LNTE E+E + +  G+ C +CR              ++ A++   V  +   + S+ + ++    E                     DP K +  D V L+ESG+  ++ ++  + PRR ++  K   K  +Q+++         +  T P + ++ S        D +   S EGE+   D KS           +S P   A +     +  +  + K    R R+    GIGGF  R         T+ S ++K +  +++ Q       + +  P   ++   +     ++ ++R  K+K++++E FP YL +AF G  LL    +TS++S
Sbjct:  928 DISSNKDDEENSMH-NTVVLFSSSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVAD-IGFDCSMCRP-------------YMPASN---VPSSDCCESSLVAQIVTKVKEL--------------------DPPKTYTQDGVCLTESGMTQLQ-SLTVTVPRRKRSKPKLKLKIINQNSVA--------VLQTPPDIQSEHS-------RDGEMDDSREGELMDCDGKS-----------ESSPEREAVDDETKGVEGTDGVKK----RKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDDGWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLL----DTSRQS 1379          

HSP 2 Score: 235.343 bits (599), Expect = 4.179e-60
Identity = 145/447 (32.44%), Postives = 212/447 (47.43%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYI--W------SKDVNSNKRSDRIKLKDCQEYCCLDTNK-RLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +    P +I  W       KD++ N      K+++          K R  +  I+      C++       D++     L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF    L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG         T +S+Q     WH+N  +CD C Q +    ++C  C + +   L   K+          C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRIT----PGFILPWRNQPSNKKDIDDNSNGTYEKMQNSAPRKQRGQRKERSPQQNIVS-----CVSVSTQTASDDQA--GKLWDELSLVGLPDAIDIQA------------LFDSTGTC----------------------------WAHHRCVEWSLGVCQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECG---------TRSSSQ-----WHHNCLICDNCYQQQ---DNLCPFCGKCYHPEL--QKDM-------LHCNMCKRWVHLECD 497          

HSP 3 Score: 115.161 bits (287), Expect = 9.775e-24
Identity = 57/158 (36.08%), Postives = 78/158 (49.37%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L+ + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G    W NNYT C  CA       S C VC R +R
Sbjct:  955 LNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGA-----------TSAGLRCEWQNNYTQCAPCASL-----SSCPVCYRNYR 1095          

HSP 4 Score: 102.449 bits (254), Expect = 6.664e-20
Identity = 66/193 (34.20%), Postives = 94/193 (48.70%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCD-----HLNTEAELEFIFEGGGYHCILCRDKGIDI 2917
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD      L+T+ + E+I       C+ C+  G ++
Sbjct:  344 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---SSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYI-------CMYCKHLGAEM 524          

HSP 5 Score: 70.0922 bits (170), Expect = 4.374e-10
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1631 NAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1707          

HSP 6 Score: 56.225 bits (134), Expect = 7.107e-6
Identity = 36/127 (28.35%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  740 FYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSH----TQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHS 1108
             +VH +C  WS   ++  +   G   NVE  +R GL   C FC + GAT  C  +  C + +H+ CA  A C   F    + CP H      E +LS       +  ++  V  + S    G+  H+
Sbjct: 4426 LWVHLNCALWS---TEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCH-RFRCTNIYHFTCAIKAQCM-FFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHT 4547          
BLAST of Histone-lysine N-methyltransferase 2C vs. UniProt/SwissProt
Match: sp|Q8BRH4|KMT2C_MOUSE (Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 5.477e-65
Identity = 184/518 (35.52%), Postives = 262/518 (50.58%), Query Frame = 2
Query: 2267 NVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRAR--------STRVSQVKKSALAAVNNQNFDQNN-------------PQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLL 3751
            ++  +K+ EE   H +TVVL  + D F L+QD+CV CGSFG   +  LL C QCGQCYH YC  I K+TKV++ KGWRCL+CTVCE CG+AT+   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C+ CG    G    WQNNYT CAPCAS + CPVC  NY + DL+L C  C+R  HA C +LNTE E+E + +  G+ C +CR              ++  ++   V  +   D S+ + ++    E                     DP K +  D V L+ESG++ +++  + + PRR +   K   K  +Q+++         +  T P + ++ S        D +   S EGE+   D KS           +S P   A +     +  +  I K    R R+    GIGGF  R          + S V+K +  +++ Q   +++             P    EN    + R    K+K++++E FP YL +AF G  LL
Sbjct:  921 DISSNKDEEENSMH-NTVVLFSSSDKFTLQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVAD-IGFDCSMCRP-------------YMPVSN---VPSSDCCDSSLVAQIVTKVKEL--------------------DPPKTYTQDGVCLTESGMSQLQSLTVTA-PRRKRTKPKLKLKIINQNSVA--------VLQTPPDIQSEHS-------RDGEMDDSREGELMDCDGKS-----------ESSPEREAGDDETKGIEGTDAIKK----RKRKPYRPGIGGFMVRQRSRTGQGKAKRSVVRKDSSGSISEQLPSRDDGWREQLPDTLVDEPVSVAENTDKIKKRY--RKRKNKLEETFPAYLQEAFFGKDLL 1366          

HSP 2 Score: 236.884 bits (603), Expect = 1.564e-60
Identity = 148/441 (33.56%), Postives = 207/441 (46.94%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDC---QEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            C+ C  G ++  GQG++ +F  +  P  +  W KD  SNK  D      C   Q Y       + KE     +           A  D  G+   L DE + VGLP  +  Q             L+ +  +C                            + HH CV WS G  Q  + L     NV+  V +G  + C+FC   GATI C  +  C   +HYPCAA AG FQDF  F L CP H  +A + S E   C++C+  G + D   CT+CGQHYH  CL+  + ++P  RAGWQC ECK C  C +S ++ KMLVCD CDKG+HT+CLQP M ++P NGWKC +CR+C +CG                S+ +WH+N  +CD C Q +    ++C  C + +   L   K+          C+ C + VH++CD
Sbjct:  134 CAFCYCGEKSSLGQGDLKQFRVT--PGLTLPW-KDQPSNKDIDDNSSGTCEKIQNYAPRKQRGQRKERPPQQSAVSCVSVSTQTACEDQAGK---LWDELSLVGLPDAIDVQA------------LFDSTGTC----------------------------WAHHRCVEWSLGICQMEEPL---LVNVDKAVVSGSTERCAFCKHLGATIKC-CEEKCTQMYHYPCAAGAGTFQDFSHFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLD--IAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTR--------------SSTQWHHNCLICDTCYQQQ---DNLCPFCGKCYHPEL--QKDM-------LHCNMCKRWVHLECD 496          

HSP 3 Score: 112.849 bits (281), Expect = 5.542e-23
Identity = 57/158 (36.08%), Postives = 77/158 (48.73%), Query Frame = 2
Query: 1013 LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            L  + C+      +G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G    W NNYT C  CA       S C VC R +R
Sbjct:  948 LQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSI-KITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGA-----------TSAGLRCEWQNNYTQCAPCASL-----SSCPVCCRNYR 1088          

HSP 4 Score: 103.219 bits (256), Expect = 3.706e-20
Identity = 68/192 (35.42%), Postives = 94/192 (48.96%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ--CPVCYNNYND--GDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGH 2929
            C  C S G       C  CGQ YH  C +I+     +   GW+C +C VC+ C Q+  +  +L+CD CD  YHTFCL P +  VP   WKC+NC +C  CG R    +  W +N   C  C  +    CP C   Y+      ML C++C+R  H  CD   T+ EL+   +   Y C+ C+  G +I   H
Sbjct:  343 CAVCDSPGDLLDQFFCTTCGQHYHGMCLDIA--VTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRS---STQWHHNCLICDTCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDK-PTDQELDSQLK-EDYICMYCKHLGAEIDPLH 527          

HSP 5 Score: 70.0922 bits (170), Expect = 4.301e-10
Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            N + + LKW+++E LG+ +T+APVL+ N    N++ +  D  +R ++I KLWRK  S+ER  +V K+R N++  + N
Sbjct: 1620 NAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRIN 1696          
BLAST of Histone-lysine N-methyltransferase 2C vs. UniProt/SwissProt
Match: sp|O14686|KMT2D_HUMAN (Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 5.197e-53
Identity = 116/294 (39.46%), Postives = 157/294 (53.40%), Query Frame = 2
Query:  599 SSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGA-SQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCER 1477
            S  G+   N ++L     S     E L  AHL         +   SC + HH C  WS G   Q   +L G    V+  + +G++Q CS C R GA+I CRS   C   +H+PCA A+G F    + QL CP H++ A    E   C++CE  G + DL  CTSCG HYH  CL+    L+   RAGWQC ECK C  C +  ++ KMLVC+ CDKG+HT+CL+PPM  +P + WKC +CRVC  CG          G++    N  W  NY+LC RC + +  G +I +V E+
Sbjct:   98 SPGGSPGPNEAVLPSEDLSQIGFPEGLTPAHL--------GEPGGSC-WAHHWCAAWSAGVWGQEGPELCG----VDKAIFSGISQRCSHCTRLGASIPCRS-PGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAYLEE-ARCAVCEGPGELCDLFFCTSCGHHYHGACLD--TALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKACRVCRACG---------AGSAELNPNSEWFENYSLCHRCHKAQ-GGQTIRSVAEQ 364          

HSP 2 Score: 200.675 bits (509), Expect = 1.429e-49
Identity = 109/197 (55.33%), Postives = 134/197 (68.02%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG   +  LL C QC QCYH YC   SK+TKV++ KGWRC++C VCE CGQA++   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C  CG   PG +  WQN+YT C PCAS   CP+C+  Y + DL++ C  CER  HA C+ L TE ++E   +  G+ C+ C+
Sbjct: 1363 TVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVN-SKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAAD-EGFDCVSCQ 1557          

HSP 3 Score: 102.449 bits (254), Expect = 6.464e-20
Identity = 52/147 (35.37%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G +  W N+YT C  CA
Sbjct: 1368 SNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNS-KITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGA-----------ASPGFHCEWQNSYTHCGPCA 1502          

HSP 4 Score: 86.2705 bits (212), Expect = 4.749e-15
Identity = 53/133 (39.85%), Postives = 71/133 (53.38%), Query Frame = 2
Query: 2351 LEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFC--GKRDPGPNGTWQNNYTTCAPCASKAQ 2743
            LE+  C  C   G    L  C  CG  YH  C + +   +     GW+C +C VC+ C +  N+  +L+C+ CD  YHTFCL PP+ E+P  SWKC+ C VC+ C  G  +  PN  W  NY+ C  C  KAQ
Sbjct:  224 LEEARCAVCEGPGELCDLFFCTSCGHHYHGACLDTALTARK--RAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRC-HKAQ 353          

HSP 5 Score: 63.1586 bits (152), Expect = 5.270e-8
Identity = 26/70 (37.14%), Postives = 46/70 (65.71%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            +W++DE LG  STI+PVL+AN    N++    D  SR ++I KLWRK+ + ++  ++ K++ N++  + N
Sbjct: 2005 RWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRIN 2074          
BLAST of Histone-lysine N-methyltransferase 2C vs. UniProt/SwissProt
Match: sp|Q6PDK2|KMT2D_MOUSE (Histone-lysine N-methyltransferase 2D OS=Mus musculus OX=10090 GN=Kmt2d PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 1.090e-50
Identity = 119/312 (38.14%), Postives = 159/312 (50.96%), Query Frame = 2
Query:  563 WVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGA-SQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRC--AQTKRRGHSIC----AVCER 1477
            W G P +      S G      ++L K   S     E L  AHL         +    C + HH C  WS G   Q   +L G    V+  + +G++Q CS C RFGA++ CRS   C   +H+PCA A+G F    + QL CP H+  A    E   C++CE  G + DL+ CTSCG HYH  CL+    L+   RA WQC ECK C  C +  ++ KMLVC+ CDKG+HT+CL+PPM  +P + WKC +CR+C  CG          G++    N  W  NY+LC RC  AQ  +   S+     AVC R
Sbjct:   91 WPGFPVV-----PSGGNSGPCEAVLPKEDASQIGFPEGLTPAHL--------GEPGGHC-WAHHWCAAWSAGVWGQEGPELCG----VDKAIFSGISQRCSHCARFGASVPCRS-PGCSRLYHFPCATASGSFLSMKTLQLLCPEHSDGA-AHLEEARCAVCEGPGQLCDLLFCTSCGHHYHGACLD--TALTARKRASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCRACG---------AGSAELNPNSEWFENYSLCHRCHKAQGSQPVTSVAEQHPAVCSR 371          

HSP 2 Score: 202.601 bits (514), Expect = 3.327e-50
Identity = 111/197 (56.35%), Postives = 134/197 (68.02%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            TVVL    D FVL QD+CV CGSFG   +  LL C QC QCYH YC   SK+TKV++ KGWRC++C VCE CGQA++   LLLCDDCDISYHT+CLDPPL  VPKG WKC+ CV C  CG   PG +  WQN+YT C PCAS   CPVC+  Y + DL++ C  CER  HA C+ L TE E+E   +  G+ C+ C+
Sbjct: 1319 TVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVN-SKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPVCHAPYVEEDLLIQCRHCERWMHAGCESLFTEDEVEQAAD-EGFDCVSCQ 1513          

HSP 3 Score: 102.834 bits (255), Expect = 5.517e-20
Identity = 55/164 (33.54%), Postives = 79/164 (48.17%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAW 1483
            S+T +  L  + C+      +G    L++C+ C Q YH  C+    I    +  GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            ++ G +  W N+YT C  CA         C VC   +
Sbjct: 1324 SNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNS-KITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGA-----------ASPGFHCEWQNSYTHCGPCASL-----VTCPVCHAPY 1470          

HSP 4 Score: 82.4185 bits (202), Expect = 7.239e-14
Identity = 54/145 (37.24%), Postives = 76/145 (52.41%), Query Frame = 2
Query: 2321 VLC--RADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFC--GKRDPGPNGTWQNNYTTCAPCASKAQ 2743
            +LC   +D    LE+  C  C   G    LL C  CG  YH  C + +   +      W+C +C VC+ C +  N+  +L+C+ CD  YHTFCL PP+ ++P  SWKC+ C +C+ C  G  +  PN  W  NY+ C  C  KAQ
Sbjct:  212 LLCPEHSDGAAHLEEARCAVCEGPGQLCDLLFCTSCGHHYHGACLDTALTARK--RASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHTFCLKPPMEDLPAHSWKCKTCRLCRACGAGSAELNPNSEWFENYSLCHRC-HKAQ 353          

HSP 5 Score: 62.003 bits (149), Expect = 1.102e-7
Identity = 25/68 (36.76%), Postives = 45/68 (66.18%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG  STI+PVL+AN    N++    D  SR ++I KLWRK+ + ++  ++ K++ N++  +
Sbjct: 1962 RWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHR 2029          
BLAST of Histone-lysine N-methyltransferase 2C vs. UniProt/SwissProt
Match: sp|Q9QX66|DPF1_MOUSE (Zinc finger protein neuro-d4 OS=Mus musculus OX=10090 GN=Dpf1 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 8.583e-17
Identity = 40/91 (43.96%), Postives = 58/91 (63.74%), Query Frame = 2
Query: 1046 ERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            ++ G   DLISC  CG+  H +CL+  + ++  VR   WQC ECK+C +C  S+++ ++L CD CD+G+H YCL PPMA  P+  W C  C
Sbjct:  282 KKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 372          

HSP 2 Score: 60.077 bits (144), Expect = 1.723e-7
Identity = 43/112 (38.39%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 2330 RADDLFVLEQDICVSC--GSFGIDTP--LLCCVQCGQCYHSYCAEIS-KLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            +A D  V+    C  C  GS     P  L+ C  CG+  H  C + +  +T  +    W+C++C  C  CG + N+D LL CDDCD  YH +CL PP+ E P+GSW C  C+
Sbjct:  262 KAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCL 373          
BLAST of Histone-lysine N-methyltransferase 2C vs. TrEMBL
Match: A0A1S5XVZ9 (LPT OS=Schmidtea mediterranea OX=79327 GN=LPT PE=2 SV=1)

HSP 1 Score: 4444.8 bits (11527), Expect = 0.000e+0
Identity = 2582/2594 (99.54%), Postives = 2587/2594 (99.73%), Query Frame = 2
Query:   44 MSDEXXXXXXXXXXXXXXXKRHKIDIVNEEISDPSNTLRCKVDDEYFVNRIIQNNNPTNENDFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYXXXXXXXXXXXTADEISTASCALVAPSNGGASHHXXXXXXXXXXXXXXXYQCPTCHNRGSATSSEVASTHTSPMPGSYCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRXXXXXXXXXXXXXXXPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSKKRLQPVNXXXXXXXXXXXXXLKRNSTLNXXXXXXXXXXXXINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLKLSPSRMAGGNYSVDAHSFSSTGSNLNDDGDDCCPDNSNCFEMDNEAENFTAAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNHGILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHGAINSDLFXXXXXXXXXXXXXXXXXXXXXXXXLAYQNQTLTFXXXXXXXXXXXXXSFPDLEMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVNDIETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTNTAIPASQQLPDCNNQSPMRSELVMRPMHNTAXXXXXXXQLMQMKSPTAMQSKAPPMNVQISGDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHTEVSFQLQQVGNIXXXXXXXXXXXXPIRSYDNXXXXXXXXXXXXXAPQFIMCSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLESFXXXXXXXXXXXXHMILGRLHDPNVTVPVQCNQAXXXXXXXXXXXXXEGIGKPSNDSKQKVWMHSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKSAQQSPQSGIHQSPQKHFPVSMQQSPFNTGNQQFNKSNPQIMIHVGQMELPEKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDXXXXXXXXXXXXXXXXXXXXNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSXXXXXXXXXXXXLQSMQLSSPNKYVXXXXXXXXXXXXXXXXXGIINSALQSPPMPQKHNXXXXXXXXXXXMGINPDMINTSLPGVPKINQINSLQIGQMSYNKYEFIXXXXXXXXXXXXXXXXEFNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDSLRMXXXXXXXSLNASTHSVANPGTPSMIDSNEGAISSPSKQQYCEGSNMQMSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQXXXXXXXXXXXXXREKLMSTNIINQSNSEMIFSPPGQSSASLPSSPFHKEMATSDETTTKLRDVLXXXXXXXXXXXXXXXXXQQTYANSPSISAADSNLLAASPSSSEHGFNHTSIQLRSLAGGNNNNTAAVSMAATSGMESLPDHEMCINNNSSSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQTRQYQMPSGCYMDPQTQQKYSINPSSQQQYLILESSDVNAKLIP 7825
            MSDESKDSDLFDSMLSLSSKRHKIDIVNEEISDPSNTLRCKVDDEYFVNRIIQNNNPTNENDFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYSLSSSNSGGNGTADEISTASCALVAPSNGGASHHNSTNNSNSNTNSNTNYQCPTCHNRGSATSSEVASTHTSPMPGSYCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRSNSIDDSSTISGSTTPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSKKRLQPVNKGKSKTAGGKSSSLKRNSTLNSTKRSRRVKSRKINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEDLLLLCDDCDISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYGSKNSLLSSVGSSVDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSA+NSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLKLSPSRMAGGN+SVDAHSFSSTGSNLNDDGDDCCPDNSNCFEMDNEAENFTAAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNHGILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHG INSDLFSQVSSNNNSGSNNNSNN NS VVSLAYQNQTLTFDEDDEYLLDDYLLSFPDLEMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVNDIETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTNTAI ASQQLPDCNNQSPMRSELVMRPMHNTAGGTGGGGQL+QMKSPTAMQSKAPPMNVQISGDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHTEVSFQLQQVGNISSVSANQASFSSPIRSYDNQSLLQQKLQFSQSAPQFIMCSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLESFQGQPSNQQTQQQHMILGRLHDPNVTVPVQCNQAPPPPPYPSNSQPSEGIGKPSNDSKQKVW+HSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKSAQQSPQSGIHQSPQKHFPVSMQQSPFN GNQQFNKSNPQIMIHVGQMELPEKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDGSSGCGGTTPTPSTPTAPQSNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSKKKKTTPAMATALQSMQLSSPNKYVQQQSPSSIHQSPSPFQQGIINSALQSPPMPQKHNQFPQFIQQQQQMGIN DMI+TSLPGVPKINQINSLQIGQMSYNKYEFIPPPPSQQEQQQAIYQQEFNSQQQQQQPSIQMQVHPQQQQQQQAMMVSAQQQQQGLDSLRMQQQQLQQSLNASTHSVANPGTPSMIDSNEGAISSPSKQQYCEGSNMQMSNQQQQQQQYLQPLPPPTWPPAADLSSSAAAAAAAAMQAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQNPADNKLNNNNSNREKLMSTNIINQSNSEMIFSPPGQSSASLPSSPFHKEMATSDETTTKLRDVLNKRNSNSNSNSKPNSFSQQTYANSPSISAADSNLLAASPSSSEHGFNHTSIQLRSLAGGNNNNTAAVSMAATSGMESLPDHEMCINNNSSSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQTRQYQMPSGCYMDPQTQQKYSINPSSQQQYLILE SDVNAKLIP
Sbjct:    1 MSDESKDSDLFDSMLSLSSKRHKIDIVNEEISDPSNTLRCKVDDEYFVNRIIQNNNPTNENDFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYSLSSSNSGGNGTADEISTASCALVAPSNGGASHHNSTNNSNSNTNSNTNYQCPTCHNRGSATSSEVASTHTSPMPGSYCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRSNSIDDSSTISGSTTPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSKKRLQPVNKGKSKTAGGKSSSLKRNSTLNSTKRSRRVKSRKINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEDLLLLCDDCDISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYGSKNSLLSSVGSSVDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSAANSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLKLSPSRMAGGNFSVDAHSFSSTGSNLNDDGDDCCPDNSNCFEMDNEAENFTAAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNHGILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHGTINSDLFSQVSSNNNSGSNNNSNNNNSCVVSLAYQNQTLTFDEDDEYLLDDYLLSFPDLEMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVNDIETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTNTAISASQQLPDCNNQSPMRSELVMRPMHNTAGGTGGGGQLVQMKSPTAMQSKAPPMNVQISGDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHTEVSFQLQQVGNISSVSANQASFSSPIRSYDNQSLLQQKLQFSQSAPQFIMCSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLESFQGQPSNQQTQQQHMILGRLHDPNVTVPVQCNQAPPPPPYPSNSQPSEGIGKPSNDSKQKVWIHSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKSAQQSPQSGIHQSPQKHFPVSMQQSPFNPGNQQFNKSNPQIMIHVGQMELPEKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDGSSGCGGTTPTPSTPTAPQSNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSKKKKTTPAMATALQSMQLSSPNKYVQQQSPSSIHQSPSPFQQGIINSALQSPPMPQKHNQFPQFIQQQQQMGINSDMISTSLPGVPKINQINSLQIGQMSYNKYEFIPPPPSQQEQQQAIYQQEFNSQQQQQQPSIQMQVHPQQQQQQQAMMVSAQQQQQGLDSLRMQQQQLQQSLNASTHSVANPGTPSMIDSNEGAISSPSKQQYCEGSNMQMSNQQQQQQQYLQPLPPPTWPPAADLSSSAAAAAAAAMQAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQNPADNKLNNNNSNREKLMSTNIINQSNSEMIFSPPGQSSASLPSSPFHKEMATSDETTTKLRDVLNKRNSNSNSNSKPNSFSQQTYANSPSISAADSNLLAASPSSSEHGFNHTSIQLRSLAGGNNNNTAAVSMAATSGMESLPDHEMCINNNSSSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQTRQYQMPSGCYMDPQTQQKYSINPSSQQQYLILEPSDVNAKLIP 2594          
BLAST of Histone-lysine N-methyltransferase 2C vs. TrEMBL
Match: A0A4Z2DDF5 (Histone-lysine N-methyltransferase 2C OS=Schistosoma japonicum OX=6182 GN=EWB00_002126 PE=4 SV=1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 507/1273 (39.83%), Postives = 686/1273 (53.89%), Query Frame = 2
Query:  266 RCSLCALGPQNKFGQGEMLKFYS----SEIPVPSYIWSKDV-----------------NSNKRSDRIKL------------KDCQ--EYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCI-CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIA-LTG----NSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSK------WPGRKCSTCHKMVHMDCDPLLASMPSPVYXXXXXXXXXXXTADEISTASCALVAPSNGGASHHXXXXXXXXXXXXXXXYQCPTCHNRGSATSSEVAST----HTSPMPGSYCDEEIADDL----------DEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRXXXXXXXXXXXXX---XXPQTYCQSN-SSSKFQLP---MSRNNKDKPYES--------------NAAPSKKRLQPVNXXXXXXXXXXXXXLKRN---STLNXXXXXXXXXXXXINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLR-ATHGD----------SVAQTLVADKSVFSNLIGNSLEYXXXXXX-XXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDV---DSKQIKLESTEPLLNADGSVVASGNHLDEDSMQ--SIEGEINT---TDMKSPSVQS-DDG-SEIQSLPAHSASNSVNNYLPSSKTIGKAVMP---RNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLS 3754
            RC  C +G     GQGE+L+ Y+    SE P     + K V                 ++N+R+   K+            + C+   +  LD  +R +     G D KPCL  + NA+FD  GRPFGL++E  ++G P+ V                           ++ LK  +LL  + +  +       Y HH C +WS G   F+DQ+    + VE      +++ CSFCLR+GA+ISCR  + C   FH+ CA+ AGC QD  + +L CP H  EA  SN   I C+LCE  G + +L+ CTSCG HYH++CLEPPL  +PT+R GWQCAECKTCL+C+ESKDE KMLVCDVCDKG+HTYCL+PP++ IPKNG++C+ CRVC+DCG      ++ L G    N+    NVRWH+NYTLCDRC    +R +S C VCERAWRCSLP  +N   +       WPG +C+ C +MVH +CDP                     + ++ + +  +  +   GG                + NY CP C  RGS T SE AST      SP+PG         D+          D +DD     ++    + P   G  S  +   + S      +        ++      +P+++C+   ++SK QL    +SR+  D+P  S                  S  R   VN   S     K+ +LKR    +T N+  +SRR KSRKI   ESK +EEKD+HPSTVV CR+DD F+LEQDIC++CGS G+DTPLL C QCGQCYHS+CAE+ K+T+ +IEKGWRCLDCTVCEGCG  +NE LLLLCDDC+IS+HT+CLDPPL EVPKG WKC +CVVC  CG+RDPG NG W  NY+ CAPCAS + CPVC   Y + +L++ C +C R +HA CD L TE ELE   +  GY+C+LCR+ G DIG GH Q+L  R A +G+           + + L ADK     L  +   Y S     L+    + D  +S   ++ FFMD +VLSE GLNTI+ A+LK QP+R  N  +   ++ S    G     DS  ++L    P               DED+ Q   ++GE +    TD KSPS+QS +DG S +Q    +S   S N    S    GK  +    RNR   +LGIGGFRA+  R  Q KK  LA  ++         +T    T+   RRR  K+KSE+++N+PDYLM+AF G++LLS
Sbjct:   50 RCIFCGMGVNLNLGQGELLRIYTKIDYSEPPTWYSEFIKKVKVKQEKCTDILATNRSTHTNRRNQHSKVVIASFTPLVTDSESCKVGPHVSLDGCRRNRNKNFFGYDCKPCLAGMPNAYFDCNGRPFGLVEELNYIGWPSTVG--------------------------EDTLKVCNLL-VKCTPREGEEGGWIYAHHCCASWSNGV-HFNDQMV--LEGVEEAAVVAISRKCSFCLRYGASISCR-VSGCDSCFHFLCASGAGCLQDIETLELLCPVHISEALTSNRISIHCALCESFGDLAELLFCTSCGSHYHASCLEPPLQPNPTIRIGWQCAECKTCLICNESKDENKMLVCDVCDKGYHTYCLKPPVSCIPKNGFRCERCRVCSDCGGGRSSTLSGLEGPVAFNNQLNPNVRWHSNYTLCDRCFHAHKRPNSCCPVCERAWRCSLPIPENSYRNPNSTFLVWPGNRCNQCRRMVHAECDP---------------------SCNQTTVSPSSAASEETGGIG--------------SANYVCPVCRARGSTTPSEAASTTASLRASPIPGGGNSSHSGGDIMDDNFTQGSRDLLDDTVRQCMASGSLVCPGANGSTSANTPSSSTSNSTTPNTEPGKQQIQLNNQDYPGSPRSHCKVTCNNSKLQLTNSTISRSTPDQPSNSGRRRGSNQTIDPNFTKTNSTTRSSNVNIQTSSVGTTKTGALKRTNSCATSNNINKSRRTKSRKITTYESKVSEEKDDHPSTVVFCRSDDKFMLEQDICIACGSIGLDTPLLACSQCGQCYHSFCAEVPKITRTMIEKGWRCLDCTVCEGCGGTSNESLLLLCDDCNISFHTYCLDPPLKEVPKGGWKCADCVVCTNCGQRDPGLNGKWHANYSLCAPCASLSTCPVCNLAYREEELLVRCALCIRWAHANCDQLRTEDELELATD-LGYNCLLCRELGADIGTGHAQVLAYRQAANGNLGALESLKFGEITEKLFADK-----LPSSLFPYSSTGVTCLARSAHADDDNSSSSDTRQFFMDGIVLSECGLNTIKQALLKFQPKRHANQRRFSDQNQSITDTGSCSVGDSTPVELTPCGP-----------HGQFDEDTSQHSGVDGENDLSSYTDWKSPSLQSEEDGCSSVQDGTRNSLYMSRNGSTGSVSANGKTSIHNSNRNRPLKHLGIGGFRAKPNRWLQTKKMQLATASD--------PFTGPP-TSDSKRRRQNKRKSELEDNYPDYLMKAFYGANLLS 1230          

HSP 2 Score: 86.6557 bits (213), Expect = 1.056e-12
Identity = 40/77 (51.95%), Postives = 53/77 (68.83%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            ++RIN  KW+EDE LG +STIAPVL AN  H  +R Q  +   R +EI KLWR+L SEER  WV ++R N++T + N
Sbjct: 2235 SRRINYHKWEEDERLGGQSTIAPVLHANVSHPTLRGQYPEFTVRAKEISKLWRRLSSEERGTWVIQARNNRTTLRSN 2311          
BLAST of Histone-lysine N-methyltransferase 2C vs. TrEMBL
Match: A0A430QGW2 (Histone-lysine N-methyltransferase MLL3 OS=Schistosoma bovis OX=6184 GN=DC041_0010920 PE=4 SV=1)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 419/1068 (39.23%), Postives = 571/1068 (53.46%), Query Frame = 2
Query:  116 DIVNEEISDPSNTLRCKVDDEYFVNRIIQNNNPTNENDFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYS----SEIPV-----------------PSYIWSKDVNSNKRSDRIK--------LKDCQEYC------CLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDEN-LKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCI---CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIA-----LTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTK------NQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYXXXXXXXXXXXTADEISTASCALVAPSNGGASHHXXXXXXXXXXXXXXXYQCPTCHNRGSATSSEVAST----HTSPMPGSYCDEEIADDL----------DEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRXXXXXXXXXXXXX---XXPQTYCQSNSSSKFQLPMSRNNK---DKPYESNAAPSKK-----------------RLQPVNXXXXXXXXXXXXXLKR---NSTLNXXXXXXXXXXXXINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLR-ATHGD----------SVAQTLVADKSVFSNLI 3016
            D + E  SD  N        E+   +++ + +P +     +F  S+ +   C  C +      GQGE+L+FY+    SE P                     + ++  ++N+R+   K        L    E+C       LD  +R +     G D K CL  + NA+FD  GRPFGL++E  +VG P+                           ++DE+ LK ++L+  + +  +       Y HH C +WS G   F+DQ+    + VE      + + CS CLR+GA+I CR  ++C   FH+ CAA AGC QD  S +L CP H  EA  S+  CI   C LCE  G + +L+ CT CG HYH++CLEPPL  SPT+R GWQCAECKTCL+C+ESKDE KMLVCDVCDKG+HTYCL+PP+++IPKNG++C+ CRVC+DCG      ++     +  N+    NVRWH+NYTLCDRC    +R +S C VC+RAWRCSLP  +      N +   WPG KCS C +MVH +CDP                S    T   +STAS                     ++    TNY CP C  RGS T SE AST      SP+ G         D+          D +DD     +     + P   G  S  +   + S      +        ++      +P+ +C+  S++K  +  S N +   D+P  + ++  ++                 R   VN   S     K+ +LKR   ++T N+  ++RR K+RKI   ESK +E KD+HPSTVV CRADD F+LEQDIC++CGS G+DTPLL C QCGQCYHS+CA++ K+T+ +IEKGWRCLDCTVCEGCG  +NE LLLLCDDC+IS+HT+CLDPPL EVPKG WKC +CVVC  CG++DPG NG W  NY+ CAPCAS   CP+C   Y D +L++ C +C R +HA CD L TE ELE I    GY+C+LCR+ G D+G GH Q+L  R A +G+           + + L ADK V   LI
Sbjct:   11 DHLKESTSDVQNP-------EFSSKKVLSSFHPDDSQTLQNF--SDVSPPLCIFCGMNGNLNLGQGELLRFYTKIEYSEPPTWYSDFIIKVRSKQEKCTNILVTNRSTHTNRRNQHSKIVVASFTPLATDPEFCKVGPHISLDGCRRSRSKNCFGYDCKTCLAGMPNAYFDCSGRPFGLVEELNYVGWPS---------------------------KSDEDTLKVSNLI-VKCTPREGEEGGWIYAHHCCASWSNGV-HFNDQMV--LEGVEDAAVIAVTRKCSLCLRYGASIPCRV-SDCNSCFHFLCAAGAGCLQDIESLELLCPVHISEALTSS--CISIQCGLCESPGDLTELLFCTGCGSHYHASCLEPPLQPSPTIRIGWQCAECKTCLICNESKDENKMLVCDVCDKGYHTYCLKPPVSSIPKNGFRCERCRVCSDCGGGRSSTLSGLEGPVAFNNQLNPNVRWHSNYTLCDRCFHAHKRPNSCCPVCDRAWRCSLPVPENFYRNPNSTFLVWPGSKCSQCRRMVHAECDP----------------SSNQTTVSPLSTAS-------------------EETSGICCTNYVCPVCRARGSTTPSEAASTTASLRASPIQGGGNSSNSGGDIMDDNFTQGGRDLLDDTVRQCIGSGSLVCPGANGSTSANTPSSSTSNSTTPNTEPGKQQIHLNNQDYPGSPRVHCKVTSNNKSSVTNSTNGRPSIDQPSINISSGRRRGNNQTSDLNFAKTNSGTRSNNVNTQTSFIGTTKTGALKRTNSSATSNNINKNRRTKTRKITSYESKVSE-KDDHPSTVVFCRADDNFMLEQDICIACGSIGLDTPLLACSQCGQCYHSFCADVPKITRTMIEKGWRCLDCTVCEGCGGTSNESLLLLCDDCNISFHTYCLDPPLKEVPKGGWKCADCVVCTNCGQKDPGLNGKWHANYSVCAPCASLTTCPICNLAYRDEELLVRCALCTRWAHANCDQLRTEDELE-IATDLGYNCLLCRELGADLGTGHAQVLAYRQAANGNLGALENLKFGEITENLFADKLVSVILI 998          
BLAST of Histone-lysine N-methyltransferase 2C vs. TrEMBL
Match: A0A183LXJ9 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS8524 PE=4 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 6.511e-141
Identity = 308/729 (42.25%), Postives = 410/729 (56.24%), Query Frame = 2
Query: 1217 MLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIA-----LTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKN------QSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYXXXXXXXXXXXTADEISTASCALVAPSNGGASHHXXXXXXXXXXXXXXXYQCPTCHNRGSATSSEVAST----HTSPMPGSYCDE----EIADD------LDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRXXXXXXXXXXXXX---XXPQTYCQSNSSSKFQLPMSRNNK---DKPYESNAAPSKK-----------------RLQPVNXXXXXXXXXXXXXLKR---NSTLNXXXXXXXXXXXXINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLR-ATHGDSVAQTLVADKSVFSNLIGNSL-----EYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQ 3232
            MLVCDVCDKG+HTYCL+PP+++IPKNG++C+ CRVC+DCG      ++     +  N+    NVRWH+NYTLCDRC    +R +S C VC+RAWRCSLP  +N       +   WPG KCS C +MVH +CDP          S + +       A E ++  C                          TNY CP C  RGS T SE AST      SP+ G         +I DD       D +DD     +     + P   G  S  +   + S      +        ++      +P+ +C+ NS++K  +  S N +   D+P  + ++  ++                 R   VN   S     K+ +LKR   ++T N+  ++RR K+RKI   ESK +E KD+HPSTVV CRADD F+LEQDIC++CGS G+DTPLL C QCGQCYHS+CAE+ K+T+ +IEKGWRCLDCTVCEGCG  +NE LLLLCDDC+IS+HT+CLDPPL EVPKG WKC +CVVC  CG++DPG NG W  NY+ CAPCAS   CP+C   Y D +L++ C +C R +HA CD L TE ELE I    GY+C+LCR+ G D+G GH Q+L  R A +G+  A   +    +  NL  + L      Y S      +   + D  +S   ++ FFMD VVLSE GLNTI+ A+LK QP+R  N  KR+    +Q
Sbjct:    1 MLVCDVCDKGYHTYCLKPPVSSIPKNGFRCERCRVCSDCGGGRSSTLSGLEGPVAFNNQLNPNVRWHSNYTLCDRCFHAHKRPNSCCPVCDRAWRCSLPVPENFYRNPNSTFLVWPGSKCSQCRRMVHAECDP----------SSNQTTVSPLSAASEETSGICG-------------------------TNYVCPVCRARGSTTPSEAASTTASLRASPIQGGGNSSNSGGDIMDDNFTQGGRDLLDDTVRQCIGSGSLVCPGANGSTSANTPSSSTSNSTTPNTEPGKQQIHLNNQDYPGSPRVHCKVNSNNKSSVTNSTNGRPSIDQPSINISSGRRRGNNQTSDLNFAKTNSGTRSNNVNTQTSFIGTTKTGALKRTNSSATSNNINKNRRTKTRKITSYESKVSE-KDDHPSTVVFCRADDNFMLEQDICIACGSIGLDTPLLACSQCGQCYHSFCAEVPKITRTMIEKGWRCLDCTVCEGCGGTSNESLLLLCDDCNISFHTYCLDPPLKEVPKGGWKCADCVVCTNCGQKDPGLNGKWHANYSVCAPCASLTTCPICNLAYRDEELLVRCALCTRWAHANCDQLRTEDELE-IATDLGYNCLLCRELGADLGTGHAQVLAYRQAANGNLGALENLKFGEITGNLFADKLPSSLFPYSSTGVACLTRSQADDDNSSSSDTRQFFMDGVVLSECGLNTIKQALLKIQPKRHTN-QKRLSDQQNQ 691          

HSP 2 Score: 124.79 bits (312), Expect = 7.728e-25
Identity = 67/188 (35.64%), Postives = 93/188 (49.47%), Query Frame = 2
Query: 1022 EHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPL 1585
            E  IC  C   G    L++C+ CGQ YHS C E P I    +  GW+C +C  C  C  + +E  +L+CD C+  FHTYCL PP+  +PK GWKC  C VC +CG    PG+          N +WH NY++C  CA       + C +C  A+R            +    +C+ C +  H +CD L
Sbjct:  395 EQDICIACGSIGLDTPLLACSQCGQCYHSFCAEVPKITRTMIEKGWRCLDCTVCEGCGGTSNESLLLLCDDCNISFHTYCLDPPLKEVPKGGWKCADCVVCTNCG-QKDPGL----------NGKWHANYSVCAPCASL-----TTCPICNLAYR-----------DEELLVRCALCTRWAHANCDQL 555          
BLAST of Histone-lysine N-methyltransferase 2C vs. TrEMBL
Match: A0A4E0RYV2 (Putative Histone-lysine N-methyltransferase MLL3 OS=Fasciola hepatica OX=6192 GN=D915_001689 PE=4 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.488e-118
Identity = 253/532 (47.56%), Postives = 339/532 (63.72%), Query Frame = 2
Query: 2276 ESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRAT---HGDSV--------AQTLVADK---SVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQS-IEGEINTT---DMKSPSVQSDDGS------------EIQSLPAHSASN------SVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENF--TAKQGRRRP-VKKKSEIDENFPDYLMQAFLGSSLLS 3754
            ESKN ++KD+HPSTVVLCRADD FVLEQD+CV+CGSFG+D  LL C QCGQCYH +CA++ K+T+ ++E+GWRCLDCTVCEGCG  TNE LLLLCDDCDISYHT+CLDPPL EVPKG WKC  CVVC  CG+RDPG +G W  NY+ C+PCAS A CPVC   Y +G+L++ C +C R SHA CD L TE ELE   +  GY+C+LCR+ G  +GAGH Q+L+ R +   + D+V        A++L ADK   S+FSN  G+            +   +         ++ FFMD VVLSE+GLNTIR AMLK+QP+R   + +R        + G V++   + E+ E  L   GS    G   +E S QS ++ ++++T   D KSPS+QS+D +            E+Q   A S +N       VN      KT G A   ++RR  NLGIGGFR ++ R SQ KK+ L AV +  F+Q++   TI +   +A  G+RR  VK+K ++++++PDYLM+AF G+SL +
Sbjct:  811 ESKNADDKDDHPSTVVLCRADDKFVLEQDMCVACGSFGLDMMLLACAQCGQCYHPFCADVPKITRTMVERGWRCLDCTVCEGCGCTTNEGLLLLCDDCDISYHTYCLDPPLQEVPKGGWKCSECVVCNNCGQRDPGLHGKWHANYSLCSPCASLATCPVCTLAYREGELLIRCALCSRWSHAGCDQLRTEEELELASD-LGYNCLLCREAGATMGAGHIQVLNYRRSFSGNADTVDAIKWMEGAESLFADKTSPSMFSNTSGHCFGPFRGRGDEETPSLTE--------TRQFFMDGVVLSETGLNTIRQAMLKAQPKRPPTSQRRSSLQQGSHSSGGVETSSRQSETPE--LTPIGS---HGQPDEEASSQSALDADVDSTSYPDWKSPSLQSEDDASSIVANGANTPHELQRCTAVSRTNLTSLITGVNG-----KTNGAATGSKSRRLGNLGIGGFRVKTGRGSQTKKAQL-AVTSDLFNQSSIHGTINSHVDSAPAGKRRKGVKRKPDLEDSYPDYLMEAFYGASLFA 1322          

HSP 2 Score: 388.267 bits (996), Expect = 3.890e-104
Identity = 198/487 (40.66%), Postives = 270/487 (55.44%), Query Frame = 2
Query:  269 CSLCALGPQNKFGQGEMLKFYSSEIPVPSYIW---------------------SKDVNSNKRSDRIK---------LKDCQE-----YCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCI-CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSN-----VRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLP--------GTKNQSSSKWPGRKCSTCHKMVHMDCDP 1582
            C  C  G + KFGQG++ +F++ +      +W                     SK ++ ++R+             L DC +     +  LD  +RLKE K    DGKPCL  I NAFFD EGRPFG I+E  ++G PA   ++ +                         L  +HL+ ++ +  +       Y HH C +WS G   F+D++      VE   R  LNQ C+FC   GA+ISCR    C   FH+PCAA AGC Q+  + +L CP H  E  L   +   C+LCE  G  ++L+ CT CG HYHS+CLEPP+  +PT+R GWQCAECKTCL C+ESKDE KMLVCDVCDKGFHTYCL+PP+++IP+NG+KC+ CRVC DCG      ++   +  + +N     ++WH NYTLCDRC  +++R  +IC VCERAWRCSLP         +   S+  W G++C+ C +MVH DCDP
Sbjct:   80 CVFCGTGSRVKFGQGDLGRFHTPDESSDPPLWYHSLRKSLIERQERAQLTLQGSKPLHGSRRAQHGSALIASWSPLLTDCSDLFVGPHMSLDGARRLKEQKCTSLDGKPCLPGIPNAFFDGEGRPFGFIEELTYIGWPAPPPSEMA-------------------------LSLSHLV-FKCTPREGGEGGWIYAHHCCASWSNGV-HFNDEV--GLTGVEKAARAALNQTCAFCRHKGASISCR-YPGCDRFFHFPCAAGAGCLQEVETLELLCPMHLNETQLFGFNSTQCALCECLGDASELLFCTGCGSHYHSSCLEPPIQPNPTIRIGWQCAECKTCLFCNESKDENKMLVCDVCDKGFHTYCLRPPVSSIPRNGFKCERCRVCLDCGAGRAAFLSGLDSPVELTNLQLPIIKWHGNYTLCDRCFNSRKRPTAICPVCERAWRCSLPVPNYLSHSSSNPASALTWSGKRCTKCRRMVHADCDP 536          

HSP 3 Score: 123.25 bits (308), Expect = 1.043e-23
Identity = 67/191 (35.08%), Postives = 90/191 (47.12%), Query Frame = 2
Query: 1022 EHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGR---KCSTCHKMVHMDCDPL 1585
            E  +C  C   G    L++C  CGQ YH  C + P I    V  GW+C +C  C  C  + +E  +L+CD CD  +HTYCL PP+  +PK GWKC  C VCN+C           G  + G + +WH NY+LC  CA       + C VC  A+R               G    +C+ C +  H  CD L
Sbjct:  837 EQDMCVACGSFGLDMMLLACAQCGQCYHPFCADVPKITRTMVERGWRCLDCTVCEGCGCTTNEGLLLLCDDCDISYHTYCLDPPLQEVPKGGWKCSECVVCNNC-----------GQRDPGLHGKWHANYSLCSPCASL-----ATCPVCTLAYR--------------EGELLIRCALCSRWSHAGCDQL 997          

HSP 4 Score: 86.2705 bits (212), Expect = 1.538e-12
Identity = 69/240 (28.75%), Postives = 95/240 (39.58%), Query Frame = 2
Query: 2342 LFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPG----------------PNGTWQNNYTTCAPC-----ASKAQCPVC---------------YNNYNDGDLMLI----CDVCERSSHATCDHLNT-----------EAELEFIFEGGGYHCILCRDKG 2908
            LF      C  C   G  + LL C  CG  YHS C E        I  GW+C +C  C  C ++ +E+ +L+CD CD  +HT+CL PP++ +P+  +KC+ C VC  CG                     P   W  NYT C  C        A CPVC               +++ N    +      C  C R  HA CD   +            +E        GY C++CR +G
Sbjct:  333 LFGFNSTQCALCECLGDASELLFCTGCGSHYHSSCLEPPIQPNPTIRIGWQCAECKTCLFCNESKDENKMLVCDVCDKGFHTYCLRPPVSSIPRNGFKCERCRVCLDCGAGRAAFLSGLDSPVELTNLQLPIIKWHGNYTLCDRCFNSRKRPTAICPVCERAWRCSLPVPNYLSHSSSNPASALTWSGKRCTKCRRMVHADCDPAQSVGPSTGSPSSTPSEDANSSNSSGYTCVVCRVRG 572          

HSP 5 Score: 80.8777 bits (198), Expect = 6.209e-11
Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCN 6154
            KW+EDE LG  STIAPVL AN  H  +R  +    +R +E+ KLWR+L SEER  WV K+R N+++ K N
Sbjct: 2495 KWEEDERLGVHSTIAPVLHANVSHPTLREHVPQFAARAKEMNKLWRRLSSEERGTWVTKARNNRTSLKGN 2564          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Cavefish
Match: kmt2d (lysine methyltransferase 2D [Source:NCBI gene;Acc:103042576])

HSP 1 Score: 238.424 bits (607), Expect = 5.802e-62
Identity = 114/284 (40.14%), Postives = 163/284 (57.39%), Query Frame = 2
Query:  737 CFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEAD-LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPL 1585
            C +VH+ C  WSEG  Q   +      NV+  V +G+ Q C +C R GATI CR+K  C   +H+PC+AA+G FQ      L CP H  +A+ ++ E   C++C+  G ++ L+ CT CGQHYH  CLE  +  +P  R+GWQC ECK C  C +  ++ KMLVCD CDKG+HT+CLQP M ++P + WKC  CRVC DCG     G+ L G+       +W  +Y++C+ C   +R+  S+C VC +     +P            R+C+ CH+ VH +C  L
Sbjct:  123 CCWVHYWCAVWSEGVRQGEGE---ELINVDEAVISGIQQPCDYCKRMGATIRCRAK-GCSRFYHFPCSAASGSFQSMKQLALLCPEHIDKAEEIAGEEARCAVCDSAGELSGLLYCTGCGQHYHDACLE--ISATPLQRSGWQCPECKVCQTCRQPGEDSKMLVCDACDKGYHTFCLQPAMDSVPPDSWKCRRCRVCTDCGAR---GLTLPGSE------QWFESYSVCEGC---QRQRTSVCGVCSKVTESLVPLQ----------RRCTVCHRWVHSECSTL 378          

HSP 2 Score: 205.682 bits (522), Expect = 4.922e-52
Identity = 108/196 (55.10%), Postives = 133/196 (67.86%), Query Frame = 2
Query: 2315 TVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILC 2896
            TVVL    D FVL QD+CV CGSFG  ++  LL C QC QCYH YC   SK+TK+++ KGWRCL+C VCE CG+A++   LLLCDDCD+SYHT+CLDPPL+ VPKG WKC+ CV C  CG   PG +  WQNNY  C PCAS   CPVC  N+ + +L+L C  C+R  HA C+ L TE E+E   +  G+ C  C
Sbjct:  799 TVVLFSNTDKFVLLQDMCVVCGSFGRGVEGQLLACAQCAQCYHPYCVN-SKITKMMLRKGWRCLECIVCEVCGKASDPSRLLLCDDCDVSYHTYCLDPPLHTVPKGGWKCKWCVCCMHCGASSPGFHCEWQNNYNHCGPCASLVTCPVCRENFMEEELLLQCQHCDRWVHAVCESLYTEDEVEQASD-EGFACTAC 992          

HSP 3 Score: 103.99 bits (258), Expect = 2.886e-21
Identity = 54/147 (36.73%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            S+T +  L  + C+      +G    L++C  C Q YH  C+    I    +R GW+C EC  C VC ++ D  ++L+CD CD  +HTYCL PP+  +PK GWKC  C  C  CG            S+ G +  W NNY  C  CA
Sbjct:  804 SNTDKFVLLQDMCVVCGSFGRGVEGQLLACAQCAQCYHPYCVNS-KITKMMLRKGWRCLECIVCEVCGKASDPSRLLLCDDCDVSYHTYCLDPPLHTVPKGGWKCKWCVCCMHCGA-----------SSPGFHCEWQNNYNHCGPCA 938          

HSP 4 Score: 100.523 bits (249), Expect = 3.281e-20
Identity = 72/196 (36.73%), Postives = 95/196 (48.47%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRD---PGPNGTWQNNYTTCAPCASK--AQCPVCYNNYND-GDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGA 2923
            E+  C  C S G  + LL C  CGQ YH  C EIS     +   GW+C +C VC+ C Q   +  +L+CD CD  YHTFCL P ++ VP  SWKC+ C VC  CG R    PG +  W  +Y+ C  C  +  + C VC         L   C VC R  H+ C  L+   E + I       C +CR+   D+  
Sbjct:  215 EEARCAVCDSAGELSGLLYCTGCGQHYHDACLEISATP--LQRSGWQCPECKVCQTCRQPGEDSKMLVCDACDKGYHTFCLQPAMDSVPPDSWKCRRCRVCTDCGARGLTLPG-SEQWFESYSVCEGCQRQRTSVCGVCSKVTESLVPLQRRCTVCHRWVHSECSTLSELPEEKCI-------CFICRETPTDVAG 400          

HSP 5 Score: 60.4622 bits (145), Expect = 4.219e-8
Identity = 24/68 (35.29%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 5945 KWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            +W++DE LG+ STI+PVL+AN    N++    D  SR ++I K+WRK+ + ++  ++ K++ N++ ++
Sbjct: 1443 RWEKDEELGNLSTISPVLYANINFPNLKQDYPDWASRCKQIMKIWRKVSAADKVPFLQKAKDNRAAQR 1510          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Cavefish
Match: ENSAMXT00000030877.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:2040785:2064127:-1 gene:ENSAMXG00000042830.1 transcript:ENSAMXT00000030877.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.838 bits (525), Expect = 9.109e-56
Identity = 102/231 (44.16%), Postives = 133/231 (57.58%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            + H  C  WSEG  Q  DQ   +  NV+  + +G  + C++C R GA+I C  +  C   +HYPCA  AG FQDF    + C  H   A   S E   C LC+R G + D + CTSCG HYH  CL+  + +SP +RAGWQC ECK C  C    ++ KMLVCD+CDKG+HT+CLQP M +IP NGW+C +CRVC  CG                S+ +WH+N  LC+ CA
Sbjct:  232 WAHQQCALWSEGVCQAEDQ---SLLNVDRAIHSGSTEHCAYCKRLGASIKC-CEEGCGRSYHYPCAGGAGTFQDFRKLSVLCTEHVHLALSKSAEEANCVLCDRAGDLLDQLFCTSCGLHYHGLCLD--ISVSPLIRAGWQCPECKVCQTCKNPGEDTKMLVCDMCDKGYHTFCLQPVMDSIPTNGWRCKNCRVCVQCGTR--------------SSGQWHHNSLLCENCA 442          

HSP 2 Score: 96.6709 bits (239), Expect = 1.451e-19
Identity = 70/196 (35.71%), Postives = 99/196 (50.51%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASK---AQ-CPVCYNNYNDGDL---MLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIG 2920
            E+  CV C   G     L C  CG  YH  C +IS     +I  GW+C +C VC+ C     +  +L+CD CD  YHTFCL P ++ +P   W+C+NC VC  CG R    +G W +N   C  CA +   AQ CP+C  +  D ++   +L C  C+R  H  C+    E  +E +  G  Y C +C+  G + G
Sbjct:  322 EEANCVLCDRAGDLLDQLFCTSCGLHYHGLCLDIS--VSPLIRAGWQCPECKVCQTCKNPGEDTKMLVCDMCDKGYHTFCLQPVMDSIPTNGWRCKNCRVCVQCGTRS---SGQWHHNSLLCENCAGQPGPAQLCPLCTISL-DPEIHKDLLSCQHCKRWFHLECER-QVEGHVE-VQAGEDYVCSVCKHAGFEPG 509          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Cavefish
Match: dpf2l (zinc finger protein ubi-d4 [Source:NCBI gene;Acc:103044730])

HSP 1 Score: 87.4261 bits (215), Expect = 3.208e-17
Identity = 40/96 (41.67%), Postives = 61/96 (63.54%), Query Frame = 2
Query: 1046 ERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCND 1330
            ++ G   +L+SC+ CG+  H +CL+   ++   V+   WQC ECK C VC  S+++ ++L CD CD+G+H YCL PPM+  P+  W   SCR+C D
Sbjct:  275 QKTGQSEELVSCSDCGRSGHPSCLQFTAVMMAAVKTYRWQCIECKCCNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSW---SCRLCLD 367          

HSP 2 Score: 58.151 bits (139), Expect = 7.171e-8
Identity = 33/84 (39.29%), Postives = 52/84 (61.90%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEISKLTKVIIEK-GWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            L+ C  CG+  H  C + + +    ++   W+C++C  C  CG + N+D LL CDDCD  YH +CL PP+++ P+GSW C+ C+
Sbjct:  283 LVSCSDCGRSGHPSCLQFTAVMMAAVKTYRWQCIECKCCNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSWSCRLCL 366          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Cavefish
Match: dpf2l (zinc finger protein ubi-d4 [Source:NCBI gene;Acc:103044730])

HSP 1 Score: 87.4261 bits (215), Expect = 3.344e-17
Identity = 40/96 (41.67%), Postives = 61/96 (63.54%), Query Frame = 2
Query: 1046 ERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCND 1330
            ++ G   +L+SC+ CG+  H +CL+   ++   V+   WQC ECK C VC  S+++ ++L CD CD+G+H YCL PPM+  P+  W   SCR+C D
Sbjct:  295 QKTGQSEELVSCSDCGRSGHPSCLQFTAVMMAAVKTYRWQCIECKCCNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSW---SCRLCLD 387          

HSP 2 Score: 58.151 bits (139), Expect = 7.722e-8
Identity = 34/89 (38.20%), Postives = 53/89 (59.55%), Query Frame = 2
Query: 2387 GIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEK-GWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            G    L+ C  CG+  H  C + + +    ++   W+C++C  C  CG + N+D LL CDDCD  YH +CL PP+++ P+GSW C+ C+
Sbjct:  298 GQSEELVSCSDCGRSGHPSCLQFTAVMMAAVKTYRWQCIECKCCNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSWSCRLCL 386          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Cavefish
Match: dpf3 (zinc finger protein DPF3 [Source:NCBI gene;Acc:103031416])

HSP 1 Score: 85.8853 bits (211), Expect = 9.277e-17
Identity = 40/95 (42.11%), Postives = 58/95 (61.05%), Query Frame = 2
Query: 1037 SLCERKGG-VNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            S+  RK G   +L+SC+ CG+  H  CL+    +   VR   WQC ECK+C +C  S+++ ++L CD CD+G+H YCL+PPM   P+  W C  C
Sbjct:  281 SISNRKTGQAEELVSCSDCGRSGHPTCLQFTDNMMQAVRTYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLKPPMTEPPEGSWSCHLC 375          

HSP 2 Score: 59.6918 bits (143), Expect = 2.437e-8
Identity = 36/95 (37.89%), Postives = 53/95 (55.79%), Query Frame = 2
Query: 2369 VSCGSFGIDTPLLCCVQCGQCYHSYCAEIS-KLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            +S    G    L+ C  CG+  H  C + +  + + +    W+C++C  C  CG + N+D LL CDDCD  YH +CL PP+ E P+GSW C  C+
Sbjct:  282 ISNRKTGQAEELVSCSDCGRSGHPTCLQFTDNMMQAVRTYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLKPPMTEPPEGSWSCHLCL 376          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002602.1 (pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 gene:ENSPMAG00000002341.1 transcript:ENSPMAT00000002602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 6.208e-63
Identity = 150/446 (33.63%), Postives = 209/446 (46.86%), Query Frame = 2
Query:  257 NNMRCSLCALGPQNKFGQGEMLKFYSSE-IPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKP---CLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
             + RC  C    Q+  GQGE+ +F ++  +  P +  ++    ++R  + K K       +    R +         K    C +R          +    ++E   VGLP  V  +             L K    C                            + HH C  WSEG    S +L+    NV+  V   + Q C  C R GAT+ C  ++ C H +HYPCAA AG FQD  S  L CP H  +A  ++ E   C +C++ G +++ + CTSCGQHYH  CLE  +  S  +RAGWQC ECKT   C +  D+ KMLVCD CDKGFHTYCL+P M +IPKN WKC  CR C+DCG       + +  +  GS  RWH +Y+LC+RC Q +  G + C VC RA      G +  S+       C  C +MVH +C+
Sbjct:    1 TDERCVFCNRDEQSSLGQGELKRFNATPGLLTPVHYPTQKAAISRREQQTKFKTPSSAVPVLIGARQQHRHQEAVQAKAAVCCCSR-------TPAQALSALEELQRVGLPDDVAIRD------------LLKPTGHC----------------------------WAHHCCAAWSEGVC-LSPELE--LINVDRAVLAAVKQRCQHCRRLGATVKCWVES-CSHMYHYPCAAVAGTFQDIRSLALLCPDHVHQAVTIAGEEANCVVCDQPGELHNQLFCTSCGQHYHGRCLE--IAPSTAIRAGWQCPECKTNKKCMQPGDDSKMLVCDACDKGFHTYCLRPAMQSIPKNTWKCKHCRSCSDCG-------SRSAGAEPGS--RWHRDYSLCERCHQQRASGRA-CPVCGRAH-----GRRPASTLL----ACQRCSRMVHAECE 374          

HSP 2 Score: 206.453 bits (524), Expect = 3.375e-53
Identity = 107/208 (51.44%), Postives = 141/208 (67.79%), Query Frame = 2
Query: 2282 KNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGI--DTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCR 2899
            K    +D  P+TVVL   +D + L+QD+CV CGSFG+  +  LL C QCGQCYH YC   +K+T+V++ KGWRCL+CTVCE CG  ++   LLLCDDCDISYH +CL+PPL+ VPKG WKC+ CV C  CG  +PG    WQNN+T CAPC S + CPVC   Y +  L++ C  C+R  H +C+ L++E E+E   +  G+ C LCR
Sbjct:  777 KEEPSEDAMPNTVVLFSTNDKYTLKQDMCVVCGSFGLGAEGQLLACSQCGQCYHPYCVG-TKITRVVLSKGWRCLECTVCESCGLTSDPGRLLLCDDCDISYHIYCLEPPLHTVPKGGWKCKWCVCCLQCGASEPGFRCEWQNNHTQCAPCTSLSTCPVCSQAYREQQLIVQCRQCDRWMHGSCEGLHSEEEVEKAAD-DGFDCSLCR 982          

HSP 3 Score: 103.219 bits (256), Expect = 8.673e-22
Identity = 53/144 (36.81%), Postives = 70/144 (48.61%), Query Frame = 2
Query: 1055 GGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWR 1486
            G    L++C+ CGQ YH  C+    I    +  GW+C EC  C  C  + D  ++L+CD CD  +H YCL+PP+  +PK GWKC  C  C  C           G S  G    W NN+T C  C        S C VC +A+R
Sbjct:  814 GAEGQLLACSQCGQCYHPYCVGT-KITRVVLSKGWRCLECTVCESCGLTSDPGRLLLCDDCDISYHIYCLEPPLHTVPKGGWKCKWCVCCLQC-----------GASEPGFRCEWQNNHTQCAPCTSL-----STCPVCSQAYR 940          

HSP 4 Score: 102.064 bits (253), Expect = 1.848e-21
Identity = 68/194 (35.05%), Postives = 94/194 (48.45%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPG--PNGTWQNNYTTCAPC----ASKAQCPVC--YNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGI 2911
            E+  CV C   G     L C  CGQ YH  C EI+  T   I  GW+C +C   + C Q  ++  +L+CD CD  +HT+CL P +  +PK +WKC++C  C  CG R  G  P   W  +Y+ C  C    AS   CPVC   +       +L C  C R  HA C+    E+ +    +   Y C LCR + +
Sbjct:  210 EEANCVVCDQPGELHNQLFCTSCGQHYHGRCLEIAPST--AIRAGWQCPECKTNKKCMQPGDDSKMLVCDACDKGFHTYCLRPAMQSIPKNTWKCKHCRSCSDCGSRSAGAEPGSRWHRDYSLCERCHQQRASGRACPVCGRAHGRRPASTLLACQRCSRMVHAECE----ESGVRTGLDCRDYLCPLCRPRSL 397          

HSP 5 Score: 60.077 bits (144), Expect = 9.000e-9
Identity = 28/66 (42.42%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 5942 LKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKS 6139
            LKW+ DE LG+ +TI+ VL+AN     +R +  D  +R ++I KLWRK  +EER  ++ K+R N++
Sbjct: 1475 LKWERDEELGEMATISAVLYANINFPGLRHEFPDWPTRSKQIAKLWRKASTEERAPYLQKARDNRA 1540          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Sea Lamprey
Match: dpf2 (D4, zinc and double PHD fingers family 2 [Source:ZFIN;Acc:ZDB-GENE-041024-2])

HSP 1 Score: 81.6481 bits (200), Expect = 4.860e-16
Identity = 42/114 (36.84%), Postives = 65/114 (57.02%), Query Frame = 2
Query: 1013 LSNEHCICSLC-------ERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCND 1330
            L+N +  C  C       ++ G   +L+SC+ CG+  H +CL+    +   V+   WQC ECK C +C  S+++ ++L CD CD+G+H YCL P M+  P+  W   SCR+C D
Sbjct:  282 LANPNNYCDFCLGGSVENKKTGQPEELVSCSDCGRSGHPSCLQFTSNMIAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLSPAMSEPPEGSW---SCRLCLD 392          

HSP 2 Score: 60.077 bits (144), Expect = 4.141e-9
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 2
Query: 2282 KNNEEKDEHPSTVVLCRADDLFVLEQ-----------DIC----VSCGSFGIDTPLLCCVQCGQCYHSYCAEI-SKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            +  E+KD  P+T V  R++D    +            D C    V     G    L+ C  CG+  H  C +  S +   +    W+C++C  C  CG + N+D LL CDDCD  YH +CL P ++E P+GSW C+ C+
Sbjct:  253 EEGEDKDSRPATPVTRRSEDRKAKKGPDGLANPNNYCDFCLGGSVENKKTGQPEELVSCSDCGRSGHPSCLQFTSNMIAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLSPAMSEPPEGSWSCRLCL 391          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 62.3882 bits (150), Expect = 1.546e-9
Identity = 26/58 (44.83%), Postives = 35/58 (60.34%), Query Frame = 2
Query: 1160 QCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDC 1333
            Q  E   CLVC    +E K+L+CD CD  +HT+CL PP+  +PK  W+C  C V  +C
Sbjct:  309 QFIEMYVCLVCGRGDEEDKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKC-VAEEC 365          

HSP 2 Score: 50.447 bits (119), Expect = 6.572e-6
Identity = 31/51 (60.78%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 2498 LDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            ++  VC  CG+   ED LLLCD CD SYHTFCL PPL +VPKG W+C  CV
Sbjct:  311 IEMYVCLVCGRGDEEDKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCV 361          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 62.3882 bits (150), Expect = 1.852e-9
Identity = 25/51 (49.02%), Postives = 33/51 (64.71%), Query Frame = 2
Query: 1181 CLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDC 1333
            CLVC    DE K+L+CD CD  +HT+CL PP+  +PK  W+C  C V  +C
Sbjct:  323 CLVCGRGDDEAKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKC-VAQEC 372          

HSP 2 Score: 51.2174 bits (121), Expect = 4.609e-6
Identity = 37/71 (52.11%), Postives = 44/71 (61.97%), Query Frame = 2
Query: 2465 TKVIIEKGWRCL--DCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGK 2671
            T +I EK +  +  D   C  CG+  +E  LLLCD CD SYHTFCL PPL +VPKG W+C  C V Q C K
Sbjct:  305 TAIIPEKYFLRMKVDLYECLVCGRGDDEAKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKC-VAQECSK 374          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002322.1 (pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 gene:ENSPMAG00000002099.1 transcript:ENSPMAT00000002322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 2.859e-9
Identity = 30/77 (38.96%), Postives = 52/77 (67.53%), Query Frame = 2
Query: 5924 NKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQI--ADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKK 6148
            N+R N LKW++DE LG+ +T +PVL+AN    N++++   AD  +R ++I KLWRK  + E+  ++ K+R N++  +
Sbjct:  484 NQR-NILKWEKDELLGEMATTSPVLYANINFPNLKTEYPGADWPTRAKQIAKLWRKASASEKAPFLQKARDNRAAVR 559          

HSP 2 Score: 56.9954 bits (136), Expect = 8.176e-8
Identity = 32/94 (34.04%), Postives = 44/94 (46.81%), Query Frame = 2
Query:  743 YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNE 1024
            +VH +C  WS   S+  +   G   NVE   R GL   C  CLR GAT SC ++  C + +H+ CA    C   F    + CP+H   +    E
Sbjct: 3439 WVHLNCALWS---SEVYETQAGALINVEGARRRGLGTKCGACLRMGATTSC-NRPRCPNVYHFACALRMRCMF-FKDKTVLCPAHRPRSSTGQE 3527          

HSP 3 Score: 50.8322 bits (120), Expect = 6.952e-6
Identity = 58/253 (22.92%), Postives = 109/253 (43.08%), Query Frame = 2
Query: 3092 PDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFR----------------------ARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTA------KQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTE 3766
            P+P K +  D V L+E+GL  +++ ++   PR+ +    R++     D + ++ S  I+L                 N L+++    +  +I   + ++ +++ D+ SE  + P        ++ +  SK +  +V  R R     GIGGF                       ARS  ++    S +   ++    ++ P+  ++  TA      KQ +RR  KKKS +++ FP YL +AF G  LL  + E
Sbjct:   52 PEPPKVYSRDGVYLTETGLTQLQSLLVPPVPRKQRRPKLRLKLPGQPDLVTELQSP-IELH-------------PQSNPLEQEP---LPDDIKGGECQAETMECDNKSETFTSPERETQE--DSAVLCSKEV-DSVKKRKRNPYRPGIGGFMVRHRGRGGAMRGRGVSRRGTGGARSDSLTSPVASDIGRSDDVT-SEHLPETPMDEITATPEPIEKQKQRRWRKKKSALEDAFPTYLQEAFFGKGLLDTSKE 283          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 61.6178 bits (148), Expect = 1.584e-9
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 1181 CLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGY 1339
            C+VC ++ D K+ ++CD CDK FH YCL PP+  +P   W C++C V N  GY
Sbjct:  238 CIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSGDWICNTCIVGN--GY 288          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Nematostella
Match: EDO37587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA5])

HSP 1 Score: 187.963 bits (476), Expect = 3.930e-53
Identity = 90/215 (41.86%), Postives = 127/215 (59.07%), Query Frame = 2
Query:  665 TDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEAD-LSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKC 1306
            T +   F  +  +E+    + +D   + HH C +WSEG  Q +D  D    NV+  V   + + C+ C RFGA++ C+    C   +HYPCAA+AG FQ+  S  + CP H ++A  L      C LC     + +++ CTSCG+HYH  CL+P + ++  VR GWQC +CK C  C +  D+ KMLVCDVCD+G+HT+CL PPM  IPK GWKC
Sbjct:   56 TPDKYTFGTVKEHEVHEAFE-SDGSVWAHHCCASWSEGVCQ-TDSYD--LVNVDKAVYQAMTERCAHCSRFGASVVCQVP-RCGRTYHYPCAASAGAFQEIHSMTMLCPDHLEDAGRLGGAEAQCYLCGEAKEIAEMLFCTSCGRHYHGRCLDPAVEITSLVRMGWQCPDCKVCQGCRQPGDDNKMLVCDVCDRGYHTFCLDPPMTTIPKTGWKC 265          

HSP 2 Score: 75.485 bits (184), Expect = 2.350e-14
Identity = 39/91 (42.86%), Postives = 54/91 (59.34%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKC 2638
            C  CG       +L C  CG+ YH  C + +     ++  GW+C DC VC+GC Q  +++ +L+CD CD  YHTFCLDPP+  +PK  WKC
Sbjct:  175 CYLCGEAKEIAEMLFCTSCGRHYHGRCLDPAVEITSLVRMGWQCPDCKVCQGCRQPGDDNKMLVCDVCDRGYHTFCLDPPMTTIPKTGWKC 265          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Nematostella
Match: EDO37588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA6])

HSP 1 Score: 185.267 bits (469), Expect = 1.939e-52
Identity = 100/183 (54.64%), Postives = 124/183 (67.76%), Query Frame = 2
Query: 2363 ICVSCGSFGI--DTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDK 2905
            +C+ CGSFG   +  L+ C QCGQC+H YC  + K+ K+I+ KGWRCLDCT+CEGCG+ ++E  LLLCD CDISYHT+CLDPPL +VP G WKC+ CV C  CG    G    WQ+NYT C PCASK  CPVC   YN  DLM+ C  C+R  H +CD L TE E++   +  GY C+ CR K
Sbjct:    1 MCLCCGSFGKGPEGQLIVCSQCGQCFHPYCVGV-KVNKMILSKGWRCLDCTLCEGCGKGSDEARLLLCDSCDISYHTYCLDPPLEKVPPGGWKCKWCVSCDDCGATSAGTQCEWQSNYTQCGPCASKTSCPVCNIKYNLNDLMIQCLHCDRWLHGSCDGLMTEEEVDRAAD-YGYQCLYCRPK 181          

HSP 2 Score: 97.8265 bits (242), Expect = 3.429e-22
Identity = 53/138 (38.41%), Postives = 72/138 (52.17%), Query Frame = 2
Query: 1028 CICSLCERKGGVNDLISCTSCGQHYHSNCLEPP---LILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCA 1432
            C+C     KG    LI C+ CGQ +H  C+      +ILS     GW+C +C  C  C +  DE ++L+CD CD  +HTYCL PP+  +P  GWKC  C  C+DC           G ++ G+   W +NYT C  CA
Sbjct:    2 CLCCGSFGKGPEGQLIVCSQCGQCFHPYCVGVKVNKMILS----KGWRCLDCTLCEGCGKGSDEARLLLCDSCDISYHTYCLDPPLEKVPPGGWKCKWCVSCDDC-----------GATSAGTQCEWQSNYTQCGPCA 124          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Nematostella
Match: EDO41238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z1])

HSP 1 Score: 85.5001 bits (210), Expect = 1.988e-17
Identity = 40/102 (39.22%), Postives = 60/102 (58.82%), Query Frame = 2
Query: 1022 EHCICSLCERK--GGVNDLISCTSCGQHYHSNCLE-PPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCR 1318
            + C+  + E K  G   +L+SC+ CG+  H +CL+  P +     +  WQC ECK+C +C  S ++ ++L CD CD+G+H YCL PPM   P+  W C  CR
Sbjct:  193 DFCLGDVSENKKSGRPEELLSCSDCGRSGHPSCLQFTPKLTYNVKKYRWQCIECKSCTLCGTSDNDDQLLFCDDCDRGYHMYCLNPPMDKPPEGHWMCSLCR 294          

HSP 2 Score: 59.6918 bits (143), Expect = 5.871e-9
Identity = 37/88 (42.05%), Postives = 53/88 (60.23%), Query Frame = 2
Query: 2387 GIDTPLLCCVQCGQCYHSYCAEIS-KLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNC 2647
            G    LL C  CG+  H  C + + KLT  + +  W+C++C  C  CG + N+D LL CDDCD  YH +CL+PP+++ P+G W C  C
Sbjct:  206 GRPEELLSCSDCGRSGHPSCLQFTPKLTYNVKKYRWQCIECKSCTLCGTSDNDDQLLFCDDCDRGYHMYCLNPPMDKPPEGHWMCSLC 293          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Nematostella
Match: EDO37592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFB0])

HSP 1 Score: 77.7962 bits (190), Expect = 5.315e-17
Identity = 36/92 (39.13%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 1034 CSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCD 1309
            C  C+  G    L+ CT CG HYH +C  PP+  +  VR GW+C  CK+C  C +    +++L C  CDK +H YC+ P      K  WKC+
Sbjct:    2 CDKCKMGGDPEQLLLCTRCGYHYHGDCCTPPVRPTEQVRKGWECLMCKSCQSCRQLSSPERLLSCMSCDKAYHLYCIDPLGTNKGKMHWKCE 93          

HSP 2 Score: 49.6766 bits (117), Expect = 4.460e-7
Identity = 34/92 (36.96%), Postives = 44/92 (47.83%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQ 2641
            C  C   G    LL C +CG  YH  C          + KGW CL C  C+ C Q ++ + LL C  CD +YH +C+DP      K  WKC+
Sbjct:    2 CDKCKMGGDPEQLLLCTRCGYHYHGDCCTPPVRPTEQVRKGWECLMCKSCQSCRQLSSPERLLSCMSCDKAYHLYCIDPLGTNKGKMHWKCE 93          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Nematostella
Match: EDO39741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S985])

HSP 1 Score: 80.4925 bits (197), Expect = 5.188e-16
Identity = 37/81 (45.68%), Postives = 52/81 (64.20%), Query Frame = 2
Query: 1049 RKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIP 1288
            ++G   +LISC  CG   H +CL+    L+  V++  WQC ECKTC VC ++ D   +L CD+CD+GFH  CL PPM+ +P
Sbjct:  190 KEGDYEELISCADCGNSGHPSCLKYSPALTARVQSEPWQCIECKTCSVCRDAGDADNLLFCDMCDRGFHMECLDPPMSEMP 270          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Medaka
Match: ENSORLT00000037146.1 (pep primary_assembly:ASM223467v1:7:12299712:12301718:-1 gene:ENSORLG00000025265.1 transcript:ENSORLT00000037146.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.453 bits (524), Expect = 2.512e-58
Identity = 108/250 (43.20%), Postives = 148/250 (59.20%), Query Frame = 2
Query:  728 NDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCER 1477
            +DS  +VHH C  WSEG +Q  D+     +NV+  + +G  Q+C +C RFGATI C  +  C   +H+PC+AA+G FQ      L CP H  +A+   E   C++C+  G + DL+ CT CG HYH+ CL+     +P +RAGWQC ECK C  C   +D  KMLVCD C+KG HT+CLQP M ++P + WKC SCRVC +CG     G+ L G +      +W  +YTLC+ C   +    SIC VC +
Sbjct:   81 DDSGCWVHHWCAAWSEGVNQTEDE---ELENVDKAIISGTQQICEYCKRFGATIRCHIE-GCTRFYHFPCSAASGSFQSMKELLLLCPEHFNKAEELGEDSWCAVCDSAGDLTDLLFCTGCGLHYHATCLDTG--ATPILRAGWQCPECKVCQTCQPGED-SKMLVCDSCEKGCHTFCLQPAMDSVPSDRWKCRSCRVCMECGVH---GLVLPGTA------QWFESYTLCEGCQHHRS---SICCVCSK 311          

HSP 2 Score: 73.559 bits (179), Expect = 5.931e-13
Identity = 56/154 (36.36%), Postives = 74/154 (48.05%), Query Frame = 2
Query: 2354 EQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGT--WQNNYTTCAPCA--SKAQCPVCYNNYNDGDLMLICDVC 2803
            E   C  C S G  T LL C  CG  YH+ C +       I+  GW+C +C VC+ C Q   +  +L+CD C+   HTFCL P ++ VP   WKC++C VC  CG       GT  W  +YT C  C     + C VC    N    +  C +C
Sbjct:  175 EDSWCAVCDSAGDLTDLLFCTGCGLHYHATCLDTG--ATPILRAGWQCPECKVCQTC-QPGEDSKMLVCDSCEKGCHTFCLQPAMDSVPSDRWKCRSCRVCMECGVHGLVLPGTAQWFESYTLCEGCQHHRSSICCVCSKPDNPSVSLQCCSLC 325          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Medaka
Match: ENSORLT00000020985.2 (pep primary_assembly:ASM223467v1:17:25344123:25371829:1 gene:ENSORLG00000016772.2 transcript:ENSORLT00000020985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 9.629e-53
Identity = 117/318 (36.79%), Postives = 164/318 (51.57%), Query Frame = 2
Query:  644 AINSCDETDENLKFAHLLSYELSANDQCNDSCF-----YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            A++   E D   +F   LSY     D    S F     + H SC  WS+G  +   Q   +  NV+  + +G  + C++C R GA+I C ++  C   +HYPCA AAG FQD  S  L CP H + A     +   C LC+  G + D + CTSCG HYH  CL+  + ++P  RAGWQC ECK C  C    D+ KMLVCD+CDKG+HT+CLQP M ++P NGW+C +CRVC  CG                ++  WH+N  LC+ C Q +       A+C     C L    ++         C TC + +H++C+
Sbjct:  212 AVSCKAEPDLASRFWDELSYVGLPKDLEVQSLFESGKCWAHESCALWSDGVCKSEGQ---SLLNVDRAIDSGSTKHCAYCKRLGASIKCCAE-GCAQLYHYPCAGAAGTFQDIRSLSLLCPDHIEVAIHKFVDDVNCVLCDSPGDLLDQLFCTSCGLHYHGMCLD--MAVTPLRRAGWQCPECKVCQTCKNHGDDTKMLVCDMCDKGYHTFCLQPAMESLPTNGWRCKNCRVCIQCGTR--------------TSGHWHHNSLLCENCFQNQDP-----ALCCSMCSCILDPEHHKDL-----LFCQTCKRWLHLECE 499          

HSP 2 Score: 88.1965 bits (217), Expect = 9.734e-17
Identity = 71/226 (31.42%), Postives = 101/226 (44.69%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTC---------APCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGI-------DIGAGHKQLLHLRATHGDSVAQTLVADK 2995
            CV C S G     L C  CG  YH  C +++     +   GW+C +C VC+ C    ++  +L+CD CD  YHTFCL P +  +P   W+C+NC VC  CG R    +G W +N   C         A C S   C +   ++ D   +L C  C+R  H  C+  N+  + E I     Y C  CR           D+  G +  L   + H DS     +A+K
Sbjct:  344 CVLCDSPGDLLDQLFCTSCGLHYHGMCLDMA--VTPLRRAGWQCPECKVCQTCKNHGDDTKMLVCDMCDKGYHTFCLQPAMESLPTNGWRCKNCRVCIQCGTRT---SGHWHHNSLLCENCFQNQDPALCCSMCSCILDPEHHKD---LLFCQTCKRWLHLECERQNS-GQTE-INPREDYVCFNCRSPAAEQALLTEDMDLGPELRLQPASMHTDSETGLQLAEK 559          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Medaka
Match: ENSORLT00000032718.1 (pep primary_assembly:ASM223467v1:17:25342809:25371829:1 gene:ENSORLG00000016772.2 transcript:ENSORLT00000032718.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 9.629e-53
Identity = 117/318 (36.79%), Postives = 164/318 (51.57%), Query Frame = 2
Query:  644 AINSCDETDENLKFAHLLSYELSANDQCNDSCF-----YVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEA-DLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCD 1579
            A++   E D   +F   LSY     D    S F     + H SC  WS+G  +   Q   +  NV+  + +G  + C++C R GA+I C ++  C   +HYPCA AAG FQD  S  L CP H + A     +   C LC+  G + D + CTSCG HYH  CL+  + ++P  RAGWQC ECK C  C    D+ KMLVCD+CDKG+HT+CLQP M ++P NGW+C +CRVC  CG                ++  WH+N  LC+ C Q +       A+C     C L    ++         C TC + +H++C+
Sbjct:  212 AVSCKAEPDLASRFWDELSYVGLPKDLEVQSLFESGKCWAHESCALWSDGVCKSEGQ---SLLNVDRAIDSGSTKHCAYCKRLGASIKCCAE-GCAQLYHYPCAGAAGTFQDIRSLSLLCPDHIEVAIHKFVDDVNCVLCDSPGDLLDQLFCTSCGLHYHGMCLD--MAVTPLRRAGWQCPECKVCQTCKNHGDDTKMLVCDMCDKGYHTFCLQPAMESLPTNGWRCKNCRVCIQCGTR--------------TSGHWHHNSLLCENCFQNQDP-----ALCCSMCSCILDPEHHKDL-----LFCQTCKRWLHLECE 499          

HSP 2 Score: 88.1965 bits (217), Expect = 9.734e-17
Identity = 71/226 (31.42%), Postives = 101/226 (44.69%), Query Frame = 2
Query: 2366 CVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTC---------APCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGI-------DIGAGHKQLLHLRATHGDSVAQTLVADK 2995
            CV C S G     L C  CG  YH  C +++     +   GW+C +C VC+ C    ++  +L+CD CD  YHTFCL P +  +P   W+C+NC VC  CG R    +G W +N   C         A C S   C +   ++ D   +L C  C+R  H  C+  N+  + E I     Y C  CR           D+  G +  L   + H DS     +A+K
Sbjct:  344 CVLCDSPGDLLDQLFCTSCGLHYHGMCLDMA--VTPLRRAGWQCPECKVCQTCKNHGDDTKMLVCDMCDKGYHTFCLQPAMESLPTNGWRCKNCRVCIQCGTRT---SGHWHHNSLLCENCFQNQDPALCCSMCSCILDPEHHKD---LLFCQTCKRWLHLECERQNS-GQTE-INPREDYVCFNCRSPAAEQALLTEDMDLGPELRLQPASMHTDSETGLQLAEK 559          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Medaka
Match: ENSORLT00000032975.1 (pep primary_assembly:ASM223467v1:7:12296688:12299149:-1 gene:ENSORLG00000028475.1 transcript:ENSORLT00000032975.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 1.128e-31
Identity = 71/116 (61.21%), Postives = 86/116 (74.14%), Query Frame = 2
Query: 2300 DEHPSTVVLCRADDLFVLEQDICVSCGSFG--IDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQ 2641
            D   +TVVL    D FVL QD+CV CGSFG  ++  LL C QC QCYH YC   SK+TK ++ KGWRCL+C VCE CG+A++   LLLCDDCD+SYHT+CLDPPL+ VPKG WKC+
Sbjct:  335 DTMQNTVVLFSNTDKFVLLQDMCVVCGSFGKGVEGQLLACAQCAQCYHPYCVN-SKITKTMLRKGWRCLECIVCEVCGEASDPSRLLLCDDCDVSYHTYCLDPPLHTVPKGGWKCK 449          

HSP 2 Score: 90.1225 bits (222), Expect = 6.302e-18
Identity = 43/105 (40.95%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  992 SHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKC 1306
            S+T +  L  + C+      KG    L++C  C Q YH  C+    I    +R GW+C EC  C VC E+ D  ++L+CD CD  +HTYCL PP+  +PK GWKC
Sbjct:  345 SNTDKFVLLQDMCVVCGSFGKGVEGQLLACAQCAQCYHPYCVNSK-ITKTMLRKGWRCLECIVCEVCGEASDPSRLLLCDDCDVSYHTYCLDPPLHTVPKGGWKC 448          
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Medaka
Match: dpf1 (double PHD fingers 1 [Source:NCBI gene;Acc:101156029])

HSP 1 Score: 87.8113 bits (216), Expect = 1.344e-17
Identity = 39/91 (42.86%), Postives = 58/91 (63.74%), Query Frame = 2
Query: 1046 ERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            ++ G   DLISC  CG+  H +CL+  + ++  VR   WQC ECK+C +C  S+++ ++L CD CD+G+H YCL PPM+  P+  W C  C
Sbjct:  238 KKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMSEPPEGSWSCHLC 328          

HSP 2 Score: 60.4622 bits (145), Expect = 1.085e-8
Identity = 35/84 (41.67%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 2402 LLCCVQCGQCYHSYCAEIS-KLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            L+ C  CG+  H  C + +  +T  +    W+C++C  C  CG + N+D LL CDDCD  YH +CL PP++E P+GSW C  C+
Sbjct:  246 LISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMSEPPEGSWSCHLCL 329          
BLAST of Histone-lysine N-methyltransferase 2C vs. Planmine SMEST
Match: SMESG000040592.1 (SMESG000040592.1)

HSP 1 Score: 4387.41 bits (11378), Expect = 0.000e+0
Identity = 2494/2600 (95.92%), Postives = 2516/2600 (96.77%), Query Frame = 2
Query:   44 MSDEXXXXXXXXXXXXXXXKRHKIDIVNEEISDPSNTLRCKVDDEYFVNRIIQNNNPTNENDFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYXXXXXXXXXXXTADEISTASCALVAPSNGGASHHXXXXXXXXXXXXXXX----YQCPTCHNRGSATSSEVASTHTSPMPGSYCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRXXXXXXXXXXXXXXXPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSKKRLQPVNXXXXXXXXXXXXXLKRNSTLNXXXXXXXXXXXXINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYXXXXXXXXXXXXXXDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLKLSPSRMAGGNYSVDAHSFSSTGSNLNDDGDDCCPDNSNCFEMDNEAENFTAAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNHGILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHGAINSDLFXXXXXXXXXXXXXXXXXXXXXXXXLAYQNQTLTFXXXXXXXXXXXXXSFPDLEMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVNDIETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTNTAIPASQQLPDCNNQSPMRSELVMRPMHNTAXXXXXXXQLMQMKSPTAMQSKAPPMNVQISGDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHTEVSFQLQQVGNIXXXXXXXXXXXXPIRSYDNXXXXXXXXXXXXXAPQFIMCSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLESFXXXXXXXXXXXXHMILGRLHDPNVTVPVQCNQAXXXXXXXXXXXXXEGIGKPSNDSKQKVWMHSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKSAQQSPQSGIHQSPQKHFPVSMQQSPFNTGNQQFNKSNPQIMIHVGQMELPEKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDXXXXXXXXXXXXXXXXXXXXNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSXXXXXXXXXXXXLQSMQLSSPNKYVXXXXXXXXXXXXXXXXXGIINSALQSPPMPQKHNXXXXXXXXXXXMGINPDMINTSLPGVPKINQINSLQIGQMSYNKYEFIXXXXXXXXXXXXXXXXEFNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDSLRMXXXXXXXSLNASTHSVANPGTPSMIDSNEGAISSPSKQQYCEGSNMQMSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQXXXXXXXXXXXXXREKLMSTNIINQSNSEMIFSPPGQSSASLPSSPFHKEMATSDETTTKLRDVLXXXXXXXXXXXXXX--XXXQQTYANSPSISAADSNLLAASPSSSEHGFNHTSIQLRSLAGGNNNNTAAVSMAATSGMESLPDHEMCINNNSSSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQTRQYQMPSGCYMDPQTQQKYSINPSSQQQYLILESSDVNAKLIP 7825
            MSDESKDSDLFDSMLSLSSKRHKIDIVNEEISDPSNTLRCKV+DEYFVNRIIQNNNPTNEN+FDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPA VTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYSLSSSNSGGNGTADEISTASCALVAPSNGGASHHNS +N+NSNTNSNTN    YQCPTCHNRGSATSSEVASTHTSPMPGSYCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRSNSIDDSSTISGSTTPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSKKRLQPVNKGKSKTAGGKSSSLKRNSTLNSTKRSRRVKSRKINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEDLLLLCDDCDISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYGSKNSLLSSVGSSVDGP SPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSA+NSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLKLSPSRMAGGNYSVDAHSFSSTGSNLNDDGDDCCPD+ NCFEMDNEAENFTAAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNHGILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHG INSDLF     +  S SNNNSNN NS VVSLAYQNQTLTFDEDDEYLLDDYLLSFPDLEMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVNDIETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTNTAI ASQQLPDCNNQSPMRSELVMRPMHNTAGGTGGGGQL+QMKSPTAMQSKAPPMNVQI+GDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHTEVSFQLQQVGNISSVSANQASFSSPIRSYDNQSLLQQKLQFSQSAPQFIMCSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLESFQGQPSNQQTQQQHMILGRLHDPNVTVP+QCNQAPPPPPYPSNSQPSEGIGKPSNDSKQKVWMHSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKSAQQSPQSGIHQSPQKHFPVSMQQSPFN GNQQFNKSNPQIMIHVGQMELPEKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDGSSGCGGTTPTPSTPTAPQSNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSKKKKTTPA ATA+QSMQLSSPNKYVQQQSPSSIHQSPSPFQQGIINSALQSPPMPQKHNQFPQFIQQQQQMGINPDMI+TSLPGVPKINQIN+LQIGQMSYNKYEFIPPPPSQ              +QQQ     +     QQQQ    M V  QQQQQGLDSLRMQQQQ QQSLNASTHSVANPGTPSMIDSNEGAISSPSKQQYC+GSN+QMSN     QQ  Q L P   P     +  +A AAAAAMQAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQNPADNKLNNNNSNREKLMS NIINQSNSEMIFSPPGQSSASLPSSPFHKEMATSDETTTKLRDVLNKRNSN+NSN+     SF+QQTYANSPSISAADSNLLAASPSSSEHGFN TSIQLRSLAGG NNNTAAVSMAATSGMESLPDHEMCINNNSSSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQTRQYQMPSGCYMDPQ QQKYSINPSSQQQYLILE SDVNAKLIP
Sbjct:    1 MSDESKDSDLFDSMLSLSSKRHKIDIVNEEISDPSNTLRCKVEDEYFVNRIIQNNNPTNENEFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEIPVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPCLNRIVNAFFDNEGRPFGLIDEFAWVGLPATVTTQKSSTGAGSNNSSLLWKAINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFSDQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAAAAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNVRWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKCSTCHKMVHMDCDPLLASMPSPVYSLSSSNSGGNGTADEISTASCALVAPSNGGASHHNSNSNTNSNTNSNTNSNTNYQCPTCHNRGSATSSEVASTHTSPMPGSYCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGYRSNSIDDSSTISGSTTPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSKKRLQPVNKGKSKTAGGKSSSLKRNSTLNSTKRSRRVKSRKINVCESKNNEEKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEDLLLLCDDCDISYHTFCLDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQCPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCILCRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYGSKNSLLSSVGSSVDGPMSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRAQNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDSMQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSAANSVNNYLPSSKTIGKAVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIENFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLKLSPSRMAGGNYSVDAHSFSSTGSNLNDDGDDCCPDSGNCFEMDNEAENFTAAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNHGILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHGTINSDLF-----SQVSSSNNNSNNNNSCVVSLAYQNQTLTFDEDDEYLLDDYLLSFPDLEMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVNDIETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTNTAISASQQLPDCNNQSPMRSELVMRPMHNTAGGTGGGGQLVQMKSPTAMQSKAPPMNVQITGDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHTEVSFQLQQVGNISSVSANQASFSSPIRSYDNQSLLQQKLQFSQSAPQFIMCSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLESFQGQPSNQQTQQQHMILGRLHDPNVTVPLQCNQAPPPPPYPSNSQPSEGIGKPSNDSKQKVWMHSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKSAQQSPQSGIHQSPQKHFPVSMQQSPFNPGNQQFNKSNPQIMIHVGQMELPEKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDGSSGCGGTTPTPSTPTAPQSNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIADPESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSKKKKTTPATATAMQSMQLSSPNKYVQQQSPSSIHQSPSPFQQGIINSALQSPPMPQKHNQFPQFIQQQQQMGINPDMISTSLPGVPKINQINALQIGQMSYNKYEFIPPPPSQ-------------QEQQQAIYQQEFNSQQQQQQPSIQMQVHPQQQQQGLDSLRMQQQQQQQSLNASTHSVANPGTPSMIDSNEGAISSPSKQQYCDGSNIQMSN-----QQQQQYLQPLPPPTWPPAADLSAVAAAAAMQAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQNPADNKLNNNNSNREKLMSANIINQSNSEMIFSPPGQSSASLPSSPFHKEMATSDETTTKLRDVLNKRNSNTNSNTNSKPNSFNQQTYANSPSISAADSNLLAASPSSSEHGFNQTSIQLRSLAGG-NNNTAAVSMAATSGMESLPDHEMCINNNSSSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQTRQYQMPSGCYMDPQIQQKYSINPSSQQQYLILEPSDVNAKLIP 2576          
BLAST of Histone-lysine N-methyltransferase 2C vs. Planmine SMEST
Match: SMESG000031948.1 (SMESG000031948.1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.109e-15
Identity = 43/116 (37.07%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  977 QLWCPSHTQEADLSNEHCICSLCERK--GGVNDLISCTSCGQHYHSNCLEPPLILSPTV-RAGWQCAECKTCLVCSESKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSC 1315
            +L  PS      +S + C+ +  E K  G    +I C+ C +  H +CL     +  +V R  WQC ECK C +C  ++++ +ML CD CD+G+H YCLQPP++  P   W CD C
Sbjct:  288 RLHDPSPVTPNKISCDFCLGNETENKKTGLREQMIKCSDCDRSAHPSCLNFSENMRFSVTRYRWQCLECKMCSMCGTAENDDEMLFCDDCDRGYHMYCLQPPLSQPPAGNWSCDLC 403          

HSP 2 Score: 59.3066 bits (142), Expect = 2.495e-8
Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 2
Query: 2387 GIDTPLLCCVQCGQCYHSYCAEISKLTKVIIEK-GWRCLDCTVCEGCGQATNEXXXXXXXXXXISYHTFCLDPPLNEVPKGSWKCQNCV 2650
            G+   ++ C  C +  H  C   S+  +  + +  W+CL+C +C  CG A N+D +L CDDCD  YH +CL PPL++ P G+W C  C+
Sbjct:  316 GLREQMIKCSDCDRSAHPSCLNFSENMRFSVTRYRWQCLECKMCSMCGTAENDDEMLFCDDCDRGYHMYCLQPPLSQPPAGNWSCDLCI 404          
BLAST of Histone-lysine N-methyltransferase 2C vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 78.9518 bits (193), Expect = 6.025e-14
Identity = 44/109 (40.37%), Postives = 57/109 (52.29%), Query Frame = 2
Query: 1037 SLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSE-SKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGI 1357
            +L +R     ++I+C  CG   H  CL+ P  L   VR   WQC +CK C  C   S+ +  ML+CD CD+GFH YC  PP+  +PK  W C  CR     G   KP I
Sbjct:  197 ALNKRTKRQENMINCWDCGTCAHPTCLQWPDSLFQKVRTIRWQCLQCKRCSYCGMISRKDDDMLLCDACDQGFHIYCCDPPIKNLPKGEWVCRICRPTG--GRKEKPSI 303          
BLAST of Histone-lysine N-methyltransferase 2C vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 78.9518 bits (193), Expect = 6.027e-14
Identity = 44/109 (40.37%), Postives = 57/109 (52.29%), Query Frame = 2
Query: 1037 SLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSE-SKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGI 1357
            +L +R     ++I+C  CG   H  CL+ P  L   VR   WQC +CK C  C   S+ +  ML+CD CD+GFH YC  PP+  +PK  W C  CR     G   KP I
Sbjct:  199 ALNKRTKRQENMINCWDCGTCAHPTCLQWPDSLFQKVRTIRWQCLQCKRCSYCGMISRKDDDMLLCDACDQGFHIYCCDPPIKNLPKGEWVCRICRPTG--GRKEKPSI 305          
BLAST of Histone-lysine N-methyltransferase 2C vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 78.9518 bits (193), Expect = 6.074e-14
Identity = 44/109 (40.37%), Postives = 57/109 (52.29%), Query Frame = 2
Query: 1037 SLCERKGGVNDLISCTSCGQHYHSNCLEPPLILSPTVRA-GWQCAECKTCLVCSE-SKDEKKMLVCDVCDKGFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGI 1357
            +L +R     ++I+C  CG   H  CL+ P  L   VR   WQC +CK C  C   S+ +  ML+CD CD+GFH YC  PP+  +PK  W C  CR     G   KP I
Sbjct:  197 ALNKRTKRQENMINCWDCGTCAHPTCLQWPDSLFQKVRTIRWQCLQCKRCSYCGMISRKDDDMLLCDACDQGFHIYCCDPPIKNLPKGEWVCRICRPTG--GRKEKPSI 303          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2C2.958e-6735.17lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2C2.958e-6735.17lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2C6.045e-6031.77lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2D1.082e-5339.46lysine methyltransferase 2D [Source:HGNC Symbol;Ac... [more]
KMT2C4.386e-4158.50lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-162.576e-3339.27Histone-lysine N-methyltransferase [Source:UniPro... [more]
dpff-15.431e-1641.86Zinc finger protein dpff-1 [Source:UniProtKB/Swis... [more]
phf-102.298e-1431.86PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
phf-102.298e-1431.86PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
phf-102.415e-1335.37PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lpt2.072e-5340.28gene:FBgn0263667 transcript:FBtr0343298[more]
Lpt2.118e-5340.28gene:FBgn0263667 transcript:FBtr0072134[more]
d45.511e-1642.35gene:FBgn0033015 transcript:FBtr0111115[more]
d41.478e-1535.40gene:FBgn0033015 transcript:FBtr0335258[more]
d41.510e-1535.40gene:FBgn0033015 transcript:FBtr0086083[more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2d3.020e-6042.51lysine (K)-specific methyltransferase 2D [Source:Z... [more]
kmt2ca1.838e-5651.04lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2ca1.908e-5639.93lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2cb3.543e-5542.17lysine (K)-specific methyltransferase 2Cb [Source:... [more]
kmt2cb1.825e-4941.56lysine (K)-specific methyltransferase 2Cb [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab9b1.938e-6034.91RAB9B, member RAS oncogene family [Source:Xenbase;... [more]
c1orf502.412e-5357.36chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf503.379e-5357.36chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf503.718e-5357.36chromosome 1 open reading frame 50 [Source:Xenbase... [more]
vps37a7.634e-1941.07vacuolar protein sorting 37 homolog A [Source:Xenb... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kmt2c1.368e-6635.35lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2c7.700e-6635.52lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2c4.057e-6132.88lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2d3.232e-5338.14lysine (K)-specific methyltransferase 2D [Source:M... [more]
Kmt2d3.314e-5338.14lysine (K)-specific methyltransferase 2D [Source:M... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NEZ4|KMT2C_HUMAN1.420e-6635.17Histone-lysine N-methyltransferase 2C OS=Homo sapi... [more]
sp|Q8BRH4|KMT2C_MOUSE5.477e-6535.52Histone-lysine N-methyltransferase 2C OS=Mus muscu... [more]
sp|O14686|KMT2D_HUMAN5.197e-5339.46Histone-lysine N-methyltransferase 2D OS=Homo sapi... [more]
sp|Q6PDK2|KMT2D_MOUSE1.090e-5038.14Histone-lysine N-methyltransferase 2D OS=Mus muscu... [more]
sp|Q9QX66|DPF1_MOUSE8.583e-1743.96Zinc finger protein neuro-d4 OS=Mus musculus OX=10... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S5XVZ90.000e+099.54LPT OS=Schmidtea mediterranea OX=79327 GN=LPT PE=2... [more]
A0A4Z2DDF51.056e-1239.83Histone-lysine N-methyltransferase 2C OS=Schistoso... [more]
A0A430QGW20.000e+039.23Histone-lysine N-methyltransferase MLL3 OS=Schisto... [more]
A0A183LXJ96.511e-14142.25Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A4E0RYV22.488e-11847.56Putative Histone-lysine N-methyltransferase MLL3 O... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2d5.802e-6240.14lysine methyltransferase 2D [Source:NCBI gene;Acc:... [more]
ENSAMXT00000030877.19.109e-5644.16pep primary_assembly:Astyanax_mexicanus-2.0:16:204... [more]
dpf2l3.208e-1741.67zinc finger protein ubi-d4 [Source:NCBI gene;Acc:1... [more]
dpf2l3.344e-1741.67zinc finger protein ubi-d4 [Source:NCBI gene;Acc:1... [more]
dpf39.277e-1742.11zinc finger protein DPF3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002602.16.208e-6333.63pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 g... [more]
dpf24.860e-1636.84D4, zinc and double PHD fingers family 2 [Source:Z... [more]
kdm5c1.546e-944.83lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
kdm5c1.852e-949.02lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
ENSPMAT00000002322.12.859e-938.96pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 ge... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
JHD21.584e-947.17JmjC domain family histone demethylase; promotes g... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375873.930e-5341.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375881.939e-5254.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412381.988e-1739.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375925.315e-1739.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397415.188e-1645.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037146.12.512e-5843.20pep primary_assembly:ASM223467v1:7:12299712:123017... [more]
ENSORLT00000020985.29.629e-5336.79pep primary_assembly:ASM223467v1:17:25344123:25371... [more]
ENSORLT00000032718.19.629e-5336.79pep primary_assembly:ASM223467v1:17:25342809:25371... [more]
ENSORLT00000032975.11.128e-3161.21pep primary_assembly:ASM223467v1:7:12296688:122991... [more]
dpf11.344e-1742.86double PHD fingers 1 [Source:NCBI gene;Acc:1011560... [more]
back to top
BLAST of Histone-lysine N-methyltransferase 2C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040592.10.000e+095.92SMESG000040592.1[more]
SMESG000031948.11.109e-1537.07SMESG000031948.1[more]
SMESG000062900.16.025e-1440.37SMESG000062900.1[more]
SMESG000062900.16.027e-1440.37SMESG000062900.1[more]
SMESG000062900.16.074e-1440.37SMESG000062900.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024921 ID=SMED30024921|Name=Histone-lysine N-methyltransferase 2C|organism=Schmidtea mediterranea sexual|type=transcript|length=8321bp
TTAATGCAAATCAAAAGTGAAATATATATAATTTTCATATATAATGTCTG
ATGAGAGTAAGGATTCTGATTTATTTGATTCAATGTTATCACTTAGTTCT
AAACGCCATAAAATTGACATTGTTAATGAAGAAATTTCAGATCCTTCTAA
TACATTAAGATGCAAGGTTGACGACGAATATTTCGTTAATAGGATAATTC
AGAATAATAATCCAACAAATGAAAATGATTTTGATGATTTTTTCCAAAGT
AACGGCAATAATATGAGGTGCTCGTTGTGTGCTCTAGGTCCACAAAATAA
ATTTGGTCAAGGAGAAATGCTGAAATTCTATTCATCGGAAATACCAGTTC
CGAGCTATATTTGGTCAAAAGATGTGAATAGTAACAAAAGGTCTGATCGA
ATCAAATTGAAAGATTGTCAGGAGTATTGCTGTTTAGATACAAATAAACG
GTTGAAAGAAAACAAAATAATTGGAACCGACGGTAAACCGTGTCTCAATC
GAATAGTGAATGCATTTTTTGACAATGAAGGCCGGCCTTTTGGACTGATT
GATGAATTCGCTTGGGTGGGGTTGCCAGCAATGGTGACGACCCAGAAATC
TAGTACTGGAGCTGGTAGTAACAACAGTTCCTTGCTGTGGAAAGCCATTA
ACAGCTGCGATGAGACGGATGAAAATTTGAAATTTGCTCATTTGCTATCG
TACGAGTTGTCCGCAAATGACCAATGCAATGACAGCTGTTTCTACGTGCA
TCATTCCTGTGTTACTTGGTCGGAGGGGGCGTCTCAGTTTAGTGATCAAC
TAGATGGCAATTTTGACAATGTCGAATCAACAGTACGCAATGGATTAAAT
CAAATGTGCAGTTTCTGCCTACGGTTCGGGGCGACGATTTCTTGTCGCAG
CAAGACCAATTGCAAGCACAAATTCCATTATCCATGTGCCGCAGCAGCCG
GCTGCTTCCAGGATTTCGTCAGTTTCCAACTCTGGTGTCCAAGTCACACT
CAGGAGGCGGATTTGTCAAATGAGCATTGCATTTGCTCGCTCTGCGAACG
GAAGGGAGGCGTCAATGACCTGATCTCGTGTACGAGTTGTGGCCAGCATT
ACCACAGCAACTGCCTCGAACCGCCACTGATATTGAGCCCGACGGTGCGT
GCCGGTTGGCAATGTGCCGAATGTAAAACGTGCCTCGTGTGCAGTGAGAG
CAAGGACGAGAAGAAGATGCTCGTGTGCGACGTGTGCGACAAGGGATTCC
ACACGTATTGTTTGCAGCCGCCAATGGCCGCCATACCGAAGAATGGATGG
AAATGCGACTCGTGTCGCGTGTGCAATGACTGCGGATACTCAATGAAACC
GGGAATCGCTCTGACCGGCAACTCTAATCAGGGCTCGAATGTGCGATGGC
ACAACAATTACACTCTCTGTGACCGATGCGCACAGACCAAGCGGCGTGGC
CATTCCATCTGTGCTGTCTGTGAGCGGGCTTGGCGATGCTCTCTACCTGG
CACCAAGAATCAATCCTCCAGCAAATGGCCTGGCCGCAAATGCTCCACGT
GCCACAAAATGGTTCACATGGACTGTGACCCGTTGCTGGCATCCATGCCG
TCACCAGTCTATTCCCTGAGTTCATCCAACAGTGGGGGTAACGGCACTGC
CGATGAGATATCCACGGCGAGCTGTGCATTAGTTGCTCCTAGCAACGGCG
GAGCAAGTCATCATAACAGCACTAATAACAGCAATAGCAACACCAATAGC
AACACCAATTACCAATGTCCTACCTGTCATAATAGGGGATCAGCAACGTC
CAGTGAAGTGGCCTCCACTCACACCAGTCCTATGCCGGGCAGCTACTGCG
ATGAGGAGATTGCAGATGATCTTGATGAGGTGGATGACGAGGAGACTGCA
TCGCTGTCGGGATTCGACCCGTTGCCGCCAAGGATGCTCGGACTGGACTC
GCAATGCTCTACAATCATGAACCGCAGCATCGAGCAGGGCTATCGCAGTA
ACAGTATTGACGATTCCAGCACAATATCAGGCTCGACAACTCCACAGACG
TATTGCCAGAGCAACAGCAGCAGCAAATTCCAGTTGCCAATGAGCAGAAA
CAATAAAGATAAGCCCTATGAATCAAATGCGGCGCCCAGTAAGAAACGTT
TGCAGCCAGTAAACAAAGGGAAGTCAAAGACTGCAGGTGGGAAATCATCA
TCCTTGAAACGGAACAGCACACTCAACAGCACCAAGAGATCTCGGAGGGT
TAAATCAAGGAAAATTAATGTGTGTGAATCTAAAAATAACGAGGAAAAAG
ACGAGCATCCGAGTACTGTAGTTCTGTGTCGAGCAGATGATCTGTTTGTG
CTGGAGCAAGATATCTGTGTGTCGTGTGGTTCATTCGGGATCGACACGCC
GTTGCTGTGCTGCGTGCAATGCGGCCAATGCTATCATTCATATTGCGCTG
AGATTAGCAAGCTCACAAAAGTCATCATAGAAAAAGGCTGGAGGTGCCTA
GATTGCACGGTCTGTGAAGGTTGCGGTCAGGCAACTAATGAGGACTTGTT
GCTATTGTGTGATGATTGCGACATCAGCTACCACACGTTTTGCCTCGATC
CCCCATTGAATGAAGTGCCGAAAGGCAGCTGGAAATGCCAGAATTGTGTC
GTGTGCCAGTTCTGTGGGAAACGGGACCCGGGGCCCAACGGGACCTGGCA
AAATAACTACACAACTTGCGCGCCGTGCGCTTCCAAGGCCCAATGTCCCG
TCTGTTATAATAATTACAATGATGGGGACTTGATGCTAATTTGCGATGTG
TGTGAGAGATCGTCACATGCCACTTGTGATCATTTGAATACTGAAGCGGA
GTTAGAGTTCATCTTTGAAGGCGGAGGATATCATTGCATTCTGTGCCGGG
ACAAAGGGATCGATATCGGTGCTGGTCACAAGCAGCTGCTGCATTTACGT
GCTACTCATGGCGATTCAGTTGCTCAAACATTGGTCGCTGATAAATCTGT
ATTTAGCAATCTAATTGGCAACTCATTGGAATACGGAAGCAAGAACTCGT
TGCTATCCAGTGTTGGATCATCTGTAGACGGGCCTACGTCACCGGATCCT
TCCAAGAACTTCTTCATGGACAATGTCGTTCTCAGTGAGAGTGGCCTCAA
CACCATTAGAAACGCCATGCTCAAAAGCCAGCCACGTCGGGCTCAAAATG
CCATGAAACGAGTACAGAAATCGCATTCCCAAGATACGATTGGAGATGTC
GACAGCAAGCAGATCAAGTTGGAATCCACCGAGCCCCTCCTGAATGCCGA
TGGCTCCGTTGTTGCTAGTGGAAACCATCTCGACGAGGACTCAATGCAGA
GCATCGAAGGAGAAATCAACACCACAGACATGAAGAGTCCAAGCGTCCAA
TCAGATGACGGATCTGAAATACAGAGTTTGCCAGCTCATTCTGCCTCAAA
CAGCGTCAATAATTATCTGCCCTCCTCGAAAACCATTGGGAAAGCAGTTA
TGCCGCGGAACAGAAGGTTCTCAAATTTGGGCATCGGCGGGTTCAGGGCC
CGATCGACAAGGGTGTCACAAGTGAAGAAGTCGGCATTGGCTGCTGTAAA
TAACCAGAATTTCGATCAAAACAACCCGCAATACACGATAGAAAATTTCA
CAGCGAAGCAGGGCCGACGGAGACCCGTGAAGAAGAAATCTGAAATTGAT
GAGAACTTTCCCGATTATTTAATGCAGGCTTTTCTTGGTAGCAGCCTTCT
GTCGCACACAACTGAGACGAGCAAGAAATCCGGCCACCTCAAATTGTCAC
CGAGCAGAATGGCTGGCGGCAATTACTCGGTTGATGCTCATTCATTCAGC
AGCACCGGCTCCAATCTGAATGACGATGGCGATGACTGCTGTCCTGACAA
CAGCAACTGCTTTGAAATGGACAACGAAGCCGAGAATTTCACCGCAGCTC
AGGAGGCATCTAATTATATGCTAATTGAGGTGCCGATCTCCTACACGAAA
ACTGAATATGACGAACCAAAGACAGAACCGACGACAAATGTGATGTCAAC
TTGCTCCTCTGTGTCCCCCAAGGTTACCAACATCAGCAATCACGGAATCC
TCCAATCAGAATTGGGCGCTAGATTTAACCACCAAATGAATATTCTGACC
AATCCCGGTCAGAGCCCCAATAAGCCCGCCGTTGGTATCAAGAAATCGGA
AGAAACAGTTCATGGAGCGATCAATAGTGATTTATTCTCTCAAGTGTCTA
GTAACAACAACAGCGGCAGCAACAACAATAGCAACAATATTAACAGTTCT
GTCGTATCGTTGGCCTATCAGAACCAAACATTGACATTTGATGAGGATGA
CGAATATTTATTGGATGATTATCTGCTTTCTTTTCCCGATTTAGAAATGG
TGGAGGAGGGCAATCCCGACACGGGAAACACTGGTGCAGAGATCAATAAT
TCCACCGAGATCCACTCCAATCCCCTGGAACTGTCAAAGCACATATCTGA
CGAGGCCGGGCTTACCCAGCTGCCAGAGCTTACAGTAAATGACATAGAGA
CTCACCTGGGGCCGTCAAATATGGAGAACAGTGAGTTGCCTATGACATCG
CGACGTGGCAACGGTGCTCGTGACAATAGCGGCATTCAGCTCAGCAGCAA
TGCCAATATCGATTCCAGCTATCTGATGTCGTCATCAACGAATACGGCAA
TTCCCGCCAGTCAGCAGCTCCCTGACTGTAACAACCAGTCTCCAATGCGC
TCGGAACTGGTGATGCGTCCTATGCACAACACTGCCGGAGGTACTGGGGG
AGGAGGCCAATTGATGCAGATGAAATCGCCCACTGCCATGCAGTCCAAGG
CCCCTCCAATGAATGTCCAAATCAGCGGAGATCCTAATGCGCTCGGGATC
GATATTTCTGCAAATTTTATCCCAAACTCACAGCTCATTAATCCCAGCAT
GAGGCGCCAGCTATTTCCCAATCAAATTCCCCGTAGACATACAGAAGTTT
CTTTTCAGCTCCAGCAAGTCGGCAACATTTCATCAGTCAGTGCTAATCAA
GCTAGTTTTTCCTCCCCAATTAGGAGCTATGATAATCAATCATTGCTGCA
GCAAAAGTTACAATTCTCCCAATCAGCTCCTCAATTCATAATGTGCTCCA
ATAATCTGCAAAAGCCTTCTCGCCAAATAAATATTGACCAAGGTTCAGGA
TTAGTTCAAGATATAAATGGCCATCAAATTATGCTCAATGAAAATCTTGG
TCTTGTTACTATTGACAACCAGCAAAAGCAGCAGTCACTGGAAAGCTTTC
AAGGACAGCCATCCAATCAGCAGACACAGCAACAGCATATGATACTGGGC
CGGTTGCATGATCCCAATGTGACTGTGCCAGTCCAGTGTAACCAAGCTCC
CCCGCCGCCGCCGTATCCAAGCAACTCTCAACCTTCGGAAGGTATCGGAA
AGCCATCGAATGATAGCAAACAGAAAGTCTGGATGCATTCACCTAATTTC
CAGCTGCAGATGAATGAGCAGAGCATTCTAGAGAAGCAATCAATGATTCC
AGCCGATTCAATCCAGTCAGGAGGACCCAATATGTTCAAGTCAGCTCAGC
AAAGCCCCCAATCAGGCATCCATCAGAGCCCCCAGAAGCATTTCCCAGTA
TCAATGCAGCAGTCGCCCTTCAATACCGGCAACCAGCAATTCAACAAATC
AAATCCCCAGATCATGATTCATGTCGGTCAGATGGAATTGCCTGAGAAGT
CCAATAAAGATTCGATGCTCTCACCAGATACAAATTTGCCAGTTCCGCGC
CCAAAAAATATATCGTTATCAGCAGCGAATTTGGAGAATTCGGAAGTGAA
TTTCACTGTCGATGGAAGTAGCGGCTGTGGAGGAACCACGCCAACACCGA
GCACTCCAACGGCACCACAGTCCAATAAACGGATCAATAATTTGAAATGG
CAGGAGGACGAACACCTGGGTGACAAATCAACGATCGCACCGGTCCTGTT
TGCGAATTGTGTCCATCAGAATATCAGATCGCAAATTGCTGATCCAGAGT
CTCGATTCAGAGAGATACAGAAGCTGTGGCGGAAATTGAAAAGCGAAGAG
CGACAGGAATGGGTGAACAAATCCCGGCTGAATAAGTCCACCAAGAAGTG
CAACGTTTCTTCCGCTTCCGGATCAGCCAATTTATCTAAAAAGAAAAAGA
CAACTCCTGCCATGGCAACCGCATTGCAATCAATGCAATTGAGTAGTCCC
AATAAATATGTGCAGCAGCAATCGCCCAGCTCCATTCATCAATCGCCGTC
TCCTTTTCAACAGGGAATAATCAATAGTGCTCTCCAGTCGCCACCGATGC
CTCAAAAACACAACCAATTCCCGCAATTTATACAACAGCAACAGCAAATG
GGAATCAATCCGGATATGATCAACACCAGCCTTCCAGGAGTTCCAAAAAT
CAATCAAATCAATTCATTGCAAATTGGCCAAATGTCATATAATAAATATG
AATTTATCCCCCCTCCTCCGTCTCAGCAGGAGCAGCAGCAAGCCATTTAT
CAGCAAGAATTCAATAGCCAGCAGCAGCAGCAGCAGCCATCGATCCAAAT
GCAAGTCCATCCTCAGCAGCAGCAGCAGCAGCAAGCAATGATGGTCAGTG
CTCAGCAGCAGCAGCAGGGCCTGGACTCCTTGCGGATGCAGCAGCAGCAG
CTGCAGCAGTCATTGAACGCCTCCACTCACTCAGTGGCCAATCCTGGCAC
TCCCTCTATGATCGATAGCAATGAGGGTGCTATCAGCTCCCCCAGCAAGC
AGCAGTACTGTGAAGGCAGCAACATGCAAATGTCCAATCAGCAGCAGCAG
CAGCAGCAATACCTTCAACCGCTACCGCCACCAACATGGCCACCAGCGGC
TGACCTGTCGTCGTCGGCGGCGGCGGCGGCGGCGGCCGCCATGCAAGCTC
CCCAATCGATCAATGCGTTCCACCGGTTCAACAAGAATCAGACTGGCAAT
TCCAACCAGATGGTATCGAGCGTGCTGCAAATGTCAGCACAGCACCAAAT
GCCCTCCACATTATTATCCCAGTCCGTTCAGAATCCCGCCGACAACAAAC
TCAACAACAACAACTCAAATAGGGAGAAACTCATGTCCACTAACATAATC
AATCAATCGAACTCGGAAATGATATTCAGTCCTCCCGGTCAGTCAAGCGC
TTCTCTGCCGTCGTCCCCGTTCCACAAGGAGATGGCTACCAGTGACGAGA
CAACCACCAAGTTGCGGGACGTGTTGAACAAGCGCAACAGCAACAGCAAC
AGCAACAGCAAGCCAAATTCATTCAGTCAGCAAACGTATGCCAATTCTCC
ATCAATCAGTGCTGCGGACAGTAACTTGCTGGCCGCCAGTCCCTCCTCAT
CTGAGCACGGTTTCAATCACACATCTATCCAGTTGCGCTCATTGGCAGGC
GGTAATAATAATAATACTGCTGCGGTTTCCATGGCTGCTACCTCCGGTAT
GGAGTCGCTCCCTGATCACGAGATGTGCATCAATAACAACTCATCATCAT
TCCAGTCCATGAACAGGCTTGGGAAGATGCAACAGTCACAGCAAATCAAT
CAAACGGCTCTCCAGATGGTCCCAGTTGCGTTTTCACAGTCGCACGGAAT
GGAGGATGCAGTCAATGGGAACATGCAATCACAAATGATGCAGACGCGCC
AATATCAAATGCCATCTGGCTGCTACATGGATCCACAGACCCAGCAGAAG
TATTCCATTAATCCGTCGTCACAGCAACAGTATCTGATCCTGGAATCGTC
CGATGTGAATGCGAAACTGATTCCACAACAACAGCAACAACAACAACAAC
AACAAATACAGTTGCAGCAGCATAATTTACCATCACATTTCTACTATCAC
AACACCAATAAAATGCCGAATTCTGCGAGTGCAATCAATAATATCGATAA
CTCAGTAGCACAGACACCAGAGAACTCGTCCAAGTGAATCCTTGTGTCAA
CAAATTCGATCTGCAAAATCGAATACCGAGTGATGGCCAATAAATGTTAA
TAAGGCACAAGTTGTGTGAATGTTCCGAATGTGTTACATGTGGTTTCATT
GCTGTATATATGAATATATATTTGTAGATAAGAACCTAGTTTTTATTACA
ATTATCAAATGTTGGAGCATAATTGCATTAATTTAGGCACTGATTATATA
ATATATTCTGATTAACTGTGCTGTCTTATCTTTTTTCTTATCTCTCTCTC
TGTGTGATGATTTGCAGCTTGTCGTGGTTTCATTGGTGTATTAGAAATTA
CTTTTGACGAATAACACAAAT
back to top

protein sequence of SMED30024921-orf-1

>SMED30024921-orf-1 ID=SMED30024921-orf-1|Name=SMED30024921-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2648bp
MSDESKDSDLFDSMLSLSSKRHKIDIVNEEISDPSNTLRCKVDDEYFVNR
IIQNNNPTNENDFDDFFQSNGNNMRCSLCALGPQNKFGQGEMLKFYSSEI
PVPSYIWSKDVNSNKRSDRIKLKDCQEYCCLDTNKRLKENKIIGTDGKPC
LNRIVNAFFDNEGRPFGLIDEFAWVGLPAMVTTQKSSTGAGSNNSSLLWK
AINSCDETDENLKFAHLLSYELSANDQCNDSCFYVHHSCVTWSEGASQFS
DQLDGNFDNVESTVRNGLNQMCSFCLRFGATISCRSKTNCKHKFHYPCAA
AAGCFQDFVSFQLWCPSHTQEADLSNEHCICSLCERKGGVNDLISCTSCG
QHYHSNCLEPPLILSPTVRAGWQCAECKTCLVCSESKDEKKMLVCDVCDK
GFHTYCLQPPMAAIPKNGWKCDSCRVCNDCGYSMKPGIALTGNSNQGSNV
RWHNNYTLCDRCAQTKRRGHSICAVCERAWRCSLPGTKNQSSSKWPGRKC
STCHKMVHMDCDPLLASMPSPVYSLSSSNSGGNGTADEISTASCALVAPS
NGGASHHNSTNNSNSNTNSNTNYQCPTCHNRGSATSSEVASTHTSPMPGS
YCDEEIADDLDEVDDEETASLSGFDPLPPRMLGLDSQCSTIMNRSIEQGY
RSNSIDDSSTISGSTTPQTYCQSNSSSKFQLPMSRNNKDKPYESNAAPSK
KRLQPVNKGKSKTAGGKSSSLKRNSTLNSTKRSRRVKSRKINVCESKNNE
EKDEHPSTVVLCRADDLFVLEQDICVSCGSFGIDTPLLCCVQCGQCYHSY
CAEISKLTKVIIEKGWRCLDCTVCEGCGQATNEDLLLLCDDCDISYHTFC
LDPPLNEVPKGSWKCQNCVVCQFCGKRDPGPNGTWQNNYTTCAPCASKAQ
CPVCYNNYNDGDLMLICDVCERSSHATCDHLNTEAELEFIFEGGGYHCIL
CRDKGIDIGAGHKQLLHLRATHGDSVAQTLVADKSVFSNLIGNSLEYGSK
NSLLSSVGSSVDGPTSPDPSKNFFMDNVVLSESGLNTIRNAMLKSQPRRA
QNAMKRVQKSHSQDTIGDVDSKQIKLESTEPLLNADGSVVASGNHLDEDS
MQSIEGEINTTDMKSPSVQSDDGSEIQSLPAHSASNSVNNYLPSSKTIGK
AVMPRNRRFSNLGIGGFRARSTRVSQVKKSALAAVNNQNFDQNNPQYTIE
NFTAKQGRRRPVKKKSEIDENFPDYLMQAFLGSSLLSHTTETSKKSGHLK
LSPSRMAGGNYSVDAHSFSSTGSNLNDDGDDCCPDNSNCFEMDNEAENFT
AAQEASNYMLIEVPISYTKTEYDEPKTEPTTNVMSTCSSVSPKVTNISNH
GILQSELGARFNHQMNILTNPGQSPNKPAVGIKKSEETVHGAINSDLFSQ
VSSNNNSGSNNNSNNINSSVVSLAYQNQTLTFDEDDEYLLDDYLLSFPDL
EMVEEGNPDTGNTGAEINNSTEIHSNPLELSKHISDEAGLTQLPELTVND
IETHLGPSNMENSELPMTSRRGNGARDNSGIQLSSNANIDSSYLMSSSTN
TAIPASQQLPDCNNQSPMRSELVMRPMHNTAGGTGGGGQLMQMKSPTAMQ
SKAPPMNVQISGDPNALGIDISANFIPNSQLINPSMRRQLFPNQIPRRHT
EVSFQLQQVGNISSVSANQASFSSPIRSYDNQSLLQQKLQFSQSAPQFIM
CSNNLQKPSRQINIDQGSGLVQDINGHQIMLNENLGLVTIDNQQKQQSLE
SFQGQPSNQQTQQQHMILGRLHDPNVTVPVQCNQAPPPPPYPSNSQPSEG
IGKPSNDSKQKVWMHSPNFQLQMNEQSILEKQSMIPADSIQSGGPNMFKS
AQQSPQSGIHQSPQKHFPVSMQQSPFNTGNQQFNKSNPQIMIHVGQMELP
EKSNKDSMLSPDTNLPVPRPKNISLSAANLENSEVNFTVDGSSGCGGTTP
TPSTPTAPQSNKRINNLKWQEDEHLGDKSTIAPVLFANCVHQNIRSQIAD
PESRFREIQKLWRKLKSEERQEWVNKSRLNKSTKKCNVSSASGSANLSKK
KKTTPAMATALQSMQLSSPNKYVQQQSPSSIHQSPSPFQQGIINSALQSP
PMPQKHNQFPQFIQQQQQMGINPDMINTSLPGVPKINQINSLQIGQMSYN
KYEFIPPPPSQQEQQQAIYQQEFNSQQQQQQPSIQMQVHPQQQQQQQAMM
VSAQQQQQGLDSLRMQQQQLQQSLNASTHSVANPGTPSMIDSNEGAISSP
SKQQYCEGSNMQMSNQQQQQQQYLQPLPPPTWPPAADLSSSAAAAAAAAM
QAPQSINAFHRFNKNQTGNSNQMVSSVLQMSAQHQMPSTLLSQSVQNPAD
NKLNNNNSNREKLMSTNIINQSNSEMIFSPPGQSSASLPSSPFHKEMATS
DETTTKLRDVLNKRNSNSNSNSKPNSFSQQTYANSPSISAADSNLLAASP
SSSEHGFNHTSIQLRSLAGGNNNNTAAVSMAATSGMESLPDHEMCINNNS
SSFQSMNRLGKMQQSQQINQTALQMVPVAFSQSHGMEDAVNGNMQSQMMQ
TRQYQMPSGCYMDPQTQQKYSINPSSQQQYLILESSDVNAKLIPQQQQQQ
QQQQIQLQQHNLPSHFYYHNTNKMPNSASAINNIDNSVAQTPENSSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR034732EPHD
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
IPR011011Znf_FYVE_PHD
IPR001965Znf_PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 778..826
e-value: 2.4E-4
score: 30.4
coord: 472..583
e-value: 7.2
score: 7.7
coord: 271..319
e-value: 0.02
score: 24.0
coord: 330..378
e-value: 1.4E-9
score: 47.8
coord: 379..425
e-value: 9.5E-12
score: 55.0
coord: 827..873
e-value: 2.5E-11
score: 53.6
coord: 874..956
e-value: 0.51
score: 19.4
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 473..582
e-value: 10.0
score: 2.6
coord: 272..318
e-value: 0.56
score: 13.4
coord: 380..427
e-value: 2.8
score: 7.4
coord: 905..955
e-value: 5.7
score: 4.8
coord: 331..377
e-value: 1.6
score: 9.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 318..378
e-value: 3.0E-11
score: 45.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 379..427
e-value: 1.3E-14
score: 55.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 772..882
e-value: 5.6E-26
score: 92.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 904..944
e-value: 3.5E-7
score: 31.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 205..317
e-value: 2.2E-15
score: 58.8
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 828..874
e-value: 6.3E-10
score: 38.8
coord: 380..427
e-value: 1.1E-10
score: 41.3
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 825..875
score: 9.846
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 328..380
score: 9.454
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 776..828
score: 8.627
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 377..427
score: 10.567
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 902..958
score: 8.6
NoneNo IPR availablePFAMPF13771zf-HC5HC2Hcoord: 236..319
e-value: 3.2E-10
score: 40.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2171..2216
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 654..742
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1940..1960
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2360..2386
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1050..1064
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2030..2085
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 715..731
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1795..1809
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1504..1530
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1050..1073
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 654..697
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2360..2379
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1787..1809
NoneNo IPR availablePANTHERPTHR45888FAMILY NOT NAMEDcoord: 75..1411
coord: 1948..2117
NoneNo IPR availableCDDcd15512PHD4_KMT2C_likecoord: 778..825
e-value: 4.36871E-19
score: 80.5847
NoneNo IPR availableCDDcd15510PHD2_KMT2C_likecoord: 380..424
e-value: 1.322E-18
score: 79.0149
NoneNo IPR availableCDDcd15509PHD1_KMT2C_likecoord: 331..377
e-value: 4.29333E-18
score: 77.7341
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 1955..2040
e-value: 4.9E-18
score: 67.1
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 209..319
score: 17.337
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 818..881
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 320..378
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 366..433
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 752..826
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 889..957