Ectonucleoside triphosphate diphosphohydrolase

Overview
NameEctonucleoside triphosphate diphosphohydrolase
Smed IDSMED30024920
Length (bp)3842
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ectonucleoside triphosphate diphosphohydrolase (SMED30024920) t-SNE clustered cells

Violin plots show distribution of expression levels for Ectonucleoside triphosphate diphosphohydrolase (SMED30024920) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ectonucleoside triphosphate diphosphohydrolase (SMED30024920) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ectonucleoside triphosphate diphosphohydrolase (SMED30024920) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024920

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024920SMESG000068450.1 dd_Smed_v4_11962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Human
Match: ENTPD8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:HGNC Symbol;Acc:HGNC:24860])

HSP 1 Score: 150.599 bits (379), Expect = 2.823e-58
Identity = 97/277 (35.02%), Postives = 146/277 (52.71%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGE--VTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETF--GALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +FL++W  +A + NG   V+Q   C+   PGIS + ++   A + ++ CL +E + LIP+    K+  +LGATAGMR++           + +N    R IF  V + L  + +         ++++G  EG   WIT NY   TL     T  ++   E    GALD+GGASTQITFV    I   +T+   RLYG +Y+VY+HSYLC+G+ Q   RLL  L ++        +P   + +PC L G   +  L  +   PCV
Sbjct:   43 FGIVFDAGSSHTSLFLYQW--LANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCL-EEALVLIPEAQHRKTPTFLGATAGMRLL-----------SRKNSSQARDIFAAVTQVLGRSPVD----FWGAELLAGQAEGAFGWITVNYGLGTLVKYSFTGEWIQPPEEMLVGALDMGGASTQITFVPGGPILDKSTQADFRLYGSDYSVYTHSYLCFGRDQMLSRLLVGLVQS--------RPAALLRHPCYLSGYQTTLALGPLYESPCV 293          

HSP 2 Score: 97.4413 bits (241), Expect = 2.823e-58
Identity = 64/200 (32.00%), Postives = 102/200 (51.00%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI--SMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLK 1734
            N+T  GT +P AC  A++ LF  S C  Q +C F+ VYQP + G+F AF+ F   ++ L    + P    +   A   ++C R    V      ++R    W +  C   +Y+  LL   YGF+   W S+ F       ++GW+LGYM+N T MIP + P    + S G +VA  +VF+V+  +  + A +  + +WL+
Sbjct:  304 NLTVEGTGNPGACVSAIRELFNFSSCQGQEDCAFDGVYQPPLRGQFYAFSNFYYTFHFLNLTSRQP---LSTVNATIWEFCQRPWKLVEASYPGQDR----WLRDYCASGLYILTLLHEGYGFSEETWPSLEFRKQAGGVDIGWTLGYMLNLTGMIPADAPAQWRAESYGVWVAK-VVFMVLALVAVVGAAL-VQLFWLQ 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Human
Match: ENTPD8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:HGNC Symbol;Acc:HGNC:24860])

HSP 1 Score: 150.599 bits (379), Expect = 2.823e-58
Identity = 97/277 (35.02%), Postives = 146/277 (52.71%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGE--VTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETF--GALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +FL++W  +A + NG   V+Q   C+   PGIS + ++   A + ++ CL +E + LIP+    K+  +LGATAGMR++           + +N    R IF  V + L  + +         ++++G  EG   WIT NY   TL     T  ++   E    GALD+GGASTQITFV    I   +T+   RLYG +Y+VY+HSYLC+G+ Q   RLL  L ++        +P   + +PC L G   +  L  +   PCV
Sbjct:   43 FGIVFDAGSSHTSLFLYQW--LANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCL-EEALVLIPEAQHRKTPTFLGATAGMRLL-----------SRKNSSQARDIFAAVTQVLGRSPVD----FWGAELLAGQAEGAFGWITVNYGLGTLVKYSFTGEWIQPPEEMLVGALDMGGASTQITFVPGGPILDKSTQADFRLYGSDYSVYTHSYLCFGRDQMLSRLLVGLVQS--------RPAALLRHPCYLSGYQTTLALGPLYESPCV 293          

HSP 2 Score: 97.4413 bits (241), Expect = 2.823e-58
Identity = 64/200 (32.00%), Postives = 102/200 (51.00%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI--SMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLK 1734
            N+T  GT +P AC  A++ LF  S C  Q +C F+ VYQP + G+F AF+ F   ++ L    + P    +   A   ++C R    V      ++R    W +  C   +Y+  LL   YGF+   W S+ F       ++GW+LGYM+N T MIP + P    + S G +VA  +VF+V+  +  + A +  + +WL+
Sbjct:  304 NLTVEGTGNPGACVSAIRELFNFSSCQGQEDCAFDGVYQPPLRGQFYAFSNFYYTFHFLNLTSRQP---LSTVNATIWEFCQRPWKLVEASYPGQDR----WLRDYCASGLYILTLLHEGYGFSEETWPSLEFRKQAGGVDIGWTLGYMLNLTGMIPADAPAQWRAESYGVWVAK-VVFMVLALVAVVGAAL-VQLFWLQ 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Human
Match: ENTPD2 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3364])

HSP 1 Score: 158.688 bits (400), Expect = 2.831e-56
Identity = 103/287 (35.89%), Postives = 147/287 (51.22%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYL-KDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRL--YGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSV 1117
            YGI++DAGS+ T MF++KWP       G V Q   C     GIS + ++P+GA   +  CL ++ +  +PK     + +YLGATAGMR+     LNL       NP+A   +   V   L           R  +I+SG  EGV  W+T NYL ++ ++   V   F  +K T GA+DLGGASTQITF +    E   ++V+L  YG++Y VY+HS+LCYG+ Q   RLLA   +T               +PC  +G +   +L  +   PC       QNF +S 
Sbjct:   40 YGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCL-EQALQDVPKERHAGTPLYLGATAGMRL-----LNLT------NPEASTSVLMAVTHTLTQYPFD----FRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGF------------HPCWPRGFSTQVLLGDVYQSPCTMAQ-RPQNFNSSA 297          

HSP 2 Score: 82.8037 bits (203), Expect = 2.831e-56
Identity = 47/165 (28.48%), Postives = 78/165 (47.27%), Query Frame = 1
Query: 1132 FEKFLNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKP 1623
            F     V+  G++DP  C+  V  LF  S C  + C FN V+QP + G F+AF+ F    + L      P        A + + C++    +      +     ++    C G ++V +LLS  YGF+   +  + F     +  +GW+LGYM+N T++IP + P
Sbjct:  293 FNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADY----CAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPP 453          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Human
Match: ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:HGNC Symbol;Acc:HGNC:3365])

HSP 1 Score: 143.28 bits (360), Expect = 7.521e-56
Identity = 91/276 (32.97%), Postives = 138/276 (50.00%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIE---SGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            YGI++DAGS+ T +++++WP       G V+Q   C     GIS + N+P       E C+  ++   +P  L   + ++LGATAGMR++             +N  A   + E ++ +  S         R  +IISG  EGV  WIT NYL        +   ++     ET GALDLGGASTQI+FV+ E ++   S   +V LYG  Y +Y+HS+ CYG+++AE + LA L    + N      LT   NPC  +  + S+ +  +    C 
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQ-KVKGQVPSHLHGSTPIHLGATAGMRLLR-----------LQNETAANEVLESIQSYFKSQPFD----FRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAML----LQNSPTKNHLT---NPCYPRDYSISFTMGHVFDSLCT 309          

HSP 2 Score: 96.6709 bits (239), Expect = 7.521e-56
Identity = 62/180 (34.44%), Postives = 95/180 (52.78%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRN--APPVVTPTTQKEREKENWRKWRCFGFIYVFEL-LSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLG--AFVAILIVF 1671
            +T+ GT DP  C++ V ++F    C  Q  C F+ VYQPKI G F+AFAGF    + L  +  S   D   F + + ++CS+N    P++ P     +  E + +  CF   Y++ L ++ Y F    W  I F   + N+++ WSLGYM++ T+ IP E PLI + +    FV  L  F
Sbjct:  323 ITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASAL-NLSGSFSLDT--FNSSTWNFCSQNWSQLPLLLP-----KFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPPVFVGTLAFF 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Human
Match: ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:HGNC Symbol;Acc:HGNC:3365])

HSP 1 Score: 143.28 bits (360), Expect = 7.521e-56
Identity = 91/276 (32.97%), Postives = 138/276 (50.00%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIE---SGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            YGI++DAGS+ T +++++WP       G V+Q   C     GIS + N+P       E C+  ++   +P  L   + ++LGATAGMR++             +N  A   + E ++ +  S         R  +IISG  EGV  WIT NYL        +   ++     ET GALDLGGASTQI+FV+ E ++   S   +V LYG  Y +Y+HS+ CYG+++AE + LA L    + N      LT   NPC  +  + S+ +  +    C 
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQ-KVKGQVPSHLHGSTPIHLGATAGMRLLR-----------LQNETAANEVLESIQSYFKSQPFD----FRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAML----LQNSPTKNHLT---NPCYPRDYSISFTMGHVFDSLCT 309          

HSP 2 Score: 96.6709 bits (239), Expect = 7.521e-56
Identity = 62/180 (34.44%), Postives = 95/180 (52.78%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRN--APPVVTPTTQKEREKENWRKWRCFGFIYVFEL-LSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLG--AFVAILIVF 1671
            +T+ GT DP  C++ V ++F    C  Q  C F+ VYQPKI G F+AFAGF    + L  +  S   D   F + + ++CS+N    P++ P     +  E + +  CF   Y++ L ++ Y F    W  I F   + N+++ WSLGYM++ T+ IP E PLI + +    FV  L  F
Sbjct:  323 ITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASAL-NLSGSFSLDT--FNSSTWNFCSQNWSQLPLLLP-----KFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPPVFVGTLAFF 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Celegans
Match: uda-1 (Nucleoside-diphosphatase uda-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XU84])

HSP 1 Score: 88.1965 bits (217), Expect = 9.505e-18
Identity = 80/277 (28.88%), Postives = 131/277 (47.29%), Query Frame = 2
Query:  167 PAWYSMTIVFFTLSICGVVIICVLWAFANQLVYS------YGIIIDAGSTSTKMFLFKW---PEIATR-TNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAM-RLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFM-SKKETFGALDLGGASTQITF-VSNETIESGNT----KVRLYGENYNVYSHSYLCYGKSQAEYRLL 946
            PA+  + I FF+L +  V      W   + ++ +      + I+IDAGST T++ L+K+   P IA+     +V +    +  PG+S F   P+ A D +E  L       +P  +  K+ + L ATAG+R++               P  M   I E VE  + ++G         V ++ GS EGV +W T N L +TL  D+ T G   +   +  A DLGG STQ+T+  +NE + S +      +  +G +  +++HS+L  G   A   +L
Sbjct:    4 PAFSILLISFFSL-LSVVTTKTQYWCHGDGVLNNQHTCRFFTIVIDAGSTGTRLHLYKFIHDPAIASHGMPFKVEKEIFQEVKPGLSSFAKSPSSAADSLEPLLQ-RARKEVPHFMWEKTPITLKATAGLRLL---------------PGDMADDILESVEERIFNSGF-FAAFPDAVNVMPGSDEGVYSWFTLNILLETLFTDEPTVGHKPAAHRSVAAFDLGGGSTQLTYWPNNEAVFSEHVGYERDIDFFGHHIRLFTHSFLGNGLIAARLNIL 262          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Celegans
Match: mig-23 (Nucleoside-diphosphatase mig-23 [Source:UniProtKB/Swiss-Prot;Acc:Q21815])

HSP 1 Score: 76.2554 bits (186), Expect = 8.517e-14
Identity = 80/287 (27.87%), Postives = 127/287 (44.25%), Query Frame = 2
Query:  248 ANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVK---------MCKSAPGISDFINDPNGAIDGIE--MCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKV-----TSGFMSKKETFGALDLGGASTQITF-------VSNETIESGNTKVRLYGE--NYNVYSHSYLCYGKSQA----EYRLLAFLSKTWIANYNPNQPLTPIDNPCM 1021
            A+    SYG+I DAGST T++F++ W  I+T ++ E+ Q++         M K +PG+S F   P  A + +   M L +     IP+  R  + V++ ATAGMR+I               P   +       R  L     M+     ++II G  EG+ +WI  NY               TS   ++++T G +D+GGAS QI F        S+  +E+ N   R       Y ++  ++L YG ++     E+ LL+ L          +Q  T I + CM
Sbjct:   37 ADDQERSYGVICDAGSTGTRLFVYNW--IST-SDSELIQIEPVIYDNKPVMKKISPGLSTFGTKPAQAAEYLRPLMELAERH---IPEEKRPYTPVFIFATAGMRLI---------------PDEQKEAVLKNLRNKLPKITSMQVLKEHIRIIEGKWEGIYSWIAVNYALGKFNKTATLDFPGTSPAHARQKTVGMIDMGGASAQIAFELPDTDSFSSINVENINLGCREDDSLFKYKLFVTTFLGYGVNEGIRKYEHMLLSKLK---------DQNGTVIQDDCM 293          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 62.7734 bits (151), Expect = 1.103e-9
Identity = 70/264 (26.52%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKW-PEIATRTNGEV----TQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLR----DVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITF-VSN--ETIESGNTKVRLYGE-------NYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTP 1003
            YG+I DAGS+ T++F++   P     TN +     ++  + K  PG+S F + P   ++ +   L       IP     ++ + + ATAGMR++               P+A +    +++   L  GLK    LR    +++II G+ EG+ +WI  NY+      DK            G +D+GGAS QI F ++N  E+   GN      G         Y +YS ++L YG ++     L     + + + N N   +P
Sbjct:   49 YGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLLR-FAEEHIPYEQLGETDLLIFATAGMRLL---------------PEAQKDA--IIKN--LQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRF--DK------ENDSKVGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEG----LKKYENSLVKSGNSNDSCSP 280          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 62.7734 bits (151), Expect = 1.103e-9
Identity = 70/264 (26.52%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKW-PEIATRTNGEV----TQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLR----DVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITF-VSN--ETIESGNTKVRLYGE-------NYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTP 1003
            YG+I DAGS+ T++F++   P     TN +     ++  + K  PG+S F + P   ++ +   L       IP     ++ + + ATAGMR++               P+A +    +++   L  GLK    LR    +++II G+ EG+ +WI  NY+      DK            G +D+GGAS QI F ++N  E+   GN      G         Y +YS ++L YG ++     L     + + + N N   +P
Sbjct:   49 YGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLLR-FAEEHIPYEQLGETDLLIFATAGMRLL---------------PEAQKDA--IIKN--LQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRF--DK------ENDSKVGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEG----LKKYENSLVKSGNSNDSCSP 280          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 62.3882 bits (150), Expect = 1.518e-9
Identity = 68/264 (25.76%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKW-PEIATRTNGEV----TQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLR----DVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITF-VSN--ETIESGNTKVRLYGE-------NYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTP 1003
            YG+I DAGS+ T++F++   P     TN +     ++  + K  PG+S F + P   ++ +   L       IP     ++ + + ATAGMR++               P+A +    +++   L  GLK    LR    +++II G+ EG+ +WI  NY+      +  +          G +D+GGAS QI F ++N  E+   GN      G         Y +YS ++L YG ++     L     + + + N N   +P
Sbjct:   83 YGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLLR-FAEEHIPYEQLGETDLLIFATAGMRLL---------------PEAQKDA--IIKN--LQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRFDKENDSK--------VGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEG----LKKYENSLVKSGNSNDSCSP 314          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0077683)

HSP 1 Score: 78.9518 bits (193), Expect = 9.405e-15
Identity = 70/264 (26.52%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  179 SMTIVFFTLSICGVVIICVLWAFANQLVYS---YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNE-----TIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLL 946
            S+ ++ F            L   A++  YS   Y  IIDAGST +++  +K+          + +    +  PG+S F ++P      I++ L DE    IPK   + + + L ATAG+R++                KA  ++  V + F  S   +    +  V+I+ G+ EG+ +W T N+L           G +SK     ALDLGG STQ+TF   +       +    +V    +  NV++HSYL  G   A + + 
Sbjct:   46 SVILLLFVFGFVSENASPYLARLASKFGYSKVQYAAIIDAGSTGSRVLAYKFNRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLL-DEARAFIPKEHWSSTPLVLKATAGLRLLP-------------ASKAENILNAVRDLFAKS---EFSVDMDAVEIMDGTDEGIFSWFTVNFLL----------GRLSKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARHAVF 282          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0332459)

HSP 1 Score: 78.9518 bits (193), Expect = 1.051e-14
Identity = 70/264 (26.52%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  179 SMTIVFFTLSICGVVIICVLWAFANQLVYS---YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNE-----TIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLL 946
            S+ ++ F            L   A++  YS   Y  IIDAGST +++  +K+          + +    +  PG+S F ++P      I++ L DE    IPK   + + + L ATAG+R++                KA  ++  V + F  S   +    +  V+I+ G+ EG+ +W T N+L           G +SK     ALDLGG STQ+TF   +       +    +V    +  NV++HSYL  G   A + + 
Sbjct:   49 SVILLLFVFGFVSENASPYLARLASKFGYSKVQYAAIIDAGSTGSRVLAYKFNRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLL-DEARAFIPKEHWSSTPLVLKATAGLRLLP-------------ASKAENILNAVRDLFAKS---EFSVDMDAVEIMDGTDEGIFSWFTVNFLL----------GRLSKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARHAVF 285          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0332460)

HSP 1 Score: 78.9518 bits (193), Expect = 1.418e-14
Identity = 68/245 (27.76%), Postives = 110/245 (44.90%), Query Frame = 2
Query:  236 LWAFANQLVYS---YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNE-----TIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLL 946
            L   A++  YS   Y  IIDAGST +++  +K+          + +    +  PG+S F ++P      I++ L DE    IPK   + + + L ATAG+R++                KA  ++  V + F  S   +    +  V+I+ G+ EG+ +W T N+L           G +SK     ALDLGG STQ+TF   +       +    +V    +  NV++HSYL  G   A + + 
Sbjct:  128 LARLASKFGYSKVQYAAIIDAGSTGSRVLAYKFNRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLL-DEARAFIPKEHWSSTPLVLKATAGLRLLP-------------ASKAENILNAVRDLFAKS---EFSVDMDAVEIMDGTDEGIFSWFTVNFL----------LGRLSKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARHAVF 345          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Zebrafish
Match: entpd2a.1 (ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040724-187])

HSP 1 Score: 159.073 bits (401), Expect = 4.175e-56
Identity = 105/280 (37.50%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKS-APGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYL-----KDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            + YGI++DAGS+ T MF++KWP       G V+Q   C +   GIS +     GA   ++ C+ D+ M  IP      + VYLGATAGMR+     LN+        PK    + + VE  L S     K       I++G  EG   WIT NYL     K    G  +T G    ++T GALD GGASTQITFV+ +T+E+ +   K+RLYG +Y +Y+HS+LCYG+ Q   RLLA L     ++       T I +PC     ++S  L  +   PCV
Sbjct:   42 FMYGIVLDAGSSHTSMFIYKWPADKQNGTGIVSQHSECHAKGGGISSYAGVKGGAARSLKECM-DKAMREIPTVRYKHTPVYLGATAGMRL-----LNIS------KPKESAEVLKEVEEKLKSYPFSFK----GASILTGQEEGAYGWITVNYLLENYIKYGFVGQWITPG----RDTVGALDFGGASTQITFVTKQTVENKDDLMKLRLYGRDYQIYTHSFLCYGRDQVLLRLLAHLITIQGSD-------TSIIHPCYPADYSSSIKLSSVFDTPCV 294          

HSP 2 Score: 81.2629 bits (199), Expect = 4.175e-56
Identity = 53/183 (28.96%), Postives = 95/183 (51.91%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSL--GAFVAILIVFLVILSIGCLF 1701
            GT + + C   V  LF  S CS + C F+ V+QP ITG F+AF+ F   ++ L +         A     +R  C+ +    +    +K ++ E+  K  C   ++V  LL + Y FN+  +  I+F     + ++GWSLGYM++ ++++P E   +  SL  GA+  ++ +F ++L+   +F
Sbjct:  310 GTGNYNQCLGNVSQLFSFSSCSYSKCSFDGVFQPNITGNFMAFSAFFYTHSFLQEATGIKIWTPAHLEDAARVICNMS----LQEMGKKSQDNESRLKDYCAVSVFVRALLVNGYSFNDRTFPQISFQKKAGDTSVGWSLGYMLSLSNLLPAENVALKKSLRSGAWSFLIFLFSILLTSALIF 488          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Zebrafish
Match: entpd2a.2 (ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040724-67])

HSP 1 Score: 162.925 bits (411), Expect = 1.413e-55
Identity = 109/301 (36.21%), Postives = 156/301 (51.83%), Query Frame = 2
Query:  203 LSICGVVIICV-LWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSK-----KETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +S  G++++ V    F       YGI++DAGS+ T MF++KWP       G V+Q   C+    GIS +      A   +E C+ D+    IPK  +  + VYLGATAGMR+     LN+        PK    + + V   L S     K       I++G  EG   WIT NYL +      +  GF+ +     ++T GALD GGASTQITFV+ +T+E+ +   K+RLYG +Y +Y+HS+LCYG+ QA  RLLA L KT  ++       T I +PC     ++S  L  +   PCV
Sbjct:   14 VSFVGILLLVVNTEDFKEPAQLMYGIVLDAGSSHTSMFIYKWPADKQNGTGIVSQHSECRVKGGGISSYAGIKGAAARSLEECM-DKATKSIPKSRQRITPVYLGATAGMRL-----LNIS------KPKESAEVLKEVGEKLKSYPFSFK----GASILTGQDEGAYGWITVNYLLENF----IKYGFVGQWITPGRDTVGALDFGGASTQITFVTKQTVENKDDLMKLRLYGRDYQIYTHSFLCYGQDQALLRLLAHLIKTQGSD-------TSIVHPCYPADYSSSIKLSSVFDTPCV 287          

HSP 2 Score: 75.8702 bits (185), Expect = 1.413e-55
Identity = 44/157 (28.03%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVT--PTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPL 1626
            GT + + C   V  LF  S CS + C F+ V+QP ITG F+AF+ F  ++  L K         AD    ++  C+ +   +    PT     E ++ R +     +    L++ YGF++ ++  I+F   + + ++GWSLGYM++ ++++  E  +
Sbjct:  303 GTGNYNQCLGNVSQLFSFSSCSYSKCSFDGVFQPNITGNFMAFSAFYYIHQFLQKAAGITITSPADLEHAAQFVCNMSFQQMQNKFPT-----EGDHLRDYCADSVLMRVLLINGYGFSDLSFPHISFQEKVEDTSVGWSLGYMLSLSNLLDAENAM 454          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Zebrafish
Match: entpd2b (ectonucleoside triphosphate diphosphohydrolase 2b [Source:ZFIN;Acc:ZDB-GENE-061013-2])

HSP 1 Score: 154.836 bits (390), Expect = 1.903e-54
Identity = 100/302 (33.11%), Postives = 160/302 (52.98%), Query Frame = 2
Query:  200 TLSICGVVIICVLWAFANQL----VYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYL-KDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIES--GNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            +L + G+V I +L    +++     Y YGI++DAGS+ T ++++KWP       G VTQ   C     GIS +      A   +E+CL   ++ + P R      VYLGATAGMR+++  N        Y+  + ++ + E ++ F  S         R   I+S   EGV  W+T NYL ++ ++   V     S ++T GALDLGGASTQITF + E +ES   +  +RL+G  Y++Y+HSYLCYGK +A   +LA+L  +   +Y      + + +PC       ++ L+++   PC +
Sbjct:   22 SLLLFGIVSILLLTVSIHEIREPAQYMYGIVLDAGSSHTALYVYKWPADKLNGTGVVTQHSECHVKGGGISGYAGQRGAAGRSLELCLKQAVLDIPPHRHHLTP-VYLGATAGMRLLKLSN-------PYKASQVLQEVKETIKSFPFS--------FRGAVILSSQDEGVYGWVTVNYLLENFIKYGYVGRWLNSGRKTVGALDLGGASTQITFETPERVESELNHMTLRLFGHEYSLYTHSYLCYGKEEALRMILAYLITS--QDYTST---SKMYHPCYPSDFINAFRLKEVFDSPCTA 302          

HSP 2 Score: 80.1073 bits (196), Expect = 1.903e-54
Identity = 46/183 (25.14%), Postives = 91/183 (49.73%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYV-FELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSL--GAFVAILIVFLVILS 1686
            ++T  GT D  +C      +F    CS + C FN V+QP I+G F+AF+ +   ++ L ++ +      A     ++  C+      +T  T K  + + + K  C   +Y+   +L  Y F+  ++ ++ F      A++GW+LGY+++ +S++P E   I   L   A+  ++ +  V+L+
Sbjct:  314 HITVQGTGDYQSCLGNTSKIFSFKSCSFSQCAFNGVFQPNISGGFMAFSAYYFTHSFLQQITEMKISTYAQLEEATQAVCNMT----ITEMTMKAPDLKKYLKDYCAVAVYIQVLMLRGYNFDENSFQNVAFQKKAGEASVGWALGYILSVSSLLPEESAAIRKGLCPAAWTGLMFLISVLLT 492          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Zebrafish
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:ZFIN;Acc:ZDB-GENE-040724-142])

HSP 1 Score: 149.058 bits (375), Expect = 1.058e-52
Identity = 102/296 (34.46%), Postives = 154/296 (52.03%), Query Frame = 2
Query:  224 IICVLWAFANQLV----YS--YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            II ++ A AN+      YS  +GI+ DAGS+ T +FL++W        G V+Q + C     GIS ++ +P GA + ++ CL D     IP   +  + VYLGATAGMR+     LNL+        ++  ++ EV +     T        R  +I++G  EG   WITTNYL ++         ++  K  +  GALDLGGASTQI+F   + +   N+   ++LYG  Y +Y++SYLCYGK QA  +L A+L K   ++       + I +PC  KG   +  L ++   PCV
Sbjct:   21 IIALILALANRQTLDQPYSTQFGIVFDAGSSHTALFLYQWQGNKENNTGIVSQKQSCDVDGDGISSYVQNPAGAGESLKKCL-DIAKAAIPTEQQKSTPVYLGATAGMRL-----LNLQ-----NQTQSDSILAEVAK-----TIQTYPFDFRGARILTGMEEGAYGWITTNYLLESFIKHTFEGSWIHPKAGKIIGALDLGGASTQISFTPKDPVRDPNSAFNLQLYGYKYELYTYSYLCYGKDQALKKLQAYLHKNAGSS-------SSISHPCYHKGYNLNLTLAELYNSPCV 293          

HSP 2 Score: 80.1073 bits (196), Expect = 1.058e-52
Identity = 48/159 (30.19%), Postives = 82/159 (51.57%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPCSQT-NCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFE-LLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK 1620
            + + GT +   C   ++N+   + C+ + +CGFN +YQP + G+F AF+ +   ++ L    K+P       ++     CS+N   +   T +    K  + K  C    Y+   LL  Y FNN  W  I+F   + + ++GW+LGYM+N T+MIP E+
Sbjct:  305 ILFKGTGNSSLCLSLIENIVNLTGCALSPDCGFNGIYQPPVNGEFFAFSAYFYTFDFLGLTPKAPL---TKVLSTIDTLCSKNWTAL---TAENPSIKPKYLKDYCASGHYITTILLKGYKFNN-TWDQISFVKQVADTDIGWTLGYMLNLTNMIPSER 456          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Zebrafish
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:ZFIN;Acc:ZDB-GENE-040724-142])

HSP 1 Score: 149.058 bits (375), Expect = 1.058e-52
Identity = 102/296 (34.46%), Postives = 154/296 (52.03%), Query Frame = 2
Query:  224 IICVLWAFANQLV----YS--YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            II ++ A AN+      YS  +GI+ DAGS+ T +FL++W        G V+Q + C     GIS ++ +P GA + ++ CL D     IP   +  + VYLGATAGMR+     LNL+        ++  ++ EV +     T        R  +I++G  EG   WITTNYL ++         ++  K  +  GALDLGGASTQI+F   + +   N+   ++LYG  Y +Y++SYLCYGK QA  +L A+L K   ++       + I +PC  KG   +  L ++   PCV
Sbjct:   21 IIALILALANRQTLDQPYSTQFGIVFDAGSSHTALFLYQWQGNKENNTGIVSQKQSCDVDGDGISSYVQNPAGAGESLKKCL-DIAKAAIPTEQQKSTPVYLGATAGMRL-----LNLQ-----NQTQSDSILAEVAK-----TIQTYPFDFRGARILTGMEEGAYGWITTNYLLESFIKHTFEGSWIHPKAGKIIGALDLGGASTQISFTPKDPVRDPNSAFNLQLYGYKYELYTYSYLCYGKDQALKKLQAYLHKNAGSS-------SSISHPCYHKGYNLNLTLAELYNSPCV 293          

HSP 2 Score: 80.1073 bits (196), Expect = 1.058e-52
Identity = 48/159 (30.19%), Postives = 82/159 (51.57%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPCSQT-NCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFE-LLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK 1620
            + + GT +   C   ++N+   + C+ + +CGFN +YQP + G+F AF+ +   ++ L    K+P       ++     CS+N   +   T +    K  + K  C    Y+   LL  Y FNN  W  I+F   + + ++GW+LGYM+N T+MIP E+
Sbjct:  305 ILFKGTGNSSLCLSLIENIVNLTGCALSPDCGFNGIYQPPVNGEFFAFSAYFYTFDFLGLTPKAPL---TKVLSTIDTLCSKNWTAL---TAENPSIKPKYLKDYCASGHYITTILLKGYKFNN-TWDQISFVKQVADTDIGWTLGYMLNLTNMIPSER 456          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Xenopus
Match: foxc2 (forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382])

HSP 1 Score: 167.162 bits (422), Expect = 2.257e-61
Identity = 96/277 (34.66%), Postives = 148/277 (53.43%), Query Frame = 2
Query:  257 LVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            L  +YG++ DAGS+ T ++L++WP       G + Q   C    PGIS + + P+GA   ++ C+ D+++ +IP   + ++ V LGATAGMR++              N    +LIF+ + + L    +      R  +I++GS EG   W+T NYL  T      +    +  +TFGA+DLGGASTQ+TF     I+  +T++  RLYG NY +Y+HSYLCYG+ Q   RLLA + + W +          + +PC  KG  A+  L  +   PCV
Sbjct:   10 LCNTYGMVFDAGSSHTTLYLYQWPANKENDTGIIRQAYSCDVQGPGISSYADTPSGAAASLQPCM-DQVLSVIPAAQQRQTPVLLGATAGMRLLR-----------IENATKTQLIFDEISKTLGGYPVD----FRGARILTGSEEGSLGWVTVNYLLGTFHTYLGSWVHPTGGQTFGAMDLGGASTQMTFQPTGAIQDKDTEMFFRLYGYNYTIYTHSYLCYGQDQVFKRLLANILQGWSSGL--------VAHPCYAKGYRANISLASVFNSPCV 262          

HSP 2 Score: 91.6633 bits (226), Expect = 2.257e-61
Identity = 57/186 (30.65%), Postives = 95/186 (51.08%), Query Frame = 1
Query: 1144 LNVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVT--PTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSI 1689
            +NVT  GT DP  C +A+ N+F  S C S+ +C F+ VYQP   G+F AF+ F   ++ L    +    +    +    ++CS +   +    P   ++R  E      C   +Y+  LL   Y F++  W+ I F+    + ++GW+LGYM+N T+MIP E P    +    + +  +F ++LSI
Sbjct:  271 VNVTVEGTGDPTECHRAIGNVFNFSACQSKADCSFDGVYQPPAQGEFYAFSAFYYTFSFLNLTSRQSLSEANGTV---WNFCSSDWATLTGSFPLESRKRLLE-----YCSSGMYILTLLLDGYKFDSQTWNKIYFSKQAGSMDIGWTLGYMLNLTNMIPSEAPTYLKAHSYSLWVGAIFFIVLSI 448          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Xenopus
Match: foxc2 (forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382])

HSP 1 Score: 163.696 bits (413), Expect = 2.280e-60
Identity = 98/284 (34.51%), Postives = 149/284 (52.46%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMS---------KKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            + YG++ DAGS+ T ++L++WP       G + Q   C    PGIS + + P+GA   ++ C+ D+++ +IP   + ++ V LGATAGMR++              N    +LIF+ + + L    +      R  +I++GS EG   W+T NYL  T  G    SG  +           +TFGA+DLGGASTQ+TF     I+  +T++  RLYG NY +Y+HSYLCYG+ Q   RLLA + + W +          + +PC  KG  A+  L  +   PCV
Sbjct:   10 HPYGMVFDAGSSHTTLYLYQWPANKENDTGIIRQAYSCDVQGPGISSYADTPSGAAASLQPCM-DQVLSVIPAAQQRQTPVLLGATAGMRLLR-----------IENATKTQLIFDEISKTLGGYPVD----FRGARILTGSEEGSLGWVTVNYLLGTFVGVS-RSGVHTYLGSWVHPTGGQTFGAMDLGGASTQMTFQPTGAIQDKDTEMFFRLYGYNYTIYTHSYLCYGQDQVFKRLLANILQGWSSGL--------VAHPCYAKGYRANISLASVFNSPCV 268          

HSP 2 Score: 91.6633 bits (226), Expect = 2.280e-60
Identity = 57/186 (30.65%), Postives = 95/186 (51.08%), Query Frame = 1
Query: 1144 LNVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVT--PTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSI 1689
            +NVT  GT DP  C +A+ N+F  S C S+ +C F+ VYQP   G+F AF+ F   ++ L    +    +    +    ++CS +   +    P   ++R  E      C   +Y+  LL   Y F++  W+ I F+    + ++GW+LGYM+N T+MIP E P    +    + +  +F ++LSI
Sbjct:  277 VNVTVEGTGDPTECHRAIGNVFNFSACQSKADCSFDGVYQPPAQGEFYAFSAFYYTFSFLNLTSRQSLSEANGTV---WNFCSSDWATLTGSFPLESRKRLLE-----YCSSGMYILTLLLDGYKFDSQTWNKIYFSKQAGSMDIGWTLGYMLNLTNMIPSEAPTYLKAHSYSLWVGAIFFIVLSI 454          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 151.369 bits (381), Expect = 4.019e-58
Identity = 109/325 (33.54%), Postives = 159/325 (48.92%), Query Frame = 2
Query:  155 DIPKPA-----WYSMTIVF----FTLSICGVVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGD----KVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            D PK A     W+   I+F    F L +  +V I V+          YGI++DAGS+ T +++++WP       G V Q+  CK    GIS + ++P  A   ++ C+N +   +IP++ + ++ VYLGATAGMR++   N  +              +   VE  L S         +  +II+G  EG   WIT NYL      D    K    F    ET GALDLGGASTQITF S   IES    +  RLYG++Y++Y+HS+LCYGK QA         +  IAN   +   + + +PC   G   +     + + PC+S
Sbjct:    2 DEPKAAKQKKTWHKKVIIFLGALFVLGVISLVAIAVVQNKPLPKNIKYGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMN-KARQVIPEKQQRETPVYLGATAGMRLLRLTNATM-----------AEEVLSSVENTLRSFPFD----FQGARIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNF-KPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQA--------LRLQIANSIKDATDSILLDPCFNSGYRRNASTNDLYSSPCIS 301          

HSP 2 Score: 96.2857 bits (238), Expect = 4.019e-58
Identity = 55/176 (31.25%), Postives = 91/176 (51.70%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI-SMSLGAFVAILIVFLVIL 1683
            GT +   C++ V+ +F ++ C+ ++C FN V+QP + G F AF+ +  V N L    +    D      +   +CSR   P         + KE +    CF   Y+  LL   YGF++ NW+ I F   I +++ GW+LGYM+N T+MIP E P    +S   +  +++ F ++L
Sbjct:  316 GTGNYQLCKRNVQAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVER--HCSR---PWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIPAELPYSPPLSHAGYTGLMVFFSILL 486          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 151.369 bits (381), Expect = 4.224e-58
Identity = 106/317 (33.44%), Postives = 156/317 (49.21%), Query Frame = 2
Query:  164 KPAWYSMTIVF----FTLSICGVVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGD----KVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            K  W+   I+F    F L +  +V I V+          YGI++DAGS+ T +++++WP       G V Q+  CK    GIS + ++P  A   ++ C+N +   +IP++ + ++ VYLGATAGMR++   N  +              +   VE  L S         +  +II+G  EG   WIT NYL      D    K    F    ET GALDLGGASTQITF S   IES    +  RLYG++Y++Y+HS+LCYGK QA         +  IAN   +   + + +PC   G   +     + + PC+S
Sbjct:    8 KKTWHKKVIIFLGALFVLGVISLVAIAVVQNKPLPKNIKYGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMN-KARQVIPEKQQRETPVYLGATAGMRLLRLTNATM-----------AEEVLSSVENTLRSFPFD----FQGARIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNF-KPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQA--------LRLQIANSIKDATDSILLDPCFNSGYRRNASTNDLYSSPCIS 299          

HSP 2 Score: 96.2857 bits (238), Expect = 4.224e-58
Identity = 55/176 (31.25%), Postives = 91/176 (51.70%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI-SMSLGAFVAILIVFLVIL 1683
            GT +   C++ V+ +F ++ C+ ++C FN V+QP + G F AF+ +  V N L    +    D      +   +CSR   P         + KE +    CF   Y+  LL   YGF++ NW+ I F   I +++ GW+LGYM+N T+MIP E P    +S   +  +++ F ++L
Sbjct:  314 GTGNYQLCKRNVQAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVER--HCSR---PWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIPAELPYSPPLSHAGYTGLMVFFSILL 484          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 151.369 bits (381), Expect = 4.861e-58
Identity = 106/317 (33.44%), Postives = 156/317 (49.21%), Query Frame = 2
Query:  164 KPAWYSMTIVF----FTLSICGVVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGD----KVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            K  W+   I+F    F L +  +V I V+          YGI++DAGS+ T +++++WP       G V Q+  CK    GIS + ++P  A   ++ C+N +   +IP++ + ++ VYLGATAGMR++   N  +              +   VE  L S         +  +II+G  EG   WIT NYL      D    K    F    ET GALDLGGASTQITF S   IES    +  RLYG++Y++Y+HS+LCYGK QA         +  IAN   +   + + +PC   G   +     + + PC+S
Sbjct:   38 KKTWHKKVIIFLGALFVLGVISLVAIAVVQNKPLPKNIKYGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMN-KARQVIPEKQQRETPVYLGATAGMRLLRLTNATM-----------AEEVLSSVENTLRSFPFD----FQGARIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNF-KPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQA--------LRLQIANSIKDATDSILLDPCFNSGYRRNASTNDLYSSPCIS 329          

HSP 2 Score: 96.2857 bits (238), Expect = 4.861e-58
Identity = 55/176 (31.25%), Postives = 91/176 (51.70%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI-SMSLGAFVAILIVFLVIL 1683
            GT +   C++ V+ +F ++ C+ ++C FN V+QP + G F AF+ +  V N L    +    D      +   +CSR   P         + KE +    CF   Y+  LL   YGF++ NW+ I F   I +++ GW+LGYM+N T+MIP E P    +S   +  +++ F ++L
Sbjct:  344 GTGNYQLCKRNVQAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVER--HCSR---PWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIPAELPYSPPLSHAGYTGLMVFFSILL 514          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Mouse
Match: Entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:MGI Symbol;Acc:MGI:1321386])

HSP 1 Score: 154.451 bits (389), Expect = 1.911e-59
Identity = 92/276 (33.33%), Postives = 142/276 (51.45%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIE---SGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            YG+++DAGS+ T +++++WP       G V+Q   C     GIS + N+P  A    E C+  ++   +P+ L   + +YLGATAGMR++             +N  A R + E ++ +  S         R  +IISG  EGV  WIT NY+        +   ++     +T GALDLGGASTQI+FV+ E +E   S   +V LYG  Y +Y+HS+ CYG+++AE + LA L ++     N       I NPC  +G + ++ L  +    C 
Sbjct:   57 YGVVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFRCSVKGSGISSYENNPQDAPKAFEDCIL-KVKEQVPEHLHGSTRIYLGATAGMRLLR-----------LQNETAAREVLESIQSYFKSQPFD----FRGAQIISGQEEGVYGWITANYIMGNFLEKNLWHMWVHPHGVDTTGALDLGGASTQISFVAGEKMEPNASDTVQVSLYGYTYTLYTHSFQCYGQNEAEKKFLAMLLQSPSTEAN-------ISNPCYPQGYSTAFTLGHVFGSLCT 309          

HSP 2 Score: 97.0561 bits (240), Expect = 1.911e-59
Identity = 59/185 (31.89%), Postives = 94/185 (50.81%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTN-CGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSR---NAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLG--AFVAILIVFLVI 1680
            +VT++GT DP  C++ V ++F  + C + + C F+ +YQPK+ G F+AFAGF   Y     +  S       F   S D+C       P +++      R  E + +  CF   Y++ LL + Y F    W  I F   + N+++ WSLGYM++ T+ IP   PLI + +    F+ +L  F  I
Sbjct:  322 SVTFMGTGDPRLCREKVASVFDFNACQEQDACSFDGIYQPKVQGPFVAFAGF---YYTASALNLSGSFSLTSFNDSSWDFCRHTWSELPALLS------RFDETYARSYCFSAHYIYHLLVNGYKFTEETWPQIRFEKEVGNSSIAWSLGYMLSLTNQIPAGSPLIHLPIQPPVFMGVLAFFTAI 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Mouse
Match: Entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:MGI Symbol;Acc:MGI:1919340])

HSP 1 Score: 159.073 bits (401), Expect = 3.450e-58
Identity = 100/276 (36.23%), Postives = 148/276 (53.62%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKET---FGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +F+++WP    +  G V+Q   C+   PGIS + +DP  A + ++ CL +E + LIP+    ++  +LG+TAGMR++           + +N    R I   V + L     K        KI++G  EG   WIT NY+   L   K +SG     E     GALDLGGASTQI+FV    I   +T+V  RLYG NY+VY+HSYLC+G+ Q   RLLA L++  +++      + P+ +PC   G  A   L  +   PC+
Sbjct:   43 FGIVFDAGSSHTSLFVYQWPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCL-EEALALIPQAQHPETPTFLGSTAGMRLL-----------SQKNSSQARDILAAVSQTLS----KSPVDFWGAKILAGQDEGAFGWITINYVLGMLL--KYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILNRLLAKLAQDRLSS-----QVAPVRHPCYHSGYQAILPLSSLYDSPCI 295          

HSP 2 Score: 88.1965 bits (217), Expect = 3.450e-58
Identity = 53/161 (32.92%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKP 1623
            N+T  GT DP  C  A+++LF  S C  Q +C FN +YQP + G+F AF+ F   ++ L    +       D + K   +C +    V      +ER    W +  C   +Y+  LL   Y F+   W +I F     + ++GW+LG+M+N T MIP E P
Sbjct:  306 NLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYTFHFLNLTSRQSLNTVNDTVWK---FCQKPWKLVEVSYPGQER----WLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAP 459          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Mouse
Match: Entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:MGI Symbol;Acc:MGI:1919340])

HSP 1 Score: 159.073 bits (401), Expect = 3.450e-58
Identity = 100/276 (36.23%), Postives = 148/276 (53.62%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKET---FGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +F+++WP    +  G V+Q   C+   PGIS + +DP  A + ++ CL +E + LIP+    ++  +LG+TAGMR++           + +N    R I   V + L     K        KI++G  EG   WIT NY+   L   K +SG     E     GALDLGGASTQI+FV    I   +T+V  RLYG NY+VY+HSYLC+G+ Q   RLLA L++  +++      + P+ +PC   G  A   L  +   PC+
Sbjct:   43 FGIVFDAGSSHTSLFVYQWPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCL-EEALALIPQAQHPETPTFLGSTAGMRLL-----------SQKNSSQARDILAAVSQTLS----KSPVDFWGAKILAGQDEGAFGWITINYVLGMLL--KYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILNRLLAKLAQDRLSS-----QVAPVRHPCYHSGYQAILPLSSLYDSPCI 295          

HSP 2 Score: 88.1965 bits (217), Expect = 3.450e-58
Identity = 53/161 (32.92%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKP 1623
            N+T  GT DP  C  A+++LF  S C  Q +C FN +YQP + G+F AF+ F   ++ L    +       D + K   +C +    V      +ER    W +  C   +Y+  LL   Y F+   W +I F     + ++GW+LG+M+N T MIP E P
Sbjct:  306 NLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYTFHFLNLTSRQSLNTVNDTVWK---FCQKPWKLVEVSYPGQER----WLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAP 459          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Mouse
Match: Entpd2 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:MGI Symbol;Acc:MGI:1096863])

HSP 1 Score: 162.155 bits (409), Expect = 1.008e-54
Identity = 104/280 (37.14%), Postives = 148/280 (52.86%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYL-KDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            YGI++DAGS+ T MF++KWP       G V Q   C     GIS + NDP+ A   +  CL ++ +  +PK     + +YLGATAGMR+     LNL       +P+A   + E V + L     +     R  +I+SG  EGV  W+T NYL ++ ++   V      +K T GA+DLGGASTQITF +    E  + +V  RLYG++Y VY+HS+LCYG+ Q   RLLA  S   I  +          +PC  KG +   +L+++   PC  G   Q
Sbjct:   40 YGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVRGGGISSYANDPSRAGQSLVECL-EQALRDVPKDRYASTPLYLGATAGMRL-----LNLT------SPEATAKVLEAVTQTLT----RYPFDFRGARILSGQDEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPDNEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLA--SALQIHRF----------HPCWPKGYSTQVLLREVYQSPCTMGQRPQ 291          

HSP 2 Score: 73.559 bits (179), Expect = 1.008e-54
Identity = 44/165 (26.67%), Postives = 76/165 (46.06%), Query Frame = 1
Query: 1132 FEKFLNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKP 1623
            F     V+  GT++   C+  V  LF  S C  + C FN V+QP + G FIAF+ F    + L  V   P          +   C++    +      ++    ++    C   +++ +LLS  Y F+  ++  + F     +  +GW+LGYM+N T++IP + P
Sbjct:  293 FNSSATVSLSGTSNAALCRDLVSGLFNISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLKTVMGLPVGTLKQLEDATETTCNQTWAELQARVPGQQTRLPDY----CAVAMFIHQLLSRGYRFDERSFRGVVFEKKAADTAVGWALGYMLNLTNLIPADLP 453          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Mouse
Match: Entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:MGI Symbol;Acc:MGI:1919340])

HSP 1 Score: 159.073 bits (401), Expect = 1.327e-53
Identity = 100/276 (36.23%), Postives = 146/276 (52.90%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKET---FGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +F+++WP    +  G V+Q   C+   PGIS + +DP  A + ++ CL +E + LIP+    ++  +LG+TAGMR++           + +N    R I   V + L     K        KI++G  EG   WIT NY+   L   K +SG     E     GALDLGGASTQI+FV    I   +T+V  RLYG NY+VY+HSYLC+G+ Q   RLLA L++        +  + P+ +PC   G  A   L  +   PC+
Sbjct:   43 FGIVFDAGSSHTSLFVYQWPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCL-EEALALIPQAQHPETPTFLGSTAGMRLL-----------SQKNSSQARDILAAVSQTLS----KSPVDFWGAKILAGQDEGAFGWITINYVLGMLL--KYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILNRLLAKLAQ--------DSQVAPVRHPCYHSGYQAILPLSSLYDSPCI 292          

HSP 2 Score: 73.1738 bits (178), Expect = 1.327e-53
Identity = 46/161 (28.57%), Postives = 67/161 (41.61%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKP 1623
            N+T  GT DP  C  A+++LF  S C  Q +C FN +YQP + G+F                                 Y   + P            +E W +  C   +Y+  LL   Y F+   W +I F     + ++GW+LG+M+N T MIP E P
Sbjct:  303 NLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQF---------------------------------YVEVSYP-----------GQERWLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAP 419          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. UniProt/SwissProt
Match: sp|O93295|ENTP8_CHICK (Ectonucleoside triphosphate diphosphohydrolase 8 OS=Gallus gallus OX=9031 GN=ENTPD8 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.234e-61
Identity = 109/279 (39.07%), Postives = 151/279 (54.12%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSK------KETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            YG++ DAGST T +++++WP       G V+QV+ C  +  GIS + +DP GA   ++ CL D+ M +IP   + ++  YLGATAGMR++   N          + KA ++  EV +        +     R  +I++G+ EG   WIT NYL +TL    +   F  K       E  GALDLGGASTQITF    TIE  NT V  RLYG NY++Y+HSYLCYG+ QA  RL+A L +    +Y  N     I +PC  KG      + +I   PCV
Sbjct:   41 YGLVFDAGSTHTALYVYQWPADKENGTGIVSQVESCTVNGSGISSYADDPAGAGASLKPCL-DKAMAVIPVEQQWQTPTYLGATAGMRLLREQN----------STKAEQVFAEVSKAIR-----EFPVDFRGAQILTGNEEGSFGWITVNYLLETL----IKFSFAGKWEHPQNTEVLGALDLGGASTQITFQPGVTIEDKNTSVLFRLYGTNYSLYTHSYLCYGQIQASKRLMAALHQD--GSYVQN-----ISHPCYPKGYRRIITIAEIYDSPCV 292          

HSP 2 Score: 92.4337 bits (228), Expect = 2.234e-61
Identity = 59/188 (31.38%), Postives = 95/188 (50.53%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK-PLISMSLGAFVAILIVFLVILSIGCLFAII 1710
            +T  GT +P AC  A+  LF  +  +   CGF+ VYQP + G+F AFAGF   ++ L    +   +  +   A   D+C++N   +V    Q    KE+   +   G   +  L+  Y F+   W +I F+    NA++GW+LG+M+N T+MIP E    +     +  A  I F+V+  +  L AI+
Sbjct:  304 LTVTGTGNPAACPTAILKLFNLTCGANRTCGFDGVYQPPVRGQFFAFAGFYYTFSFLNLTGQ---QSLSHVNATVWDFCNKNWSELVETFPQN---KEHLHTYCVVGLYILTLLVDGYKFDEHTWSNIHFSQKAGNADIGWTLGFMLNLTNMIPTEALEHVKGHEPSLWAGAISFIVLAIVAGLVAIL 485          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. UniProt/SwissProt
Match: sp|P79784|ENTP2_CHICK (Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus OX=9031 GN=ENTPD2 PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 3.727e-58
Identity = 99/276 (35.87%), Postives = 143/276 (51.81%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYL-KDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            + YGI++DAGS+ T +F++KWP       G V++  MC    PGIS + + P  A   +E CL+  M   +PK     + +YLGATAGMR++              +P +   +  V     ++T           KI+SG  EGV  WIT NYL ++ ++   +     SKK+T GA+D GGASTQITF +++ IE    +V  +LYG+ Y VY+HS+LCYG+ Q   RLL+ + +    NY        + NPC   G   S  L  I   PC 
Sbjct:   36 FKYGIVLDAGSSHTAVFIYKWPADKENDTGVVSEHSMCDVEGPGISSYSSKPPAAGKSLEHCLSQAMRD-VPKEKHADTPLYLGATAGMRLL-----------TIADPPSQTCLSAV-----MATLKSYPFDFGGAKILSGEEEGVFGWITANYLLENFIKRGWLGEWIQSKKKTLGAMDFGGASTQITFETSDAIEDPKNEVMLKLYGQPYKVYTHSFLCYGRDQVLKRLLSKVLQA--ENYQET-----VANPCWPTGYRKSLSLSSIYDSPCT 287          

HSP 2 Score: 91.6633 bits (226), Expect = 3.727e-58
Identity = 58/193 (30.05%), Postives = 99/193 (51.30%), Query Frame = 1
Query: 1144 LNVTYV--GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMS-LGAFVAILIVFLVILSIGCLFAII 1710
            LN T V  GT + + C   V  LF  + CS ++C F+ V+QP+++G FIAF+ F    + +  V + P    +D    +   C+ +   +     + E+   ++    C    +V+ L++  Y FNN ++ SI F       ++GW+LGYM+N T+MIP ++P    S L  +  ILI+  VI ++  L   +
Sbjct:  296 LNTTVVVSGTGNGNLCAVHVNKLFDFTSCSFSHCSFDGVFQPEVSGNFIAFSAFFYTVDFIRTVMERPVHSPSDLKDAAETICATSWNELYQKAPRLEKRLPDY----CATSTFVYLLITKGYNFNNRSFPSIAFQKKAGETSIGWALGYMLNLTNMIPAQEPASHRSMLYNYWVILILLFVITTLTALLTAV 484          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. UniProt/SwissProt
Match: sp|Q9MYU4|ENTP1_PIG (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Sus scrofa OX=9823 GN=ENTPD1 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.150e-57
Identity = 112/299 (37.46%), Postives = 156/299 (52.17%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAID-GIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK-------ETFGALDLGGASTQITFV-SNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLPD 1129
            +GI++DAGS+ T ++++KWP       G V+QV+ CK   PGIS+F     G ID  +E C+ +    ++PK    ++ VYLGATAGMR++   N NL         K +  + E + R+            +  +II+G  EG   WIT NYL D        SG+ + K       ET+GALDLGGASTQITFV  N+ +ES    +  RLYG+NY+VY+HS+LCYGK QA   LL  L+K  + N N       I  PC   G      +  +   PC       + F TS+  P+
Sbjct:   49 FGIVLDAGSSHTSLYIYKWPAEKENDTGVVSQVEECKLKGPGISEFAKKL-GEIDIYLEACM-ERARTVVPKSQHAETPVYLGATAGMRLLRMKNENLA-------SKILSTVAESITRYPFD--------FQGARIITGQEEGAYGWITINYLLDKFIQK---SGWFNLKPRKGDTQETYGALDLGGASTQITFVPQNQVLESPENTLHFRLYGKNYSVYTHSFLCYGKDQA---LLQKLTKD-LKNTNGT-----IHEPCFHSGYQRRMNVSHLYEAPCT------RRFLTSLPFPE 312          

HSP 2 Score: 89.3521 bits (220), Expect = 1.150e-57
Identity = 62/198 (31.31%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKS----RDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLIS-MSLGAFVAILIVF---LVILSIGCLFAIISYKWYW 1728
            GT D   CQ++++ LF  S C  + C F+ V+ P   G F AF+ F  V       F +   +   F +K       +CSR   P           KE +    CF   Y+  LL S Y F    W +I F   + + ++GW+LGYM+N T+MIP E+P  + +S   +V ++++F   LVI+ I  LF      ++W
Sbjct:  317 GTGDFQKCQQSIRPLFNTSYCPYSRCSFDGVFLPLPQGDFAAFSAFYYVMG-----FLNLTSEEGSFQSKVTSTLEAFCSR---PWAELQMYFGDVKEKYLSEYCFSGTYILTLLLSGYHFTAETWKNIHFMGKVQSTSVGWTLGYMLNLTNMIPSEEPSSTRLSHSTYVFLMVLFSLILVIVVIIGLFVCHRPSYFW 506          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. UniProt/SwissProt
Match: sp|Q5MY95|ENTP8_HUMAN (Ectonucleoside triphosphate diphosphohydrolase 8 OS=Homo sapiens OX=9606 GN=ENTPD8 PE=1 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 1.250e-57
Identity = 97/277 (35.02%), Postives = 146/277 (52.71%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGE--VTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETF--GALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +FL++W  +A + NG   V+Q   C+   PGIS + ++   A + ++ CL +E + LIP+    K+  +LGATAGMR++           + +N    R IF  V + L  + +         ++++G  EG   WIT NY   TL     T  ++   E    GALD+GGASTQITFV    I   +T+   RLYG +Y+VY+HSYLC+G+ Q   RLL  L ++        +P   + +PC L G   +  L  +   PCV
Sbjct:   43 FGIVFDAGSSHTSLFLYQW--LANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCL-EEALVLIPEAQHRKTPTFLGATAGMRLL-----------SRKNSSQARDIFAAVTQVLGRSPVD----FWGAELLAGQAEGAFGWITVNYGLGTLVKYSFTGEWIQPPEEMLVGALDMGGASTQITFVPGGPILDKSTQADFRLYGSDYSVYTHSYLCFGRDQMLSRLLVGLVQS--------RPAALLRHPCYLSGYQTTLALGPLYESPCV 293          

HSP 2 Score: 97.4413 bits (241), Expect = 1.250e-57
Identity = 64/200 (32.00%), Postives = 102/200 (51.00%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI--SMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLK 1734
            N+T  GT +P AC  A++ LF  S C  Q +C F+ VYQP + G+F AF+ F   ++ L    + P    +   A   ++C R    V      ++R    W +  C   +Y+  LL   YGF+   W S+ F       ++GW+LGYM+N T MIP + P    + S G +VA  +VF+V+  +  + A +  + +WL+
Sbjct:  304 NLTVEGTGNPGACVSAIRELFNFSSCQGQEDCAFDGVYQPPLRGQFYAFSNFYYTFHFLNLTSRQP---LSTVNATIWEFCQRPWKLVEASYPGQDR----WLRDYCASGLYILTLLHEGYGFSEETWPSLEFRKQAGGVDIGWTLGYMLNLTGMIPADAPAQWRAESYGVWVAK-VVFMVLALVAVVGAAL-VQLFWLQ 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. UniProt/SwissProt
Match: sp|A0JND9|ENTP8_BOVIN (Ectonucleoside triphosphate diphosphohydrolase 8 OS=Bos taurus OX=9913 GN=ENTPD8 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.771e-57
Identity = 90/275 (32.73%), Postives = 140/275 (50.91%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKS-APGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKET--FGALDLGGASTQITFVSNETI--ESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            +GI+ DAGS+ T +F+++WP       G V+Q   C++  PGIS + ++P    + ++ CL +E + LIPK    ++ ++LGATAGMR++           + +N      +F  V R L  + +      R  ++++G  EG   WIT NY+   L     +  ++   E    GALD+GGASTQITFV    I  ++     RLYG ++ VY+HSYLC+G+ QA  R+LA L +              I +PC   G   +  L  +   PC 
Sbjct:   43 FGIVFDAGSSHTSLFVYQWPANKENDTGIVSQALACQAEGPGISSYASNPARVGESLQGCL-EEALALIPKAKHHETPMFLGATAGMRLL-----------SRKNRSQAEDVFAAVSRALGQSPVD----FRGAELLTGQDEGAFGWITINYILGLLVKYSFSGEWIRPLEETLVGALDMGGASTQITFVPGGPILDKTAQATFRLYGADHTVYTHSYLCFGRDQALSRVLAELVQASTGLL--------IRHPCYHSGYRGTLALASLYESPCA 293          

HSP 2 Score: 101.679 bits (252), Expect = 1.771e-57
Identity = 63/207 (30.43%), Postives = 104/207 (50.24%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSR-------NAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI--SMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLK 1734
            N+T  GT +P AC +A++ LF  S C  + +C F  VYQP + G+F AF+ F   +N  + +   P    A+  A   ++C R       +APP           ++ W +  C   +Y+  LL   YGF+   W  I F      A++GW+LGYM+N T++IP E P    + S G + A ++   V+L++      ++ + +WL+
Sbjct:  303 NLTVEGTGNPGACVEALRKLFNFSSCDGREDCAFAGVYQPPVQGQFYAFSNFYYTFN-FLNLTSKPSLSGAN--ATIWEFCLRPWKLVEASAPP----------GQDRWLRDYCASGLYILTLLVEGYGFSEETWGGIEFRQQAGGADIGWTLGYMLNLTNLIPAEAPAQGWAQSFGVWAAGVV--FVVLTLAATLGAVAVQVFWLQ 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. TrEMBL
Match: A0A068YEN9 (Ectonucleoside triphosphate diphosphohydrolase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000828350 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.049e-67
Identity = 115/305 (37.70%), Postives = 162/305 (53.11%), Query Frame = 2
Query:  236 LWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVR-LYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSV----DLPDSL 1135
            L+A A  +   Y ++IDAGSTS+K+ +FKW +   + NG V +VKM K  PGIS + +    A   +E  +   +   IP   R  + V+L ATAGMR++              NP     I E ++  L   GL +     DV+I+SG  EG+ +WIT NYL   L    V    + +K+T GALDLGGASTQITFV      + +T  R L+G+ +N+YS+SYLCYGKS AE R+ A +          NQ    IDNPC  +G+       KI    CVS  Y+    G+++    DLP+++
Sbjct:   35 LYAIACNVGCVYTLLIDAGSTSSKLTVFKWKDWPFQKNGYVEEVKMAKVQPGISAYKDKSADAFAALEPHIMKLLGQTIPSESRHSTRVFLAATAGMRLL-----------TLENPLQSEAIIESLQLQLPQVGLMVDNPYSDVRIMSGRDEGIYSWITVNYLTKKLGSRNVPP--VDEKQTIGALDLGGASTQITFVPENNKPAPHTSTRNLFGKAFNLYSYSYLCYGKSAAEKRIWAEIIG--------NQSAREIDNPCFHQGNVVVVKTSKIFAEQCVSSKYADVLVGSALFPHKDLPENV 318          

HSP 2 Score: 107.457 bits (267), Expect = 1.049e-67
Identity = 65/187 (34.76%), Postives = 97/187 (51.87%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPN-WHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAF---VAIL-IVFLVILSIG 1692
            NVT+ GT DP  C++ V+ +F    CSQ  C F+ +Y+P + G F AF+GF  V   L    +       +F  +   +C R+   +   T+   R   ++    CF  +Y+  LLS +GFN  + W SITF+  I    + W+ GY I+ T MI    P I + L AF   VA+L +VF V+L+I 
Sbjct:  317 NVTFKGTGDPTKCREIVEKIFPTKVCSQEPCIFHGIYRPNLRGNFHAFSGFTYVMAYLDFPIEGRKPTRDEFRQRVDAFCKRSWNDISASTSPDSR---SFVSLYCFDGVYIDALLSHFGFNTSDSWRSITFSAKIDGVTVSWAPGYAIDATGMIESTSPKIDLGLLAFTTSVAVLSVVFAVLLAIA 500          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. TrEMBL
Match: A0A3B1KCT0 (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Astyanax mexicanus OX=7994 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.149e-66
Identity = 115/322 (35.71%), Postives = 169/322 (52.48%), Query Frame = 2
Query:  164 KPAWYSMTIVFFT-LSICGVVIICVLWAFANQLV---YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSG-NYSQQNF 1105
            K  W+   I+F T L + G+V +  +    N+ +   Y YGI++DAGS+ T +++++WP       G V Q+  C     GIS +  +PN A D ++ C+ D+   +IP     ++ VYLGATAGMR++E            +N  A   + E VER L +         +  +IISG  EG   WIT NYL ++L   +  SG      T GALDLGGASTQITFVS +  ES +  +  RLYG +Y+VY+HS+LCYGK Q    +L       I   +       +++PC   G   +   Q +   PCV+G +Y ++NF
Sbjct:   10 KNPWHRPRIIFITVLFVIGIVSMVAIGVVQNKPLHQKYKYGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCM-DKARSIIPNHRHPETPVYLGATAGMRLLE-----------MKNAAASEKVLESVERVLQTYPFS----YQGARIISGQEEGAFGWITVNYLNESL---RQASG------TLGALDLGGASTQITFVSGQKQESPDNSIDFRLYGHDYHVYTHSFLCYGKDQ----VLKLSLANEIRPVHTKTETIVVEDPCFHPGYRMNKNFQSVFNSPCVTGLSYPEKNF 302          

HSP 2 Score: 103.605 bits (257), Expect = 3.149e-66
Identity = 61/211 (28.91%), Postives = 102/211 (48.34%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQL---VKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI-SMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLKPVTEKSSEVV 1764
            N  ++G+ +   C  AV+ +F  S CS + C FN ++QP++ G+F AF+ F  V + L           ++   + A   +   +N P V          KE +    CF   Y+  LL   Y F + NW  I F   I N++ GW+LGYM+N T+MIP E P    +  G +V ++++F V++ +  L A   ++    +P      E++
Sbjct:  301 NFVHMGSGNGTKCHAAVRKVFNDSGCSYSICSFNGIFQPRVEGQFGAFSAFFFVMDFLNLTTLSLDEAKEELGKYCATPWEIIKQNHPNV----------KEKYLAEYCFSGTYILTLLEDGYNFTSHNWQDIKFIKKIGNSDAGWTLGYMLNLTNMIPAESPDTPPLPYGGYVTLMVLFAVMILLLGLLACKVFR----RPTGSAQKEII 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. TrEMBL
Match: A0A5K3EYZ3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 3.227e-66
Identity = 109/314 (34.71%), Postives = 164/314 (52.23%), Query Frame = 2
Query:  179 SMTIVFFTLSICGVVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVR-LYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSV 1117
            S+ ++ F +    ++ +  L+  A  + Y Y ++IDAGSTS+K+ +FKW +   + NG V +V M K APGIS + + P  A + ++  L D +   +P+  +  + ++L ATAGMR++E             NP     I E +   L   G K+     D++I+SG  EG+ AWIT NYL+       V     S +E  GALDLGGAS QITFV      + +T  R L+G  Y VYS+S+LCYGKS ++ R+ A +          NQ    I+NPC L+         +I T PCV   Y+ +  G+ +
Sbjct:   20 SLLVIIFVV----IITLVALYIVACNVGYLYAVLIDAGSTSSKISVFKWRDWPFQHNGRVEEVYMKKVAPGISSYKDHPEEAFNTLKPTLLDLLQEYVPQESKKSTRLFLAATAGMRLVE-----------LDNPLKADAIMENLRSQLPHVGAKVNNPYSDIRIMSGRDEGINAWITVNYLEKKFGVHGVAPS--SGQEMIGALDLGGASAQITFVPKNPSLAPHTSTRYLFGSEYYVYSYSHLCYGKSASQKRVWAEIIG--------NQSTATINNPCFLQNYELKVKKSEIFTEPCVKSKYAVELIGSEL 308          

HSP 2 Score: 106.686 bits (265), Expect = 3.227e-66
Identity = 64/186 (34.41%), Postives = 95/186 (51.08%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGF-NNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVA----ILIVFLVILSI 1689
             +T VGT DPD C++ V+ +F    C+Q+ C F  VY+P + GKF AF+G+A V + L    K          AK  ++C R+   V         E   +    C   +Y+  LLS YGF ++ +W +I F + I    + W+ GY+I+ T MI  E P I + L AFV     + IVF+ +L I
Sbjct:  317 EITLVGTGDPDQCRQFVQKMFPSKACAQSPCMFQGVYRPPLHGKFSAFSGYAFVIDHLNFPTKGQNLTRDAVKAKVDEFCRRDWTQVAQEYPASSLE---FIAGYCQDGVYIDALLSNYGFVDSESWKNIVFASKIAGTTVSWAPGYLIDATGMIDSESPKIDLGLTAFVTSVVILSIVFVALLVI 499          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. TrEMBL
Match: A0A564Y308 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2070 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.817e-66
Identity = 109/288 (37.85%), Postives = 164/288 (56.94%), Query Frame = 2
Query:  266 SYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVR-LYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLP 1126
            +Y ++IDAGSTS+K+ +F W +     NG V ++   K +PGIS + NDP  A + +E  + + +   IP   ++++  YL ATAGMR+++             NP     I EV++  L  TGLK+     DV+++SG  EG+ A+IT NYL     GD+ +S  + + +T G+LDLGGASTQI FVS E + + +T  R L+G +Y +YS+SYLCYGKS AE R+ A   +  + N N   P  PI+NPC+      +     I    CV+G Y+    G+++  P
Sbjct:   44 AYALLIDAGSTSSKLSVFTWKDWPYIDNGYVRELSTDKVSPGISSYKNDPKEAYNKLEPNITNLVKACIPSDQQSRTHQYLAATAGMRLLD-----------LENPLKSEAIIEVLQLNLPRTGLKLGNPYSDVRVMSGRDEGIYAFITVNYLLGKF-GDQQSSP-VDQLQTVGSLDLGGASTQIAFVS-EDVNAPHTSTRGLFGNDYTIYSYSYLCYGKSAAEKRVWA---QIIVNNSNAADPHKPIENPCLNMDKNITIETAPIFDDQCVTGTYASDLVGSALTKP 314          

HSP 2 Score: 102.449 bits (254), Expect = 5.817e-66
Identity = 58/186 (31.18%), Postives = 93/186 (50.00%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFAL------VYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGF-NNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVIL 1683
            ++T+ GT DPD C++ V+ +F    CSQT C F ++Y+P + G F+AF+GF        VYN+             D+ A+   +C      V     +K    + +    CF   Y+  LL+ YGF  + +W  ITF + + NA + W++GY I+ T MI    P I +   AF+A ++   +I 
Sbjct:  320 DITFYGTGDPDKCREFVRMMFPSKTCSQTPCMFGDIYRPALRGNFLAFSGFTYSAKFFGVYNKSTT--------RTDYRAQVDKFCKLPYADV-----KKLPGYDKYTYIYCFDGAYIETLLAGYGFEESESWKKITFEDKVNNAIVSWAMGYTIDATGMIESASPQIKLDTNAFIASVVCLSIIF 492          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. TrEMBL
Match: A0A0A0AVE8 (Ectonucleoside triphosphate diphosphohydrolase 8 (Fragment) OS=Charadrius vociferus OX=50402 GN=N301_09831 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.036e-64
Identity = 105/275 (38.18%), Postives = 152/275 (55.27%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKET--FGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            YG++ DAGST T +++++WP       G ++QV+ C  S PGIS + ++P GA   ++ CL D+ M ++P   + ++  YLGATAGMR++   N          + KA ++  EV +        +     R  +I++G+ EG   WIT NYL +TL        +   ++T   GALDLGGASTQITF    TIE  NT V  RLYG NY++Y+HSYLCYG++QA  RL    S++   + +P Q    I +PC  KG   S     +   PCV
Sbjct:    3 YGLVFDAGSTHTALYIYRWPADKENGTGIISQVEACTVSGPGISSYADNPAGAGASLKPCL-DKAMKVVPAEQQRETPTYLGATAGMRLLREQN----------STKAEQVFAEVAKAIG-----EYPVDFRGARILTGNEEGSFGWITVNYLLETLVKFSFAEKWEHPQDTEVLGALDLGGASTQITFQPGVTIEDKNTSVFFRLYGTNYSLYTHSYLCYGQTQALKRLPTNCSRSLQGSPSPQQ----ISHPCYPKGYRESITTTDLYDSPCV 257          

HSP 2 Score: 104.76 bits (260), Expect = 1.036e-64
Identity = 68/193 (35.23%), Postives = 98/193 (50.78%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWR--CFGFIYVFE-LLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKP--LISMSLGAFVAILIVFLVIL-SIGCLFAII 1710
            +T  GT DPDAC  A++ LF  S      CGFN VYQP + G+F AF+GF   Y+ L  +  +     +   A    +C+ +   V     QKE    N  + R  C    Y    LL  Y FN+  W +I F   + N ++GW+LGYM+N T+MIP E P  +I +    ++A  ++  V+L  I CL  +I
Sbjct:  269 LTVTGTGDPDACSSAIQKLFDFSCGGNRTCGFNGVYQPPVRGQFFAFSGF---YHSLHSLNLTGGLSLSSVNATMEQFCNSSWEKV-----QKEFPAMNRTQLRDACAASSYTLTLLLQGYKFNHTTWLNIHFIRQVTNMDVGWTLGYMLNLTNMIPSETPQRVIGLQRSNWIAATVLLAVMLILIFCLLTVI 453          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Cavefish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:103029336])

HSP 1 Score: 181.415 bits (459), Expect = 1.968e-69
Identity = 115/322 (35.71%), Postives = 169/322 (52.48%), Query Frame = 2
Query:  164 KPAWYSMTIVFFT-LSICGVVIICVLWAFANQLV---YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSG-NYSQQNF 1105
            K  W+   I+F T L + G+V +  +    N+ +   Y YGI++DAGS+ T +++++WP       G V Q+  C     GIS +  +PN A D ++ C+ D+   +IP     ++ VYLGATAGMR++E            +N  A   + E VER L +         +  +IISG  EG   WIT NYL ++L   +  SG      T GALDLGGASTQITFVS +  ES +  +  RLYG +Y+VY+HS+LCYGK Q    +L       I   +       +++PC   G   +   Q +   PCV+G +Y ++NF
Sbjct:   10 KNPWHRPRIIFITVLFVIGIVSMVAIGVVQNKPLHQKYKYGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCM-DKARSIIPNHRHPETPVYLGATAGMRLLE-----------MKNAAASEKVLESVERVLQTYPFS----YQGARIISGQEEGAFGWITVNYLNESL---RQASG------TLGALDLGGASTQITFVSGQKQESPDNSIDFRLYGHDYHVYTHSFLCYGKDQ----VLKLSLANEIRPVHTKTETIVVEDPCFHPGYRMNKNFQSVFNSPCVTGLSYPEKNF 302          

HSP 2 Score: 103.605 bits (257), Expect = 1.968e-69
Identity = 61/211 (28.91%), Postives = 102/211 (48.34%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQL---VKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI-SMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLKPVTEKSSEVV 1764
            N  ++G+ +   C  AV+ +F  S CS + C FN ++QP++ G+F AF+ F  V + L           ++   + A   +   +N P V          KE +    CF   Y+  LL   Y F + NW  I F   I N++ GW+LGYM+N T+MIP E P    +  G +V ++++F V++ +  L A   ++    +P      E++
Sbjct:  301 NFVHMGSGNGTKCHAAVRKVFNDSGCSYSICSFNGIFQPRVEGQFGAFSAFFFVMDFLNLTTLSLDEAKEELGKYCATPWEIIKQNHPNV----------KEKYLAEYCFSGTYILTLLEDGYNFTSHNWQDIKFIKKIGNSDAGWTLGYMLNLTNMIPAESPDTPPLPYGGYVTLMVLFAVMILLLGLLACKVFR----RPTGSAQKEII 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Cavefish
Match: entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:NCBI gene;Acc:103030351])

HSP 1 Score: 146.362 bits (368), Expect = 9.470e-58
Identity = 94/283 (33.22%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMC-KSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIESGN-TKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTP------------IDNPCMLKGDTASYILQKIITI 1069
            YGI++DAGS+ T ++L++WP       G V+Q   C    PGIS+  +D   +   ++ C+ D++   +P    + + ++LGATAGMR++             +N +A   I + ++++L S    +    ++  IISG  EG+  WIT NYL        + + ++     +T G+LDLGGASTQI F + +     +  +V LYG  YNVY+HS+LCYGK++AE ++LA L K+       N P  P             D+ C  K   ASY   K IT 
Sbjct:   61 YGIVLDAGSSRTTVYLYQWPAEKENNTGVVSQTTKCLVKGPGISEMNDD---SWKYLKTCM-DDITKHVPPSQHSSTPIFLGATAGMRLLH-----------IKNEEASNTILQDIQKYLRS----LPFNFQNASIISGQEEGLYGWITVNYLMGNFLEKNMWNAWVHPHGAKTVGSLDLGGASTQIAFTAPDDATGEDLIRVSLYGYEYNVYTHSFLCYGKNEAEKKVLAELVKSSTDWSRVNHPCYPADYSITMAASEIFDSECTKKSTPASYSPAKNITF 324          

HSP 2 Score: 99.3673 bits (246), Expect = 9.470e-58
Identity = 62/194 (31.96%), Postives = 104/194 (53.61%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPC-SQTNCGFNNVYQPKITGKFIAFAGFALVYNQL-VKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLS-AYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSL--GAFVAILIVFLVILSIGCLFAIIS 1713
            N+T+ G +DP  C+  VK +F    C  + NC F  VYQP ++G+F+A+AGF      L VK   +  + N   ++    +CS+   P  T     E  +++ + + C+   YV  +L+  Y FN+ NW ++ F   +   ++ WSLGYM+ +++MIP E  L+ + +   AF  +L VF  +  I  +F II+
Sbjct:  321 NITFFGGSDPVRCKDLVKRIFDFKSCQGKENCSFEGVYQPPVSGEFMAYAGFYYTAWALDVKGSNTLKQFNTAMLS----FCSK---PWATLKKNYEITEKHLKSY-CYSANYVHTILADGYKFNDDNWENLNFQKEVNQTSIAWSLGYMLAQSNMIPAEAKLLKLPIPNSAFAGLLFVFSALTIITLMFLIIT 506          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Cavefish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:103029336])

HSP 1 Score: 181.415 bits (459), Expect = 2.808e-57
Identity = 115/322 (35.71%), Postives = 169/322 (52.48%), Query Frame = 2
Query:  164 KPAWYSMTIVFFT-LSICGVVIICVLWAFANQLV---YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSG-NYSQQNF 1105
            K  W+   I+F T L + G+V +  +    N+ +   Y YGI++DAGS+ T +++++WP       G V Q+  C     GIS +  +PN A D ++ C+ D+   +IP     ++ VYLGATAGMR++E            +N  A   + E VER L +         +  +IISG  EG   WIT NYL ++L   +  SG      T GALDLGGASTQITFVS +  ES +  +  RLYG +Y+VY+HS+LCYGK Q    +L       I   +       +++PC   G   +   Q +   PCV+G +Y ++NF
Sbjct:   10 KNPWHRPRIIFITVLFVIGIVSMVAIGVVQNKPLHQKYKYGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCM-DKARSIIPNHRHPETPVYLGATAGMRLLE-----------MKNAAASEKVLESVERVLQTYPFS----YQGARIISGQEEGAFGWITVNYLNESL---RQASG------TLGALDLGGASTQITFVSGQKQESPDNSIDFRLYGHDYHVYTHSFLCYGKDQ----VLKLSLANEIRPVHTKTETIVVEDPCFHPGYRMNKNFQSVFNSPCVTGLSYPEKNF 302          

HSP 2 Score: 62.3882 bits (150), Expect = 2.808e-57
Identity = 38/139 (27.34%), Postives = 60/139 (43.17%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVY---NQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTI 1551
            N  ++G+ +   C  AV+ +F  S CS + C FN ++QP++ G+F AF+ F  V    N          ++   + A   +   +N P V          KE +    CF   Y+  LL   Y F + NW  I F   +
Sbjct:  301 NFVHMGSGNGTKCHAAVRKVFNDSGCSYSICSFNGIFQPRVEGQFGAFSAFFFVMDFLNLTTLSLDEAKEELGKYCATPWEIIKQNHPNV----------KEKYLAEYCFSGTYILTLLEDGYNFTSHNWQDIKFIKKV 429          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Cavefish
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:ZFIN;Acc:ZDB-GENE-040724-142])

HSP 1 Score: 162.155 bits (409), Expect = 1.907e-53
Identity = 104/303 (34.32%), Postives = 159/303 (52.48%), Query Frame = 2
Query:  203 LSICGVVIICVLWAFAN----QLVYS--YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKK--ETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCV 1078
            L++  + I+ ++ + AN    ++ YS  YGI+ DAGST T +FL++WP       G V+Q  MC     GIS ++ +P GA + +  CL D  +  +PK+ +  + VYLGATAGMR++           + +N     +I   V +F+ S         R   IISG+ EG   WIT NYL +          +   K     GA+DLGG+STQI+F   + ++   +   ++LYG+ Y +Y+HSYLC+GK QA  +L A+L KT  AN      L+ +++PC   G   +  L  +   PCV
Sbjct:   16 LAVACMSIVALILSLANYQRVEVPYSTQYGIVFDAGSTHTALFLYQWPGNKENNTGVVSQNLMCDVKGDGISSYVTNPAGAGESLRECL-DVALAAVPKKKQKTTPVYLGATAGMRLL-----------SLQNQTQANIIIAEVSKFIQSYPFD----FRGATIISGTEEGAYGWITINYLLEDFIKYTFDGKWSHPKAGRILGAMDLGGSSTQISFTPKDAVKDPTSAFNLQLYGQKYQLYTHSYLCFGKDQALRKLQAYLQKT--AN------LSTVNHPCYHTGYNLTITLGNLYDSPCV 294          

HSP 2 Score: 69.3218 bits (168), Expect = 1.907e-53
Identity = 54/198 (27.27%), Postives = 93/198 (46.97%), Query Frame = 1
Query: 1132 FEKFLNVTYVGTADPDACQKAVKNLFLQSPCSQT-NCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSP-PKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLG----AFVAILIVFLVILSIGCLFAI 1707
            F     VT+VGT D   C  + +N+   S C+ + +CGFN VYQP + G F AF+ +   ++ L    ++P P+     ++   ++C+ N   +++ T    +EK+          +     L  Y               + + ++GW+LGYM+N T++IP E+PL    +     A     IVF + LS+  L A+
Sbjct:  300 FNPSAKVTFVGTGDSALCLSSFRNVVNLSDCALSPDCGFNGVYQPPVNGDFYAFSAYFYTFDFLGLAPRTPLPQ----VLSTIDNFCNTNWTTLLS-TYPNVKEKDKQHTHTHTHSLTHCRCLYLY--------------NVSDTDIGWTLGYMLNLTNLIPAERPLAVTGVENKQWAAEVFFIVFGLFLSLIILIAL 478          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Cavefish
Match: entpd2a.1 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:103024136])

HSP 1 Score: 155.221 bits (391), Expect = 2.140e-51
Identity = 101/284 (35.56%), Postives = 143/284 (50.35%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKE---GLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSK-----KETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            Y YGI++DAGS+ T MF++KWP       G V+Q   C     GIS +     GA   +E C+ D  +  IPK    ++ +YLGATAGMR+     LN+        PK       V +  L   G K+K     ++   I++G  EG   W+T NYL +      +  GF+       K+T GALD GGASTQITF + E +E+     K+RLYG +Y++Y+ S+LCYG+ Q   +LLA L +T  +N         I +PC       S  L  +   PC +
Sbjct:   40 YMYGIVLDAGSSHTAMFIYKWPANKQNGTGIVSQHSECDVDGGGISSYAGQKGGAARSLEKCM-DHAIQKIPKVRHHQTPIYLGATAGMRL-----LNIS------QPK-------VSDEILKEVGEKLKTYPFSVKGATILTGQEEGAYGWVTVNYLLENF----IKYGFVGHWLSPGKKTVGALDFGGASTQITFETKEKVENVENLMKLRLYGRDYHIYTQSFLCYGRDQMLRKLLAHLVETQGSN-------DAIIHPCYPADYNVSITLDNVFDTPCTA 293          

HSP 2 Score: 69.3218 bits (168), Expect = 2.140e-51
Identity = 48/183 (26.23%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPT----TQKEREKENWRKWRCFGFIYV-FELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLI--SMSLGAFVAILIVFLVILSI 1689
            G+ +   C   + ++F    C+ + C FN V+QP ++G F+AFA F  +++ L        K        S       A  V   +     QK  E+++  +  C   +++   LL  YGF+  ++  I+F       ++GW+LGYM++ +S++P E   +  ++S GA+  ++ +F V L I
Sbjct:  310 GSGNYQHCLGNMSHIFSFQTCTYSKCSFNGVFQPNVSGNFMAFAAFFYIHSFL--------KSTTGITVTSPSLLEEAAITVCNMSFHEMLQKVPEQQSRLQDYCAATVFMKVLLLKGYGFDRLSFPQISFQKKAGETSVGWALGYMLSLSSLLPAESVSLRKALSPGAWNTLIFLFSVALFI 484          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003192.1 (pep scaffold:Pmarinus_7.0:GL484058:1986:12022:-1 gene:ENSPMAG00000002913.1 transcript:ENSPMAT00000003192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 3.451e-40
Identity = 98/280 (35.00%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-----SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNY-LKDTLQGDKVTS-GFMSKKETFGALDLGGASTQITFVSNETIESG--NTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            YGI++DAGS+ T +F+++WP       G + Q  +C      +  GIS + + P+GA + +  C+ D+   ++PK     + + LGATAGMR++E             +  A + +   V   L S     +EG    +IISG  EG   WIT NY L + +Q   +    + +  +  GALDLGGASTQITF++ E ++    +  ++LYG  Y+VYSHSYLCYG+ QA  R L+ L K          P   +DNPC     + +Y L  I   PC S
Sbjct:   42 YGIVLDAGSSHTALFVYEWPAEKQNDTGVIAQRHLCDVDDELAGGGISSYSSSPSGAGESLRACM-DKAKAIVPKDRWADTPLALGATAGMRLLE-----------MSDSVAAKAVLSSVREVLGSYPFSYREG----RIISGQEEGTYGWITANYFLYNFIQFTWLGKWQWTTSTKPIGALDLGGASTQITFMTEEPLQGSPDSLTIQLYGRKYHVYSHSYLCYGRDQAIKRFLSTLYKA--------SPGALVDNPCYPTLYSVAYNLSFIYDSPCTS 297          

HSP 2 Score: 46.9802 bits (110), Expect = 3.451e-40
Identity = 19/46 (41.30%), Postives = 30/46 (65.22%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFI 1284
            +VT+ GTA+P  C   + ++F  S CS  NC F+ V+QP + G+F+
Sbjct:  309 SVTFRGTANPAECSNTISSIFNFSACSSPNCTFDGVWQPPVRGQFL 354          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008355.1 (pep scaffold:Pmarinus_7.0:GL477173:2090:22790:1 gene:ENSPMAG00000007537.1 transcript:ENSPMAT00000008355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 8.530e-34
Identity = 84/233 (36.05%), Postives = 125/233 (53.65%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLK-DTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSK 961
            YG+++DAGS+ T +F+++WP       G VTQV        GIS + + P  A   +   L +    L+P     ++ + +GATAGMR++             +NP+A   + E V+  L +T           +I++G  EG   W+T NYL+ + LQ D ++       +T GALDLGGASTQI FV      SG  + RLYG ++ V++HSYLCYGK +A  R+ A LS+
Sbjct:    1 YGVVLDAGSSHTSLFVYQWPADKENDTGVVTQVAHIDVEGGGISSYKDHPEMAGQSLVPSLFNATK-LVPPERHHETPISVGATAGMRLLR-----------KQNPEAAERVMESVKTALRATPFLFC----SARILTGQEEGAFGWVTINYLQGNFLQRDWLSWVRPRGAKTVGALDLGGASTQIAFVPAGGALSGTQRFRLYGYDHAVFTHSYLCYGKDEALMRVAATLSR 217          

HSP 2 Score: 81.2629 bits (199), Expect = 4.393e-16
Identity = 49/159 (30.82%), Postives = 84/159 (52.83%), Query Frame = 1
Query: 1162 GTADPDACQKAVKNLFLQSPCS-QTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKS-RDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYN----ANLGWSLGYMINKTSMIPIE 1617
            G+   D C +AV  +F  S C+ + +C F+ VYQP ++G F+AF+ F  V + L    K   + N D+I    + +C++    V   +  +++  +++    CF   Y+ +LL   Y FN   W +I F   +         GW+LGYM+N+T++IP+E
Sbjct:  279 GSGQADQCAEAVAQIFNYSSCAGRKDCTFDGVYQPPVSGSFMAFSAFYYVMDFL----KLRGEGNVDYIRNVVKRFCNKPWNEVRASSQTEQKHLKSY----CFSANYLLQLLFHGYKFNLSTWMNIKFVKKVEGIQAIGEAGWALGYMLNETNLIPVE 429          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007714.1 (pep scaffold:Pmarinus_7.0:GL476707:293032:299205:-1 gene:ENSPMAG00000006963.1 transcript:ENSPMAT00000007714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 5.117e-33
Identity = 52/187 (27.81%), Postives = 92/187 (49.20%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRD-YCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSIGCLFA 1704
            +VT+ GTA+P  C   + ++F  S CS  NC F+ V+QP + G F+AF+ F   Y+ +     + PK   +    + D YC +    +V+ +   +       +  C     +F  +S Y ++  +W +I F        LGW+LG+M+N T+M+P+ K L  +   A V   ++F + + +    A
Sbjct:  106 SVTFRGTANPAECSNTISSIFNFSACSSPNCTFDGVWQPPVRGHFLAFSSF---YHAMAAFNLTNPKPPLNDATNAFDYYCRKTWNELVSRSHPLDSNHCYCYRSTC---KLLFSKVSIYNYDKESWENINFQKEAGGGELGWALGFMLNVTNMVPVGK-LPELYSTAAVGFSLIFTIAIFLAVALA 285          

HSP 2 Score: 77.411 bits (189), Expect = 5.117e-33
Identity = 44/101 (43.56%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  785 GALDLGGASTQITFVSNETIESG--NTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVS 1081
            GALDLGGASTQITF++ E ++    +  ++LYG  Y+VYSHSYLCYG+ QA  R L+ L K   +  +       ++NPC     + +Y L  I   PC S
Sbjct:    1 GALDLGGASTQITFMTEEPLQGSPDSLTIQLYGRKYHVYSHSYLCYGRDQAIKRFLSTLYKKASSGAH-------VNNPCYPTLYSVAYNLSFIYDSPCTS 94          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Sea Lamprey
Match: entpd6 (ectonucleoside triphosphate diphosphohydrolase 6 [Source:ZFIN;Acc:ZDB-GENE-050417-412])

HSP 1 Score: 87.8113 bits (216), Expect = 2.779e-18
Identity = 66/234 (28.21%), Postives = 115/234 (49.15%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVE-GVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNET--IESGN----TKVRLYGENYNVYSHSYLCYGKSQAEYRLLA 949
            YGI+ DAGST T++ +F + ++      E+T        PG+S + + P  ++  IE  L  +    IP+    ++ V L ATAG+R++                +   ++ E V      +  K+ +    V+I+ G+ E G+++WIT N+L   L+G         + + FG LDLGG STQ+TF+  +   ++S +    T  +++ + + +YSHSYL  G   A   +L 
Sbjct:   63 YGIMFDAGSTGTRIHVFIFKQLNKANLPELTSEVFLSVKPGLSAYADHPEQSVQSIEELLA-KAKKAIPETQWQETPVVLRATAGLRLLP--------------GRKADVLLEQVRNVFDRSPFKVPK--NSVEIMDGANEGGISSWITINFLLGFLRG--------PEDKLFGILDLGGGSTQVTFLPQKQGLLQSASDADVTSFKMFNKTFKIYSHSYLGLGLMSARLAILG 271          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Yeast
Match: YND1 (Apyrase with wide substrate specificity; helps prevent inhibition of glycosylation by hydrolyzing nucleoside tri- and diphosphates that inhibit glycotransferases; partially redundant with Gda1p; mediates adenovirus E4orf4-induced toxicity [Source:SGD;Acc:S000000807])

HSP 1 Score: 90.5077 bits (223), Expect = 9.737e-25
Identity = 79/309 (25.57%), Postives = 138/309 (44.66%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEI-----ATRTNGE--------VTQVK--MCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMR--LIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQ--GDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRLYG----------ENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYN--PNQPLTP--IDNPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            +GI+IDAGS+ +++ +FKW +      AT  + +        + Q K    K  PG+S F   P  A       L D    +IP+   +   V++ ATAGMR++               P+ ++  ++  + +         +++    +++I G  EG+  W+  NYL         +V+  F     TFG +D+GGASTQI F  +++ E    +  +            + ++V+  ++L +G +QA  R LA L  T   N N   N   +   +++PCM +G +  +  +  I     SGNY Q
Sbjct:   10 FGIVIDAGSSGSRIHVFKWQDTESLLHATNQDSQSILQSVPHIHQEKDWTFKLNPGLSSFEKKPQDAYKSHIKPLLDFAKNIIPESHWSSCPVFIQATAGMRLL---------------PQDIQSSILDGLCQGLKHPAEFLVEDCSAQIQVIDGETEGLYGWLGLNYLYGHFNDYNPEVSDHF-----TFGFMDMGGASTQIAFAPHDSGEIARHRDDIATIFLRSVNGDLQKWDVFVSTWLGFGANQARRRYLAQLINTLPENTNDYENDDFSTRNLNDPCMPRGSSTDFEFKDTIFHIAGSGNYEQ 298          

HSP 2 Score: 41.5874 bits (96), Expect = 9.737e-25
Identity = 35/124 (28.23%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 1159 VGTADPDACQKAVKNLFLQS-PCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKS-RDYCSRNAPPVVTPTTQKEREK--ENWRKWRCFGFIYVFELLSAYGFNNP 1518
             G+ + + C K++  L L++ PC    C FN V+ P+I      F G +  +     VFK   + N D  +KS R++C+ N   ++  + +       EN+ K  CF   +V  +L   GF+ P
Sbjct:  291 AGSGNYEQCTKSIYPLLLKNMPCDDEPCLFNGVHAPRIDFANDKFIGTSEYWYTANDVFKLGGEYNFDKFSKSLREFCNSNWTQILANSDKGVYNSIPENFLKDACFKGNWVLNILHE-GFDMP 413          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Yeast
Match: GDA1 (Guanosine diphosphatase located in the Golgi; involved in the transport of GDP-mannose into the Golgi lumen, converting GDP to GMP after mannose is transferred to substrates; null mutants are defective in sporulation and pre-meiotic S phase entry; orthologous to human ENTPD6, a meiosis-associated non-obstructive azoospermia (NOA) related gene identified in GWAS studies [Source:SGD;Acc:S000000768])

HSP 1 Score: 82.8037 bits (203), Expect = 1.081e-16
Identity = 73/237 (30.80%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQI----TFVSNETIESGNTKVRL-YG-ENYNVYSHSYLCYGKSQAEYRLLAFL 955
            + Y I+IDAGST +++ ++K+ ++ T     + + K     PG+S F  D  GA + ++  L    M  +P + R+ + V + ATAG+R++              + K+ +++  V +         + EG   V I+ G  EGV AWITTNYL   +  +        K  T    DLGG STQI    TF  NE +  G  K  L +G ENY +Y  S+L YG  +   ++ + L
Sbjct:   91 HKYVIMIDAGSTGSRVHIYKF-DVCTSPPTLLDE-KFDMLEPGLSSFDTDSVGAANSLDPLLK-VAMNYVPIKARSCTPVAVKATAGLRLL-------------GDAKSSKILSAVRDHLEKDYPFPVVEG-DGVSIMGGDEEGVFAWITTNYLLGNIGANG------PKLPTAAVFDLGGGSTQIVFEPTFPINEKMVDGEHKFDLKFGDENYTLYQFSHLGYGLKEGRNKVNSVL 304          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Nematostella
Match: EDO43911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX67])

HSP 1 Score: 92.4337 bits (228), Expect = 1.525e-19
Identity = 80/276 (28.99%), Postives = 131/276 (47.46%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQV---KMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRL-IFEVVERFLLSTG---LKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPC-------MLKGDTASYILQ 1054
            Y ++ DAGS+ T+  ++K  +  T    +VTQ+   K  K+ PG+S F   P G    ++  + +    ++P + + ++ VYL ATAGMR++               P   ++ +   V  FL  +       K+G  + K+ISG  E    W+T N+L   L G+  T         +G LD+GGASTQ  F +N T +     + L      +Y+HSYL YG+ +A  R + FL    + N   N+ +  I NPC        ++ D A Y+++
Sbjct:   30 YAVLFDAGSSGTRCKVYKLIQRQTLHVRDVTQLNVPKPNKAKPGLSSFGESPAGVGPYLQTLI-EGAKKVVPVQYQAQTPVYLFATAGMRLL---------------PVDQKIAVINEVNNFLRDSKKSPFAFKKG--NAKVISGIDEATYDWVTVNFLMGALTGESDTE--------YGVLDMGGASTQNAFDTNNT-QHITVVLDLTKGMLPLYAHSYLGYGEQEARKRFIRFL----VNNRRHNRKV--ITNPCYNSNFEKRVEVDGAEYLMR 272          

HSP 2 Score: 51.6026 bits (122), Expect = 1.628e-6
Identity = 50/203 (24.63%), Postives = 84/203 (41.38%), Query Frame = 1
Query: 1018 HAKGRYSFIHFTKNNNHSLRIWKLFPTEFRNQR*FTRFFEKFLNVTYV-----GTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPK-DNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMI 1608
              + R  FI F  NN    R     P    N       FEK + V        G  +P  C   +K+LF      + NC F+   QP++ GKF +F+ F   + +   V K+  + D      K   +C R+        T+KE   + +   RCF   +++ +L+  G+   N   +    +I   +L W+LG M++   ++
Sbjct:  227 EQEARKRFIRFLVNNRRHNRKVITNPCYNSN-------FEKRVEVDGAEYLMRGGFNPQMCHMIIKSLFFCLSSKKDNCPFHQ--QPRLKGKFYSFSLFTYAFRETGVVSKNGERIDMETLKRKMLSFCGRD-------LTEKELANK-YTTPRCFQLNFIYSMLTD-GYRVDNSFELYNGESINGLDLNWTLGAMLSALKVL 411          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Nematostella
Match: EDO42571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S133])

HSP 1 Score: 86.2705 bits (212), Expect = 5.759e-19
Identity = 68/234 (29.06%), Postives = 118/234 (50.43%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK---SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVER--------FLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITF-VSNETIESGNTKVRLYGENYNVYSHSYLCYGKSQAE 934
            Y ++ DAGS+ T+  ++K     +    +V+Q+K+ K   + PG+S F + P+G    ++  + D  +  +P + ++++ VY+ ATAGMR++              + KA  +I  V +         FL  TG        ++K+ISG  E +  W+T N+L   L G+  T         +GAL++GGAS+Q  F V    + +    +R +G    +Y+HSYL YG+S+A 
Sbjct:    1 YAVMFDAGSSGTRCKVYKLQTRHSLRISDVSQIKVPKPNKATPGLSFFGDSPSGVGPYLQPLI-DAAINAVPSQYQSQAPVYVFATAGMRLLP-------------DNKATAVIRAVEQMLSNSSKSPFLFQTG--------NIKVISGKDEAIYDWVTVNFLMGVLTGESSTE--------YGALEMGGASSQNAFEVPVNQLHTAILNLR-HGTR-RLYAHSYLGYGESEAR 202          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Nematostella
Match: EDO38010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE19])

HSP 1 Score: 61.2326 bits (147), Expect = 2.435e-11
Identity = 40/108 (37.04%), Postives = 60/108 (55.56%), Query Frame = -3
Query: 2737 IGGPGIIVQLDKCKFGKRV--DGAWVFGGVEVAAARKCFSKVVESRDQDTLNDLIMQYV*LGSIVVSVGYKVYNKFKKNDEFE*HCVKNSIHFVNLEGFHTKHFEETW 3054
            IGGPG +VQ+D+ K G R    G WVFGG+E A  +  F   V  R  +TL  +I +     S++VS  ++ Y+K ++ + +    V +S  FVN +G+HT   E  W
Sbjct:    3 IGGPGKLVQIDETKVGHRKCHRGQWVFGGIEEAGWKVVFV-AVPDRTGNTLLPIIKE----SSVIVSYCWRSYSKLEE-EGYNQQPVNHSEEFVNEQGWHTNKIEGHW 104          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 157.532 bits (397), Expect = 1.167e-59
Identity = 103/283 (36.40%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSA-PGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNE--TIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            Y YGI++DAGS+ T +++++WP       G V Q   C+ A  GIS +   P  A + +  CL  E    IP+++  ++ +YLGATAGMR+++             N  A   +F+ VE+ L           +  ++++G  EG   W+T NYL      D++T G     ET GALDLGGASTQI+FVS+E    ES +  V  RLYG +Y +Y+HS+LCYGK QA    LA  +K        N   T I +PC  KG   +     +   PCVS    Q
Sbjct:   47 YKYGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLK-----------LENSSASDEVFKAVEKTLRGFPF----SYQGARLLAGQEEGAFGWVTVNYLD-----DRLTQGL----ETTGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQALRLALAHQTKV-------NSGPTAIMDPCFHKGYNETKHYAAVYDSPCVSDQKPQ 297          

HSP 2 Score: 94.3597 bits (233), Expect = 1.167e-59
Identity = 59/192 (30.73%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 1156 YVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWR---CFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK----PLISMSLGAFVAILIVFLVILSIGCLFAI 1707
            ++G  +   CQ+ +K++F  + C  + C FN ++QP + G+F AF+ +  V N L     S P      + K  DYC+       TP TQ ++E +   K+    CF   Y+  L+   Y F +  + SI +   I N++ GW+LGYM+N T+MIP E     PL   S  + V ++ + L ++ I  L+++
Sbjct:  305 HLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTV--MQKLSDYCA-------TPWTQIKKEHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKIKNSDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVIFILILYSL 487          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 146.362 bits (368), Expect = 8.572e-55
Identity = 101/287 (35.19%), Postives = 144/287 (50.17%), Query Frame = 2
Query:  266 SYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSA-PGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQ-----GDKVTSGFMSKKETFGALDLGGASTQITFVSNE--TIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            +YGI++DAGS+ T +++++WP       G V Q   C+ A  GIS +   P  A + +  CL  E    IP+++  ++ +YLGATAGMR+++             N  A   +F+ VE+ L           +  ++++G  EG   W+T NYL D L      G K TS     +   GALDLGGASTQI+FVS+E    ES +  V  RLYG +Y +Y+HS+LCYGK QA    L+           P    T I +PC  KG   +     +   PCVS    Q
Sbjct:   28 TYGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLK-----------LENSSASDEVFKAVEKTLRGFPFS----YQGARLLAGQEEGAFGWVTVNYLDDRLTQVSMGGFKYTS-VHGNESAKGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQALRLALS----------GP----TAIMDPCFHKGYNETKHYAAVYDSPCVSDQKPQ 283          

HSP 2 Score: 89.3521 bits (220), Expect = 8.572e-55
Identity = 58/194 (29.90%), Postives = 95/194 (48.97%), Query Frame = 1
Query: 1156 YVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQ-----KEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK----PLISMSLGAFVAILIVFLVILSIGCLFAI 1707
            ++G  +   CQ+ +K++F  + C  + C FN ++QP + G+F AF+ +  V N L     S P      + K  DYC+       TP TQ     K      +    CF   Y+  L+   Y F +  + SI +   I N++ GW+LGYM+N T+MIP E     PL   S  + V ++ + L ++ I  L+++
Sbjct:  291 HLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTV--MQKLSDYCA-------TPWTQVCAYFKHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKIKNSDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVIFILILYSL 475          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 149.443 bits (376), Expect = 1.286e-49
Identity = 107/288 (37.15%), Postives = 148/288 (51.39%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSA-PGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQ-----GDKVTS--GFMSKKETFGALDLGGASTQITFVSNE--TIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            YGI++DAGS+ T +++++WP       G V Q   C+ A  GIS +   P  A + +  CL  E    IP+++  ++ +YLGATAGMR+++             N  A   +F+ VE+ L   G       +  ++++G  EG   W+T NYL D L      G K TS  G  S  ET GALDLGGASTQI+FVS+E    ES +  V  RLYG +Y +Y+HS+LCYGK QA  RL              + P T I +PC  KG   +     +   PCVS    Q
Sbjct:   31 YGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLK-----------LENSSASDEVFKAVEKTL--RGFPFS--YQGARLLAGQEEGAFGWVTVNYLDDRLTQVSMGGFKYTSVHGNESGLETTGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQA-LRL--------------SGP-TAIMDPCFHKGYNETKHYAAVYDSPCVSDQKPQ 286          

HSP 2 Score: 68.9366 bits (167), Expect = 1.286e-49
Identity = 50/192 (26.04%), Postives = 90/192 (46.88%), Query Frame = 1
Query: 1156 YVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQ---LVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELL-SAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK----PLISMSLGAFVAILIVFLVILSIGCLFAI 1707
            ++G  +   CQ+ +K++F  + C  + C FN ++QP + G+F  F  F  +Y Q   ++ +  SP +     I K  D       P+             +    CF   Y+  L+   Y F +  + SI +   + + + GW+LGYM+N T+MIP E     PL   S  + V ++ + L ++ I  L+++
Sbjct:  294 HLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGTFVLF--IYTQRFLIISIHFSPSQRLQ--IKKEHDI------PL------------KYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKV-SCDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVIFILILYSL 462          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 156.762 bits (395), Expect = 3.144e-48
Identity = 103/283 (36.40%), Postives = 147/283 (51.94%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSA-PGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNE--TIESGNTKV--RLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            Y YGI++DAGS+ T +++++WP       G V Q   C+ A  GIS +   P  A + +  CL  E    IP+++  ++ +YLGATAGMR+++             N  A   +F+ VE+ L           +  ++++G  EG   W+T NYL      D++T G     ET GALDLGGASTQI+FVS+E    ES +  V  RLYG +Y +Y+HS+LCYGK QA    LA  +K+      P    T I +PC  KG   +     +   PCVS    Q
Sbjct:   47 YKYGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLK-----------LENSSASDEVFKAVEKTLRGFPF----SYQGARLLAGQEEGAFGWVTVNYLD-----DRLTQGL----ETTGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQALRLALAHQTKS-----GP----TAIMDPCFHKGYNETKHYAAVYDSPCVSDQKPQ 295          

HSP 2 Score: 56.9954 bits (136), Expect = 3.144e-48
Identity = 37/136 (27.21%), Postives = 64/136 (47.06%), Query Frame = 1
Query: 1156 YVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKE---NWRKWRCFGFIYVFEL-LSAYGFNNPNWHSITFTNTI 1551
            ++G  +   CQ+ +K++F  + C  + C FN ++QP + G+F AF+ +  V N L     S P      + K  DYC+       TP TQ ++E +    +    CF   Y+  L +  Y F +  + SI +   +
Sbjct:  303 HLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTV--MQKLSDYCA-------TPWTQIKKEHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKV 429          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Medaka
Match: entpd2b (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:101169627])

HSP 1 Score: 149.443 bits (376), Expect = 1.758e-37
Identity = 106/298 (35.57%), Postives = 148/298 (49.66%), Query Frame = 2
Query:  263 YSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCK-SAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSK-----KETFGALDLGGASTQITFVSNETIESGNT--KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPID------------NPCMLKGDTASYILQKIITIPCVSGNYSQ 1096
            + YGI++DAGS+ T +F+++WP       G VTQ   C     GIS +      A + +  CL D+ +  IPK     + VYLGATAGMR+     LN+       NPK    I + V   + S   K  EG     I+SG  EG   W+T NYL +      +  GF+ +     + T GALDLGGASTQITF + E +E      ++RLYG  Y++Y+HS+LCYG +Q   R+LA L K+     +   P  P D            +PC  +     Y  +  +T+   SGNY Q
Sbjct:   38 FMYGIVLDAGSSHTALFIYRWPADKQNGTGVVTQHAECHVQGEGISSYAGQKGEAGESLVACL-DQAVRDIPKDKHQLTPVYLGATAGMRL-----LNIS------NPKQSDQILKEVGDKIKSYPFKF-EG---AAILSGQEEGAYGWVTVNYLLENF----IKYGFIGRWMSPGRATVGALDLGGASTQITFATQERVEGKQNMMEMRLYGHKYSLYTHSFLCYGINQVYNRMLAHLVKSQGYVQSVTNPCYPPDVNTTLKMKDVFSSPCTEEHRPKPYNPEGTLTVKG-SGNYQQ 314          

HSP 2 Score: 77.411 bits (189), Expect = 4.024e-14
Identity = 42/158 (26.58%), Postives = 80/158 (50.63%), Query Frame = 1
Query: 1150 VTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFEL-LSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEK 1620
            +T  G+ +   C++ + N+F    C  + C FN + QP +TG F+AF+ F  V++ L K+   P          ++  CS     +   + Q   +  +W  + C   +++  L L  Y F+N  +  I+F     + ++GW+LGY++N ++++P EK
Sbjct:  304 LTVKGSGNYQQCEENMSNMFSFEDCPFSQCSFNGISQPNVTGNFMAFSTFFYVHSSLRKLTGKPVNTPQQLQEAAQTTCSMTLSQM---SNQIPDQGPHWMNY-CTASVFIKTLVLRGYAFDNSTFPQISFQKKAGDTSVGWALGYILNLSNLLPAEK 457          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Planmine SMEST
Match: SMESG000068450.1 (SMESG000068450.1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 322/337 (95.55%), Postives = 324/337 (96.14%), Query Frame = 2
Query:  131 MKKIEKLKDIPKPAWYSMTIVFFTLSICGVVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLPDSLKN 1141
            MKKIEKLKDIPKPAWYSMTIVF TLSICG+VIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE           YRNPKAMRLIFEVVERFLLSTGLKMK+GLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSN TIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLPDSLKN
Sbjct:    1 MKKIEKLKDIPKPAWYSMTIVFLTLSICGIVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE-----------YRNPKAMRLIFEVVERFLLSTGLKMKDGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNGTIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLPDSLKN 326          

HSP 2 Score: 464.537 bits (1194), Expect = 0.000e+0
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 1
Query: 1144 LNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLKPVTEKSSEVVSLNPKVNNISDDLTNKV 1815
            LNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLKPVTEKSSEVVSLNPKVNNISDDLTNKV
Sbjct:  329 LNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSIGCLFAIISYKWYWLKPVTEKSSEVVSLNPKVNNISDDLTNKV 552          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Planmine SMEST
Match: SMESG000051033.1 (SMESG000051033.1)

HSP 1 Score: 248.825 bits (634), Expect = 7.334e-94
Identity = 133/328 (40.55%), Postives = 194/328 (59.15%), Query Frame = 2
Query:  146 KLKDIPKPAWYSMTIVFFTLSICGVVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNT-KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLP 1126
            K K+     W  + IV F LS+CG++ +  ++      +++Y +IIDAGSTS+K++L+ W       N +V QV MCK+ PGIS F  +PN + +GI+ CL+ +++PLIP  +R K+FVYLGATAGMR++           +  NP A + I   +   L  + LK+   + D+ II+G+ EG+  W T N+L   L  + V      K    GALD+GGASTQITF+ N       T K++LYG +Y++YSHSYLCYGKSQAEYR LA L +  I N+  N     I NPCM + ++ +Y  + I  +PCV G ++  ++G  V  P
Sbjct:   95 KTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRML-----------SLNNPNASQQIMYFIRNSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKNIV-----KKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIE--IENFTTN-----ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPP 399          

HSP 2 Score: 117.087 bits (292), Expect = 7.334e-94
Identity = 62/189 (32.80%), Postives = 102/189 (53.97%), Query Frame = 1
Query: 1147 NVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADF---IAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSIGCLFA 1704
            N+T+ GT++   C   V++LF +S C+  +C FN VYQP I+GKF AF+ +      L+K   +   +N DF     + ++ C+           +     + W KWRCF  +++ ++L   GFN  NW +I F + I +AN+GW LG++ +KTS++P E+  + +    F  +L V LVI+     F 
Sbjct:  408 NITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAY-----NLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGE-----DKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFT 586          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Planmine SMEST
Match: SMESG000013793.1 (SMESG000013793.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.158e-26
Identity = 61/128 (47.66%), Postives = 80/128 (62.50%), Query Frame = -3
Query: 2734 KNVCSSKFVRKQH*IGGPGIIVQLDKCKFGKR-------VDGAWVFGGVEVAAARKCFSKVVESRDQDTLNDLIMQYV*LGSIVVSVGYKVYNKFKKNDEFE*HCVKNSIHFVNLEGFHTKHFEETWN 3096
            K VC S   R+   IGGPG++VQLD+ KFGKR       V+G WVF GVE    RKCF+ +V+ RD DT+N LI++Y   GS VV+ G+K  + FK N  F  H   +S+ FVN EGF+T   + T+N
Sbjct:   31 KKVCES-VSREDLRIGGPGVLVQLDESKFGKRKYNLGHRVEGTWVFAGVEKTPERKCFAVIVDKRDADTVNFLILKYALPGSTVVTDGWKGNDTFKNNINFTHHWANHSVTFVNNEGFNTYTIDGTFN 157          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Planmine SMEST
Match: SMESG000010140.1 (SMESG000010140.1)

HSP 1 Score: 108.997 bits (271), Expect = 2.887e-24
Identity = 75/227 (33.04%), Postives = 118/227 (51.98%), Query Frame = 2
Query:  266 SYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLL 946
            ++GI+IDAGS  T+ +L+KW +  T TN EV+++  C +      +  + N   + +  C+   ++ L  + ++ K  +YL ATAGMRI+E  N  L            +++F  ++      G   K     V I+ G  EG++ W T NYLK+T+  +        +  TFG LDLGG+STQI F +    ++G+  V L+   Y +YS SYLCYG +    R L
Sbjct:   93 NFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVTDKLQILYFQNRN---EDLMKCIKSLLLKL--RAVKFKPPIYLAATAGMRILEIENKTL-----------TKVMFNEIKSLFYVLGWNFKF----VGILKGYYEGISGWTTVNYLKNTIGKNSTVRK--DRFSTFGVLDLGGSSTQIAFET----KTGDP-VILFTRKYLLYSRSYLCYGVNMFRIRYL 292          

HSP 2 Score: 53.1434 bits (126), Expect = 1.265e-6
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 1
Query: 1249 NVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIP 1611
            +V Q     +F+A A FA     L K ++   K N+ F+  +  +C+ +   +     +  +  +N+    C    ++  L   YG N  N+ ++ F N I   N GW+LGYMI +T  IP
Sbjct:  359 DVIQVDKKMRFVAVAVFAYYNAFLTKYYRMTGKYNS-FVQATGLFCTEDYATLDAKYGKDAKFAQNY----CLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 474          
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Planmine SMEST
Match: SMESG000002990.1 (SMESG000002990.1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.227e-18
Identity = 66/228 (28.95%), Postives = 108/228 (47.37%), Query Frame = 2
Query:  269 YGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSA-PGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*MNLNLK*FYAYRNPKAMRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGN-TKVRLYGENYNVYSHSYLCYGKSQAEYRLL 946
            Y I+ DAGST T++ ++K+      T   V   ++ +   PG+S + N P     GI   L       IPK    ++++ L ATAG+R++                +  + + + V+  L ++G ++      V I+SG  EG+ +W+T N+L   ++           + +FG +DLGG S QITFV +  +      KV+L      +YSHSYL  G   A Y +L
Sbjct:   28 YAIVFDAGSTGTRIHVYKFRYSQNETYPYVLVDELFEEVKPGVSSYANKPADVKKGIIQLLQSAKRK-IPKPFWVRTWMTLKATAGLRLL--------------GEQQAQTLLDEVKSVLNTSGFQLMPN--GVSIMSGLDEGILSWVTVNFLLQRVR---------QPRHSFGTIDLGGGSMQITFVPDHNVSRRFLQKVKLGNSKKGIYSHSYLGLGLMSARYCIL 229          
The following BLAST results are available for this feature:
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENTPD82.823e-5835.02ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
ENTPD82.823e-5835.02ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
ENTPD22.831e-5635.89ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
ENTPD37.521e-5632.97ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
ENTPD37.521e-5632.97ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uda-19.505e-1828.88Nucleoside-diphosphatase uda-1 [Source:UniProtKB/... [more]
mig-238.517e-1427.87Nucleoside-diphosphatase mig-23 [Source:UniProtKB... [more]
ntp-11.103e-926.52Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
ntp-11.103e-926.52Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
ntp-11.518e-925.76Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NTPase9.405e-1526.52gene:FBgn0024947 transcript:FBtr0077683[more]
NTPase1.051e-1426.52gene:FBgn0024947 transcript:FBtr0332459[more]
NTPase1.418e-1427.76gene:FBgn0024947 transcript:FBtr0332460[more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd2a.14.175e-5637.50ectonucleoside triphosphate diphosphohydrolase 2a,... [more]
entpd2a.21.413e-5536.21ectonucleoside triphosphate diphosphohydrolase 2a,... [more]
entpd2b1.903e-5433.11ectonucleoside triphosphate diphosphohydrolase 2b ... [more]
entpd81.058e-5234.46ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
entpd81.058e-5234.46ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxc22.257e-6134.66forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382... [more]
foxc22.280e-6034.51forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382... [more]
n4bp2l14.019e-5833.54NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
n4bp2l14.224e-5833.44NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
n4bp2l14.861e-5833.44NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Entpd31.911e-5933.33ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
Entpd83.450e-5836.23ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
Entpd83.450e-5836.23ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
Entpd21.008e-5437.14ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
Entpd81.327e-5336.23ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93295|ENTP8_CHICK2.234e-6139.07Ectonucleoside triphosphate diphosphohydrolase 8 O... [more]
sp|P79784|ENTP2_CHICK3.727e-5835.87Ectonucleoside triphosphate diphosphohydrolase 2 O... [more]
sp|Q9MYU4|ENTP1_PIG1.150e-5737.46Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
sp|Q5MY95|ENTP8_HUMAN1.250e-5735.02Ectonucleoside triphosphate diphosphohydrolase 8 O... [more]
sp|A0JND9|ENTP8_BOVIN1.771e-5732.73Ectonucleoside triphosphate diphosphohydrolase 8 O... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YEN91.049e-6737.70Ectonucleoside triphosphate diphosphohydrolase OS=... [more]
A0A3B1KCT03.149e-6635.71Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
A0A5K3EYZ33.227e-6634.71Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564Y3085.817e-6637.85Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0A0AVE81.036e-6438.18Ectonucleoside triphosphate diphosphohydrolase 8 (... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd11.968e-6935.71ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd39.470e-5833.22ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
entpd12.808e-5735.71ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd81.907e-5334.32ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
entpd2a.12.140e-5135.56ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003192.13.451e-4035.00pep scaffold:Pmarinus_7.0:GL484058:1986:12022:-1 g... [more]
ENSPMAT00000008355.18.530e-3436.05pep scaffold:Pmarinus_7.0:GL477173:2090:22790:1 ge... [more]
ENSPMAT00000007714.15.117e-3327.81pep scaffold:Pmarinus_7.0:GL476707:293032:299205:-... [more]
entpd62.779e-1828.21ectonucleoside triphosphate diphosphohydrolase 6 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YND19.737e-2525.57Apyrase with wide substrate specificity; helps pre... [more]
GDA11.081e-1630.80Guanosine diphosphatase located in the Golgi; invo... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO439111.525e-1928.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425715.759e-1929.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380102.435e-1137.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd11.167e-5936.40ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd18.572e-5535.19ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd11.286e-4937.15ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd13.144e-4836.40ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd2b1.758e-3735.57ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068450.10.000e+095.55SMESG000068450.1[more]
SMESG000051033.17.334e-9440.55SMESG000051033.1[more]
SMESG000013793.11.158e-2647.66SMESG000013793.1[more]
SMESG000010140.12.887e-2433.04SMESG000010140.1[more]
SMESG000002990.11.227e-1828.95SMESG000002990.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024920 ID=SMED30024920|Name=Ectonucleoside triphosphate diphosphohydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=3842bp
GTAATATATTAAGGTCAAAATAATTTAAATTTCATTTAAATTAAGATTTT
ATTATCAAATATATTTCGTGCTTGGACAGTTTATTTGAATAACTCTCCTT
AAAAACTATAAAGAAGTTTAATAGTAATAAATGAAAAAAATAGAAAAATT
AAAAGATATCCCGAAACCAGCATGGTATTCCATGACAATTGTATTTTTTA
CCCTTTCAATTTGTGGGGTTGTTATAATCTGTGTTCTTTGGGCTTTTGCA
AATCAGTTGGTTTATTCTTATGGAATTATCATTGATGCCGGTTCAACGTC
CACTAAAATGTTCCTCTTTAAATGGCCAGAAATTGCTACTAGAACAAATG
GTGAAGTCACTCAAGTGAAAATGTGCAAATCTGCTCCAGGAATATCAGAT
TTCATCAACGACCCGAATGGAGCAATTGATGGCATTGAAATGTGTTTGAA
TGATGAAATGATGCCACTTATTCCAAAACGTTTAAGAACAAAATCCTTTG
TTTATCTCGGTGCAACGGCTGGAATGAGAATTATTGAGTAAATGAATTTA
AATTTAAAATAATTTTATGCATACCGAAATCCCAAAGCAATGAGATTAAT
TTTTGAAGTTGTCGAACGCTTTCTTTTAAGTACGGGATTGAAAATGAAAG
AAGGACTGCGTGACGTTAAAATCATTAGTGGGTCTGTTGAAGGTGTCGCA
GCTTGGATTACTACTAATTATCTAAAGGATACTCTGCAAGGGGATAAAGT
AACATCTGGATTTATGTCAAAAAAAGAAACATTTGGTGCTTTAGACCTCG
GAGGGGCAAGTACTCAGATAACCTTTGTTTCCAATGAAACAATTGAATCA
GGAAACACTAAAGTTCGTCTTTATGGTGAAAATTACAATGTATACAGTCA
TAGTTATCTTTGTTATGGTAAAAGTCAAGCAGAATACAGATTATTGGCCT
TTTTGTCTAAAACATGGATTGCCAATTACAATCCGAATCAGCCCTTAACA
CCCATAGACAATCCATGCATGCTAAAGGGAGATACAGCTTCATACATTTT
ACAAAAAATAATAACCATTCCCTGCGTATCTGGAAATTATTCCCAACAGA
ATTTCGGAACCAGCGTTGATTTACCAGATTCTTTGAAAAATTTTTGAATG
TTACCTACGTCGGAACTGCAGATCCTGATGCATGTCAAAAGGCAGTAAAA
AACCTTTTTCTTCAATCGCCTTGTTCACAGACAAATTGCGGTTTCAATAA
TGTCTACCAACCGAAAATTACTGGCAAATTTATAGCATTCGCCGGTTTCG
CTTTAGTATACAACCAATTAGTAAAGGTTTTTAAATCCCCTCCAAAAGAT
AATGCTGATTTCATCGCGAAATCAAGAGATTATTGCTCACGAAATGCCCC
ACCAGTGGTTACTCCAACTACTCAGAAAGAACGAGAAAAAGAAAATTGGC
GAAAATGGCGTTGCTTTGGATTTATTTATGTATTTGAATTGCTTAGTGCT
TACGGATTCAATAATCCCAACTGGCATTCAATCACCTTCACTAACACAAT
TTATAATGCCAATCTCGGATGGTCTTTGGGGTACATGATCAACAAAACTT
CAATGATTCCAATTGAGAAACCACTTATCTCGATGTCCCTGGGGGCATTT
GTTGCAATATTAATAGTTTTTCTAGTCATTTTATCAATCGGTTGTCTTTT
TGCAATAATCAGTTACAAATGGTACTGGCTGAAACCCGTCACGGAAAAAT
CGTCGGAAGTTGTCAGTTTAAATCCGAAAGTGAATAATATTTCTGATGAT
TTAACAAATAAAGTATAAATTTTACAAATGTGGATCATGTTTGTTGATCA
CTAATCCTGCTATCTCACGTTAGAGTTATTTATTATGAGGATTGATGAAG
ATGAATTTTTATTCATATAATTTTACCAATATTATTATTATTCTTTTTAT
TATTATTGATTTTATATATTATTATAAATATTTATTATTTTAGGATCAAT
TAATATTCGAAATTTTTTTCATCGATATAATAATTACTTTGCAGCAAAGG
CTTGTTTTATTATTTACCTTCCTGATATTTATTATTATCATTATTTATAA
TATTTTATTATTAATTATTTTTATTTATTTTTTTTATTGATTTATTATTA
TTGATTTATTATTATTTAATAATAATATTATTAATTAATTTATCATATTA
TTTGACAATTATTTCATTCGAATAAATCTCTGTTGCTAATAAATCACATC
ACGTATAAATCACACACAAAAAATGTCATTTCTCTCCAAAATTAATAATC
CTCGAACATTATAATTGCTGAACCCTGAACTGATTTTATCATTAATTTGA
GTCTTCCTCGGAATATGTCAAGGTTGGACTACACTAAACTTGATGTCAAA
CGTAATCGGTTAAATTAGGGACATAGCGATCTATATAAAAGTTTCTAAAA
TTCATTAAATTTTGTTTAAACGTTTCATTATCTCTCATTGCTAATAGATC
AAAAATGTTTTCAATTAGAGTATACAATACTACCCCCCGGGTAGTATATT
TATTTAATTATTCAAATTAAATGAAATGATATTAAAACAAAACAAAAAAT
TAATTTCAACGTAATTTAATCTCTTAGCATTTAATCGCATCAATCAAACC
ACTACAATTGGATATTATTTTTTCTTCACCAAATAAATTCCAATATTCCA
CAAAACTTTCATTGTGATGGCACACAAGTTTTCATTCCACGTTTCTTCGA
AGTGCTTAGTATGAAACCCTTCCAAGTTAACAAAATGTATGGAGTTTTTA
ACGCAATGTTATTCAAATTCATCATTTTTTTTGAATTTATTATATACCTT
GTAACCTACGCTGACTACTATTGATCCAAGCTAAACATACTGCATTATGA
GATCATTTAAAGTATCTTGGTCTCTGCTTTCAACAACTTTTGAAAAACAC
TTTCTGGCAGCCGCAACTTCAACACCACCGAAAACCCATGCCCCGTCCAC
TCTCTTGCCAAATTTACACTTATCGAGTTGCACAATGATACCGGGTCCAC
CAATTTAGTGTTGCTTTCTGACAAATTTAGAGCTACACACATTCTTATGA
ACTTTTAAACCTTGCAGGTGGTTTTTTTGGAATGACCTTTAATATAGTTG
ATGGTCTGGTTCGGGCTTTTACATACAGAAACTGATGTACCTTTAATTTA
CTCTTGGCAAAAACACTTTCAGTTAACGAAGAGTAGATTTTCCTGTGGGT
TTTCTTTTTGCATTTGAATAATGTTGGTGCTTTTTGGGCAAGAGAATCGG
TATGAAGTTATTGGGGCAAGCAAAAGGTTTTCATAGCAAAAATCCATTGC
CTTTTCTTTGTTTTCGACTATTTACTTTAATAAAATCTGCTTTTGTATAA
TTTAGGATAAATTGAATAATTGATTTAATTTTTCTATTAATACATTTAAT
TTAAAAATGTTAAAAAACGTTTATGCGAGATTGGAACCTGGAGGGTTGTA
TTGTAAACTTGATCCAAGTTTTCTTTTGCTATGTAACAAAAATTTCCGAC
GATGCCTTAGTCAAGTTTCATTAAAATCTTATAAAGGTATTTTCAAAGAT
TTTTGTTACAAATCAAAAATGGCCAAATACTTTGAAAAATGTTTTCACAA
AACATTACATTTTTTTCAAAATGAAACAGTCAAAAATTCTAAAAACTGTA
ATATCTGTAAATTCAACTCTGTTATTTATGATTCTGTTAGCTACTTGAAA
AACGATTATATTTATTTTGAGATCATTTTTACAATGAGGTCAATATTGAA
TTTTTTATTATCCATCAGATGATGAAAATCGTGTTGTTATAA
back to top

protein sequence of SMED30024920-orf-1

>SMED30024920-orf-1 ID=SMED30024920-orf-1|Name=SMED30024920-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MLKNVYARLEPGGLYCKLDPSFLLLCNKNFRRCLSQVSLKSYKGIFKDFC
YKSKMAKYFEKCFHKTLHFFQNETVKNSKNCNICKFNSVIYDSVSYLKND
YIYFEIIFTMRSILNFLLSIR*
back to top

protein sequence of SMED30024920-orf-2

>SMED30024920-orf-2 ID=SMED30024920-orf-2|Name=SMED30024920-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MKKIEKLKDIPKPAWYSMTIVFFTLSICGVVIICVLWAFANQLVYSYGII
IDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAID
GIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIE*
back to top

protein sequence of SMED30024920-orf-3

>SMED30024920-orf-3 ID=SMED30024920-orf-3|Name=SMED30024920-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MRLIFEVVERFLLSTGLKMKEGLRDVKIISGSVEGVAAWITTNYLKDTLQ
GDKVTSGFMSKKETFGALDLGGASTQITFVSNETIESGNTKVRLYGENYN
VYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTA
SYILQKIITIPCVSGNYSQQNFGTSVDLPDSLKNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000407GDA1_CD39_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000407Nucleoside phosphatase GDA1/CD39PFAMPF01150GDA1_CD39coord: 18..157
e-value: 3.2E-28
score: 98.6
IPR000407Nucleoside phosphatase GDA1/CD39PANTHERPTHR11782ADENOSINE/GUANOSINE DIPHOSPHATASEcoord: 3..172
NoneNo IPR availableGENE3DG3DSA:3.30.420.150coord: 30..180
e-value: 3.0E-38
score: 134.1