Leucine--tRNA ligase, cytoplasmic

Overview
NameLeucine--tRNA ligase, cytoplasmic
Smed IDSMED30024910
Length (bp)3785
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine--tRNA ligase, cytoplasmic (SMED30024910) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine--tRNA ligase, cytoplasmic (SMED30024910) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine--tRNA ligase, cytoplasmic (SMED30024910) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine--tRNA ligase, cytoplasmic (SMED30024910) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024910

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024910SMESG000031601.1 SMESG000029599.1 SmedASXL_017704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024910SMESG000031601.1 SMESG000029599.1 SmedASXL_017704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30024910SMESG000031601.1 SMESG000029599.1 dd_Smed_v4_2849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024910SMESG000031601.1 SMESG000029599.1 dd_Smed_v4_2849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024910SMESG000031601.1 SMESG000029599.1 dd_Smed_v4_2849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024910SMESG000031601.1 SMESG000029599.1 dd_Smed_v4_2849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024910SMESG000031601.1 SMESG000029599.1 dd_Smed_v4_2849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024910SMESG000031601.1 SMESG000029599.1 dd_Smed_v4_2849_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: LARS1 (leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:6512])

HSP 1 Score: 1184.09 bits (3062), Expect = 0.000e+0
Identity = 609/1199 (50.79%), Postives = 820/1199 (68.39%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETP---VAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            RKGTAK++ +K IE   Q++W+  +VFE N   +  +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E      +++ +  I  +K KGKKSKA AK+G  KYQW IM+  G++DEEI KF+E ++W+ Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTL+K+K+ +PYP  L  +K  ++FLVAATLRPETM+GQTNCW+ P ++Y+  ++    + IC ++AARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ Y I D  VLPFEPV VI+IP +G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  +I +G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +E WK  T  CL  + TF +E RRNFEA L  L E+ACSR+YGLGT +PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG+L G++  +  GI    MT + W+YV   +         +   KLD L++EF +WYPVDLRVSGKDLVPNHL+YYL+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT+++AI+K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP S  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H +L+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G V+E L    +YL  ++H+ R +          ++ +           I++AK+YPPWQ + L  L        GKLPDNK + S L   PELKK MKK M  +  I+    +    +  L+  E DEK+V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F +         P V               +V++VNP   +G  S +IEI  GD+  ++ RR+      I+D + V+L  F D     R +P+  +   +  PI  +A F+V      I  + NG+   IG+
Sbjct:    4 RKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTEDIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETVNGDIFICTQKAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAEAKEKIYLKGFYEGIMLVDGFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQAE-SPLGIRPQQMTKEVWDYVFFKEAPFPKTQIAK--EKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDK-WPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQL-EFDEKAVLMENIVYLTNSLELE--HIEVKFASEAED-KIREDCCPGKPLNVFRI--------EPGV---------------SVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: LARS1 (leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:6512])

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 583/1148 (50.78%), Postives = 785/1148 (68.38%), Query Frame = 3
Query:  318 MNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETP---VAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKD-DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            MNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E      +++ +  I  +K KGKKSKA AK+G  KYQW IM+  G++DEEI KF+E ++W+ Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTL+K+K+ +PYP  L  +K  ++FLVAATLRPETM+GQTNCW+ P ++Y+  ++    + IC ++AARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ Y I D  VLPFEPV VI+IP +G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  +I +G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +E WK  T  CL  + TF +E RRNFEA L  L E+ACSR+YGLGT +PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG+L G++  +  GI    MT + W+YV   +         +   KLD L++EF +WYPVDLRVSGKDLVPNHL+YYL+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT+++AI+K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP S  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H +L+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G V+E L    +YL  ++H+ R +          ++ +           I++AK+YPPWQ + L  L        GKLPDNK + S L   PELKK MKK M  +  I+    +    +  L+  E DEK+V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F +         P V               +V++VNP   +G  S +IEI  GD+  ++ RR+      I+D + V+L  F D     R +P+  +   +  PI  +A F+V      I  + NG+   IG+
Sbjct:    1 MNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTEDIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETVNGDIFICTQKAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAEAKEKIYLKGFYEGIMLVDGFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQAE-SPLGIRPQQMTKEVWDYVFFKEAPFPKTQIAK--EKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDK-WPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQL-EFDEKAVLMENIVYLTNSLELE--HIEVKFASEAED-KIREDCCPGKPLNVFRI--------EPGV---------------SVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGD 1115          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: LARS1 (leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:6512])

HSP 1 Score: 368.237 bits (944), Expect = 1.398e-114
Identity = 205/507 (40.43%), Postives = 303/507 (59.76%), Query Frame = 3
Query: 2229 IWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            +WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT+++AI+K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP S  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H +L+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G V+E L    +YL  ++H+ R +          ++ +           I++AK+YPPWQ + L  L        GKLPDNK + S L   PELKK MKK M  +  I+    +    +  L+  E DEK+V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F +         P V               +V++VNP   +G  S +IEI  GD+  ++ RR+      I+D + V+L  F D     R +P+  +   +  PI  +A F+V      I  + NG+   IG+
Sbjct:    1 MWPEQSDK-WPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQL-EFDEKAVLMENIVYLTNSLELE--HIEVKFASEAED-KIREDCCPGKPLNVFRI--------EPGV---------------SVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGD 478          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: LARS1 (leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:6512])

HSP 1 Score: 157.147 bits (396), Expect = 1.441e-43
Identity = 73/116 (62.93%), Postives = 90/116 (77.59%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPE 512
            RKGTAK++ +K IE   Q++W+  +VFE N   +  +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+
Sbjct:    4 RKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPD 119          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: lars-1 (Leucine--tRNA ligase [Source:UniProtKB/Swiss-Prot;Acc:Q09996])

HSP 1 Score: 1076.62 bits (2783), Expect = 0.000e+0
Identity = 563/1108 (50.81%), Postives = 738/1108 (66.61%), Query Frame = 3
Query:  186 KLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKT---EINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKH--GVLICVERAARNMAYQEILTDQPGEV---IILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESK-PNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMG---DYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXH------NAAIIWIAKSYPPWQMSILDSLIDMSD-KEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECS-DEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFS 3449
            K+  +++IE + Q+ WE+ K FEA+     D K KY VTFP+PYMNG LHLGH FS SKCEF+ G++RL+GK  L+ FGFHCTGMPIK+ ADKLKREM+ FG+PP FPE       EE +   EI  +K KGKKSK VAK+G  KYQWQIM+  G+ DEEIK+F++ ++W+ Y+PP  I ++K++G+K DWRRSFITTD NP++DSFVRWQF  L+   KI FGKR TI+SP D QPCMDHDR+SGEGVGPQEYTLIK+K+  P PQ L  IK+D++LVAATLRPETMYGQTNC++HP I+Y    +T++   V +   R+AR M+YQ  LT + G+V   + L K  G +++G  L APL  Y+ +Y LPM +IK +KGTG+VTSVPSDSPDD+AAL DLK+K+  R  Y + D  VLPFEPV +I I   G   AV+     KI+SQN+ DKL EAK++ Y  GFY G +++GKYAG      K++IQ DL   GLA  Y EPE++V+SRSG ECVVALCDQWYLNY + +WK+  K  L  + TF+DE RR  E  ++ LHEYACSRSYGLGT++PWD QYL+ESLSDSTIY AYYTVAH+LQ G+ DG S V  +GI    MT  +W YV   +   +  + P    KL  LR+EF YWYP+D+R SGKDL+ NHLTY LFNH AIWP ++ + WPK IRANGHLLLNNEKMSKSTGNF+T+ EAIEK+SADGMR++ ADAGD +EDANFV  MADA +LRL++ IEW+KE++E +   +        +D VFAN +N  I  TE NY+   +K  L+ GF E+Q+IRD YRE C G        L+  F+E Q LILSPICPHI +YIW  +L K   I+N  WP    VDEKL+   R++     EFR +       K             A+I++AK YPPWQ +ILD L   +    G LPDNK+++  + +   LKK  KKAM  +Q I+ +  ++  +     +P +D+ S++  N  ++   L+LD  ++ ++++DE   D  + ++  P+ P + F        + P    V R     N++    V +VN D  S
Sbjct:   10 KVAQLQEIEKSIQELWESKKAFEADA--RDDGKPKYLVTFPFPYMNGRLHLGHTFSASKCEFAAGFQRLQGKEVLFPFGFHCTGMPIKACADKLKREMQDFGYPPNFPEDVVEEVKEEVSAVDEIIKDKSKGKKSKLVAKTGNAKYQWQIMKSLGLCDEEIKEFSDPNHWLYYFPPHCIADLKKMGLKADWRRSFITTDVNPYFDSFVRWQFNLLRAAKKIDFGKRYTIYSPKDGQPCMDHDRASGEGVGPQEYTLIKLKVLDPKPQALSHIKEDIYLVAATLRPETMYGQTNCYLHPDIQYSVFYATENEKQVFVATARSARIMSYQG-LTKENGKVNYVLGLEKIAGSKILGAPLSAPLAKYERVYALPMLTIKDDKGTGVVTSVPSDSPDDFAALSDLKKKKPLREKYGLTDEMVLPFEPVPIIKIEGLGDLAAVEMCSRLKIESQNEKDKLEEAKKEVYLKGFYDGVMLVGKYAGKKTADVKKVIQDDLTAEGLATKYVEPEKKVMSRSGDECVVALCDQWYLNYGEAEWKAAAKKVLEPLRTFNDETRRGLETTVDWLHEYACSRSYGLGTKLPWDTQYLIESLSDSTIYNAYYTVAHLLQQGAFDG-SVVGPAGIKADQMTDASWSYVFLGEIYDSKTM-PVEEEKLKSLRKEFMYWYPIDMRASGKDLIGNHLTYLLFNHAAIWPTDTSK-WPKGIRANGHLLLNNEKMSKSTGNFMTLEEAIEKFSADGMRLSLADAGDGLEDANFVYAMADAAILRLFTMIEWIKEMIEQRDAGLLRKDAKKFADRVFANEMNSLIAATEQNYEATNFKDALKTGFFEYQAIRDTYRELCAGIDEPMSESLVFRFIETQMLILSPICPHIAEYIW-QLLGKDGLIVNAPWPTVDPVDEKLAIGARFITESLAEFRARLKTYMTPKKKALKEIPEVPTEAVIYVAKEYPPWQKTILDILEKQAKANNGALPDNKAISQLIGKEESLKKFAKKAMPFVQMIKERFEQKGVSALASSSP-VDQTSILNENIDFIMNALDLD--RVTIRHTDEEGIDANIVETTVPLVPMLNFT------PNRPTIKLVARNVQICNAMFDVDVPIVNGDSVS 1101          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: lars-1 (Leucine--tRNA ligase [Source:UniProtKB/Swiss-Prot;Acc:Q09996])

HSP 1 Score: 1076.62 bits (2783), Expect = 0.000e+0
Identity = 563/1108 (50.81%), Postives = 738/1108 (66.61%), Query Frame = 3
Query:  186 KLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKT---EINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKH--GVLICVERAARNMAYQEILTDQPGEV---IILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESK-PNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMG---DYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXH------NAAIIWIAKSYPPWQMSILDSLIDMSD-KEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECS-DEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFS 3449
            K+  +++IE + Q+ WE+ K FEA+     D K KY VTFP+PYMNG LHLGH FS SKCEF+ G++RL+GK  L+ FGFHCTGMPIK+ ADKLKREM+ FG+PP FPE       EE +   EI  +K KGKKSK VAK+G  KYQWQIM+  G+ DEEIK+F++ ++W+ Y+PP  I ++K++G+K DWRRSFITTD NP++DSFVRWQF  L+   KI FGKR TI+SP D QPCMDHDR+SGEGVGPQEYTLIK+K+  P PQ L  IK+D++LVAATLRPETMYGQTNC++HP I+Y    +T++   V +   R+AR M+YQ  LT + G+V   + L K  G +++G  L APL  Y+ +Y LPM +IK +KGTG+VTSVPSDSPDD+AAL DLK+K+  R  Y + D  VLPFEPV +I I   G   AV+     KI+SQN+ DKL EAK++ Y  GFY G +++GKYAG      K++IQ DL   GLA  Y EPE++V+SRSG ECVVALCDQWYLNY + +WK+  K  L  + TF+DE RR  E  ++ LHEYACSRSYGLGT++PWD QYL+ESLSDSTIY AYYTVAH+LQ G+ DG S V  +GI    MT  +W YV   +   +  + P    KL  LR+EF YWYP+D+R SGKDL+ NHLTY LFNH AIWP ++ + WPK IRANGHLLLNNEKMSKSTGNF+T+ EAIEK+SADGMR++ ADAGD +EDANFV  MADA +LRL++ IEW+KE++E +   +        +D VFAN +N  I  TE NY+   +K  L+ GF E+Q+IRD YRE C G        L+  F+E Q LILSPICPHI +YIW  +L K   I+N  WP    VDEKL+   R++     EFR +       K             A+I++AK YPPWQ +ILD L   +    G LPDNK+++  + +   LKK  KKAM  +Q I+ +  ++  +     +P +D+ S++  N  ++   L+LD  ++ ++++DE   D  + ++  P+ P + F        + P    V R     N++    V +VN D  S
Sbjct:   10 KVAQLQEIEKSIQELWESKKAFEADA--RDDGKPKYLVTFPFPYMNGRLHLGHTFSASKCEFAAGFQRLQGKEVLFPFGFHCTGMPIKACADKLKREMQDFGYPPNFPEDVVEEVKEEVSAVDEIIKDKSKGKKSKLVAKTGNAKYQWQIMKSLGLCDEEIKEFSDPNHWLYYFPPHCIADLKKMGLKADWRRSFITTDVNPYFDSFVRWQFNLLRAAKKIDFGKRYTIYSPKDGQPCMDHDRASGEGVGPQEYTLIKLKVLDPKPQALSHIKEDIYLVAATLRPETMYGQTNCYLHPDIQYSVFYATENEKQVFVATARSARIMSYQG-LTKENGKVNYVLGLEKIAGSKILGAPLSAPLAKYERVYALPMLTIKDDKGTGVVTSVPSDSPDDFAALSDLKKKKPLREKYGLTDEMVLPFEPVPIIKIEGLGDLAAVEMCSRLKIESQNEKDKLEEAKKEVYLKGFYDGVMLVGKYAGKKTADVKKVIQDDLTAEGLATKYVEPEKKVMSRSGDECVVALCDQWYLNYGEAEWKAAAKKVLEPLRTFNDETRRGLETTVDWLHEYACSRSYGLGTKLPWDTQYLIESLSDSTIYNAYYTVAHLLQQGAFDG-SVVGPAGIKADQMTDASWSYVFLGEIYDSKTM-PVEEEKLKSLRKEFMYWYPIDMRASGKDLIGNHLTYLLFNHAAIWPTDTSK-WPKGIRANGHLLLNNEKMSKSTGNFMTLEEAIEKFSADGMRLSLADAGDGLEDANFVYAMADAAILRLFTMIEWIKEMIEQRDAGLLRKDAKKFADRVFANEMNSLIAATEQNYEATNFKDALKTGFFEYQAIRDTYRELCAGIDEPMSESLVFRFIETQMLILSPICPHIAEYIW-QLLGKDGLIVNAPWPTVDPVDEKLAIGARFITESLAEFRARLKTYMTPKKKALKEIPEVPTEAVIYVAKEYPPWQKTILDILEKQAKANNGALPDNKAISQLIGKEESLKKFAKKAMPFVQMIKERFEQKGVSALASSSP-VDQTSILNENIDFIMNALDLD--RVTIRHTDEEGIDANIVETTVPLVPMLNFT------PNRPTIKLVARNVQICNAMFDVDVPIVNGDSVS 1101          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: Y105E8A.20 (pep chromosome:WBcel235:I:14486890:14495252:-1 gene:WBGene00013678.1 transcript:Y105E8A.20a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y105E8A.20)

HSP 1 Score: 55.4546 bits (132), Expect = 1.766e-7
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 3
Query: 2151 YPVDLRVSGKDLVPNHLTYYLFNHCAIWPE---NSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANF 2423
            +P   +V GKD+   HL Y        WP     +    P+ +  +GH L++N KMSKS GN +  SEAI K++A+G+R      G+   D +F
Sbjct:  147 WPPTCQVIGKDITKFHLYY--------WPAFLMAAGLSLPQKVFIHGHWLIDNVKMSKSLGNVVNPSEAITKFTAEGLRYFLLKHGNPSYDCSF 232          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: Y105E8A.20 (pep chromosome:WBcel235:I:14486898:14495255:-1 gene:WBGene00013678.1 transcript:Y105E8A.20a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y105E8A.20)

HSP 1 Score: 55.4546 bits (132), Expect = 1.766e-7
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 3
Query: 2151 YPVDLRVSGKDLVPNHLTYYLFNHCAIWPE---NSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANF 2423
            +P   +V GKD+   HL Y        WP     +    P+ +  +GH L++N KMSKS GN +  SEAI K++A+G+R      G+   D +F
Sbjct:  147 WPPTCQVIGKDITKFHLYY--------WPAFLMAAGLSLPQKVFIHGHWLIDNVKMSKSLGNVVNPSEAITKFTAEGLRYFLLKHGNPSYDCSF 232          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: Y105E8A.20 (pep chromosome:WBcel235:I:14486878:14496560:-1 gene:WBGene00013678.1 transcript:Y105E8A.20b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y105E8A.20)

HSP 1 Score: 55.4546 bits (132), Expect = 2.066e-7
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 3
Query: 2151 YPVDLRVSGKDLVPNHLTYYLFNHCAIWPE---NSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANF 2423
            +P   +V GKD+   HL Y        WP     +    P+ +  +GH L++N KMSKS GN +  SEAI K++A+G+R      G+   D +F
Sbjct:  265 WPPTCQVIGKDITKFHLYY--------WPAFLMAAGLSLPQKVFIHGHWLIDNVKMSKSLGNVVNPSEAITKFTAEGLRYFLLKHGNPSYDCSF 350          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: LeuRS (gene:FBgn0284253 transcript:FBtr0345640)

HSP 1 Score: 1118.99 bits (2893), Expect = 0.000e+0
Identity = 577/1164 (49.57%), Postives = 786/1164 (67.53%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKN--KYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIE--TPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHG-VLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGD-YHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFR-----------XXXXXXXXXXXXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLK-TPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSD-EKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAME-SNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKISIR-DSTAVELYHFIDEKASARLIP 3599
            RKGT K+  ++ IE   Q+ WE  +V E++      K+   K+FVTFP+PYMNG LHLGH FSLSK E+SM Y RLKG+  LW FGFHCTGMPIK+ ADKL RE+E FGFPP FPE E   PVA E  +E+  +K KGKKSKAVAK+G  KYQWQIM+  G+ DEEIK F   ++W+ Y+PPL + ++KR+G+ VDWRR+FITTDANP++DSFVRWQF  LK+  KIM+GKR TI+SP D QPCMDHDRSSGEGVGPQEYTLIKMK+ +  P+ L  IK  +F+VAATLRPETMYGQTNCW+HP I+Y+A ++ K+  V +   RAARNM YQ   T   GE+ +L++  G++L+G  L APLT +K +Y+LPM SIK++KGTG+VTSVPSDSPDDYAAL DL++KE  R  Y ++D  VLP+EP+ +I++P  G+  AV   E  KI+SQND DKL EAKE CY   FY G +++G +AG  +Q  K+ +Q  L+ +  A  Y EPE+ ++SRS  ECVVALC+QWYLNY + +W++     L+ + TF +E R NFEA L  LHEYACSR+YGLGT++PWD+++L+ESLSDSTIYMA+YTV H+LQGG+  G       GI  +DMT + W+Y+   +  +      +    L  LRREF YWYP+DLRVSGKDL+ NHLT+ L+NH AIWP N +  WPK +R NGHLLLN+ KMSKS GNFLT++EA++K+SADGMR+  ADAGDS+EDANFVE  ADAG+LRLY+FIEWVKE++E++ ++R G     +D VF + +N   ++T+ NY++M++K  L+ GF+E Q  RD+YRE C  +  H DL+  F+  Q L++SPICPH+ +++W  + NK  SI++  WP  G ++E       YL   +H FR           K    K  +  + + N  ++W+AK+YPPWQ  +LD++ ++ +K   LPDNK + + L +  ELKK MK+ M   Q IR K  E  + V+ L  T E DE+ V+ SN  Y+  TL+LD+  LE+KY+D+ S  EK  +   P  P I+F V              P V++E +N + R+++  VN             I +GD+  ++  +++  I ++ D+  ++++ + D     R IP
Sbjct:    6 RKGTFKVEYLQKIEREVQQRWEAERVHESDAPTAPKKRQAEKFFVTFPFPYMNGRLHLGHTFSLSKAEYSMRYHRLKGRRVLWPFGFHCTGMPIKACADKLTRELEQFGFPPQFPETEEVVPVAAEAASEVPKDKSKGKKSKAVAKTGAAKYQWQIMQSLGLKDEEIKDFANAEHWLNYFPPLAVQDLKRIGVHVDWRRTFITTDANPYFDSFVRWQFNHLKERGKIMYGKRYTIYSPKDGQPCMDHDRSSGEGVGPQEYTLIKMKVLE-VPKALSSIKQPIFMVAATLRPETMYGQTNCWLHPDIKYIAWQANKNNEVWVSTRRAARNMTYQG-FTAVEGEIKVLAEVTGQDLLGVPLSAPLTKHKVVYSLPMLSIKEDKGTGVVTSVPSDSPDDYAALVDLQKKEAFRQKYGLKDEMVLPYEPIPIIEVPTLGKLSAVHAYETLKIQSQNDKDKLAEAKEMCYLKSFYDGVMLVGAFAGRKIQDVKKDLQKRLVDANEADVYYEPEKTIMSRSADECVVALCNQWYLNYGEPEWQAQATKILHGMETFHEEARNNFEACLNWLHEYACSRTYGLGTKLPWDDKWLIESLSDSTIYMAFYTVVHLLQGGTFRGEKP-GPFGIKPSDMTGEIWDYIFFKETPLPKKTAIK-QEHLAVLRREFEYWYPMDLRVSGKDLIQNHLTFCLYNHAAIWP-NDENKWPKGMRVNGHLLLNSAKMSKSDGNFLTLTEAVDKFSADGMRLCLADAGDSVEDANFVESTADAGILRLYTFIEWVKEMLENRSSLRKGTDKTFNDQVFLSELNLKTQQTDENYRKMLFKEALRSGFYELQLARDKYRELCGANGMHEDLVLEFIRRQALLVSPICPHMAEHVWGLLGNK-ESIVHARWPEVGAINEVDILCSEYLMEAAHSFRLNLKNLLQIKGKAGKDKSVNVQAAKPNRGLVWVAKTYPPWQCCVLDTMKELFNKSQALPDNKVIAATLQQKAELKKFMKRVMPFAQMIREKV-ESGKGVAALAVTLEFDERQVLISNLEYLKNTLDLDV--LEIKYTDDPSAPEKTREEVRPGSPFISFSV-------------APNVSVELTNPIERSSLFQVN-----------TVISEGDTVQSLREKLSKIIGLKTDAATLKIWRYEDPVLGPRKIP 1136          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: LeuRS (gene:FBgn0284253 transcript:FBtr0077562)

HSP 1 Score: 1118.99 bits (2893), Expect = 0.000e+0
Identity = 577/1164 (49.57%), Postives = 786/1164 (67.53%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKN--KYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIE--TPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHG-VLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGD-YHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFR-----------XXXXXXXXXXXXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLK-TPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSD-EKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAME-SNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKISIR-DSTAVELYHFIDEKASARLIP 3599
            RKGT K+  ++ IE   Q+ WE  +V E++      K+   K+FVTFP+PYMNG LHLGH FSLSK E+SM Y RLKG+  LW FGFHCTGMPIK+ ADKL RE+E FGFPP FPE E   PVA E  +E+  +K KGKKSKAVAK+G  KYQWQIM+  G+ DEEIK F   ++W+ Y+PPL + ++KR+G+ VDWRR+FITTDANP++DSFVRWQF  LK+  KIM+GKR TI+SP D QPCMDHDRSSGEGVGPQEYTLIKMK+ +  P+ L  IK  +F+VAATLRPETMYGQTNCW+HP I+Y+A ++ K+  V +   RAARNM YQ   T   GE+ +L++  G++L+G  L APLT +K +Y+LPM SIK++KGTG+VTSVPSDSPDDYAAL DL++KE  R  Y ++D  VLP+EP+ +I++P  G+  AV   E  KI+SQND DKL EAKE CY   FY G +++G +AG  +Q  K+ +Q  L+ +  A  Y EPE+ ++SRS  ECVVALC+QWYLNY + +W++     L+ + TF +E R NFEA L  LHEYACSR+YGLGT++PWD+++L+ESLSDSTIYMA+YTV H+LQGG+  G       GI  +DMT + W+Y+   +  +      +    L  LRREF YWYP+DLRVSGKDL+ NHLT+ L+NH AIWP N +  WPK +R NGHLLLN+ KMSKS GNFLT++EA++K+SADGMR+  ADAGDS+EDANFVE  ADAG+LRLY+FIEWVKE++E++ ++R G     +D VF + +N   ++T+ NY++M++K  L+ GF+E Q  RD+YRE C  +  H DL+  F+  Q L++SPICPH+ +++W  + NK  SI++  WP  G ++E       YL   +H FR           K    K  +  + + N  ++W+AK+YPPWQ  +LD++ ++ +K   LPDNK + + L +  ELKK MK+ M   Q IR K  E  + V+ L  T E DE+ V+ SN  Y+  TL+LD+  LE+KY+D+ S  EK  +   P  P I+F V              P V++E +N + R+++  VN             I +GD+  ++  +++  I ++ D+  ++++ + D     R IP
Sbjct:    6 RKGTFKVEYLQKIEREVQQRWEAERVHESDAPTAPKKRQAEKFFVTFPFPYMNGRLHLGHTFSLSKAEYSMRYHRLKGRRVLWPFGFHCTGMPIKACADKLTRELEQFGFPPQFPETEEVVPVAAEAASEVPKDKSKGKKSKAVAKTGAAKYQWQIMQSLGLKDEEIKDFANAEHWLNYFPPLAVQDLKRIGVHVDWRRTFITTDANPYFDSFVRWQFNHLKERGKIMYGKRYTIYSPKDGQPCMDHDRSSGEGVGPQEYTLIKMKVLE-VPKALSSIKQPIFMVAATLRPETMYGQTNCWLHPDIKYIAWQANKNNEVWVSTRRAARNMTYQG-FTAVEGEIKVLAEVTGQDLLGVPLSAPLTKHKVVYSLPMLSIKEDKGTGVVTSVPSDSPDDYAALVDLQKKEAFRQKYGLKDEMVLPYEPIPIIEVPTLGKLSAVHAYETLKIQSQNDKDKLAEAKEMCYLKSFYDGVMLVGAFAGRKIQDVKKDLQKRLVDANEADVYYEPEKTIMSRSADECVVALCNQWYLNYGEPEWQAQATKILHGMETFHEEARNNFEACLNWLHEYACSRTYGLGTKLPWDDKWLIESLSDSTIYMAFYTVVHLLQGGTFRGEKP-GPFGIKPSDMTGEIWDYIFFKETPLPKKTAIK-QEHLAVLRREFEYWYPMDLRVSGKDLIQNHLTFCLYNHAAIWP-NDENKWPKGMRVNGHLLLNSAKMSKSDGNFLTLTEAVDKFSADGMRLCLADAGDSVEDANFVESTADAGILRLYTFIEWVKEMLENRSSLRKGTDKTFNDQVFLSELNLKTQQTDENYRKMLFKEALRSGFYELQLARDKYRELCGANGMHEDLVLEFIRRQALLVSPICPHMAEHVWGLLGNK-ESIVHARWPEVGAINEVDILCSEYLMEAAHSFRLNLKNLLQIKGKAGKDKSVNVQAAKPNRGLVWVAKTYPPWQCCVLDTMKELFNKSQALPDNKVIAATLQQKAELKKFMKRVMPFAQMIREKV-ESGKGVAALAVTLEFDERQVLISNLEYLKNTLDLDV--LEIKYTDDPSAPEKTREEVRPGSPFISFSV-------------APNVSVELTNPIERSSLFQVN-----------TVISEGDTVQSLREKLSKIIGLKTDAATLKIWRYEDPVLGPRKIP 1136          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: lars1b (leucyl-tRNA synthetase 1b [Source:ZFIN;Acc:ZDB-GENE-030114-7])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 376/825 (45.58%), Postives = 527/825 (63.88%), Query Frame = 3
Query: 1275 MFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHN--------AAIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            M +IK++KGTG+VTSVPSD+PDD AALRD+K+K+  R  Y I+D+ VLPFEPV +I+IP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  ++  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +E+WK      L  + TF DE R+NFEA L  L E+ACSR+YGLGTR+PW+EQ+L+ESLSDSTIYMAYYTVAH+LQGG L G+ G +  GI    MT + W+Y+            P+    L  LRREF +WYPVD+RVSGKDLVPNHL+YYL+NH A+WP +S + WP+ +RANGHLLLN+EKMSKSTGNFLT+S+AI K+SADGMR+A ADAGD++EDANFVE MADAG+LRL++++EWVKE++ ++ N+RTGP    +D VF + +N  I +T+ +Y++MMYK  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++ W+ +L K S++M   WP  G VDE L    +YL   +H+ R +     +    ++ +           I++AK+YPPWQ S L  L        G LPDNK +   L   PELKK MK+ M  +  I+    +    V  L+  E DE++V+  N  Y+  +L LD  ++++ ++ E +DEK+ + CCP +P   F       +S P  +                +++VNP   +G  S +I+I  GDS  ++ RR++     I+D + V+L  + D     R IP+  +      P+  ++ F +S  +S +  S NG+   IG+
Sbjct:    1 MLTIKEDKGTGVVTSVPSDAPDDIAALRDIKKKQALREKYGIQDFMVLPFEPVPIIEIPGYGNLSAPLVCDELKIQSQNDREKLAEAKEKVYLKGFYEGIMLVEGFKGQKVQDVKKPIQKMMVEKGEALIYMEPEKQVLSRSADECVVALCDQWYLDYGNEEWKKQAHGVLEHLETFCDETRKNFEATLAWLQEHACSRTYGLGTRLPWNEQWLIESLSDSTIYMAYYTVAHLLQGGVLSGQ-GPSPLGIRPQQMTREVWDYIFFKTSPFPKTDIPK--EHLLKLRREFEFWYPVDVRVSGKDLVPNHLSYYLYNHVAMWPNDSGK-WPQAVRANGHLLLNSEKMSKSTGNFLTLSQAIAKFSADGMRLALADAGDTVEDANFVEAMADAGILRLFTWVEWVKEMIANQDNLRTGPADTFNDRVFISEMNSGIIKTDQHYERMMYKEALKSGFFEFQAAKDKYRELAIEGMHKDLVFQFIENQTLLLAPICPHLCEHTWS-LLGKSSTVMKAQWPTAGPVDEILIRSSQYLMDTAHDLRLRLKAYTQPAKGKKGDNKPPAKPTHCTIYVAKTYPPWQHSALSLLGKHYKSNNGALPDNKVIAMELGAMPELKKYMKRVMPFVAMIKDNLEKNGPRVLDLEL-EFDERAVLLENIVYLTNSLELD--QIDVVFASE-ADEKVKEDCCPGKPFCVF-------RSEPGVI----------------ISLVNPQPSNGLFSTKIDIRQGDSKDSIIRRLSRVNRGIKDLSKVKLMRYEDPVLGPRRIPVLGKEEEGKLPVSNSSVFHISLQESKVHMSDNGLKVDIGD 793          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: lars1b (leucyl-tRNA synthetase 1b [Source:ZFIN;Acc:ZDB-GENE-030114-7])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 342/773 (44.24%), Postives = 483/773 (62.48%), Query Frame = 3
Query: 1431 VEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHN--------AAIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            V +I+IP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  ++  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +E+WK      L  + TF DE R+NFEA L  L E+ACSR+YGLGTR+PW+EQ+L+ESLSDSTIYMAYYTVAH+LQGG L G+ G +  GI    MT + W+Y+            P+    L  LRREF +WYPVD+RVSGKDLVPNHL+YYL+NH A+WP +S + WP+ +RANGHLLLN+EKMSKSTGNFLT+S+AI K+SADGMR+A ADAGD++EDANFVE MADAG+LRL++++EWVKE++ ++ N+RTGP    +D VF + +N  I +T+ +Y++MMYK  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++ W+ +L K S++M   WP  G VDE L    +YL   +H+ R +     +    ++ +           I++AK+YPPWQ S L  L        G LPDNK +   L   PELKK MK+ M  +  I+    +    V  L+  E DE++V+  N  Y+  +L LD  ++++ ++ E +DEK+ + CCP +P   F       +S P  +                +++VNP   +G  S +I+I  GDS  ++ RR++     I+D + V+L  + D     R IP+  +      P+  ++ F +S  +S +  S NG+   IG+
Sbjct:    2 VPIIEIPGYGNLSAPLVCDELKIQSQNDREKLAEAKEKVYLKGFYEGIMLVEGFKGQKVQDVKKPIQKMMVEKGEALIYMEPEKQVLSRSADECVVALCDQWYLDYGNEEWKKQAHGVLEHLETFCDETRKNFEATLAWLQEHACSRTYGLGTRLPWNEQWLIESLSDSTIYMAYYTVAHLLQGGVLSGQ-GPSPLGIRPQQMTREVWDYIFFKTSPFPKTDIPK--EHLLKLRREFEFWYPVDVRVSGKDLVPNHLSYYLYNHVAMWPNDSGK-WPQAVRANGHLLLNSEKMSKSTGNFLTLSQAIAKFSADGMRLALADAGDTVEDANFVEAMADAGILRLFTWVEWVKEMIANQDNLRTGPADTFNDRVFISEMNSGIIKTDQHYERMMYKEALKSGFFEFQAAKDKYRELAIEGMHKDLVFQFIENQTLLLAPICPHLCEHTWS-LLGKSSTVMKAQWPTAGPVDEILIRSSQYLMDTAHDLRLRLKAYTQPAKGKKGDNKPPAKPTHCTIYVAKTYPPWQHSALSLLGKHYKSNNGALPDNKVIAMELGAMPELKKYMKRVMPFVAMIKDNLEKNGPRVLDLEL-EFDERAVLLENIVYLTNSLELD--QIDVVFASE-ADEKVKEDCCPGKPFCVF-------RSEPGVI----------------ISLVNPQPSNGLFSTKIDIRQGDSKDSIIRRLSRVNRGIKDLSKVKLMRYEDPVLGPRRIPVLGKEEEGKLPVSNSSVFHISLQESKVHMSDNGLKVDIGD 742          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: lars1a (leucyl-tRNA synthetase 1a [Source:ZFIN;Acc:ZDB-GENE-110411-16])

HSP 1 Score: 408.297 bits (1048), Expect = 1.455e-131
Identity = 213/354 (60.17%), Postives = 266/354 (75.14%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFE--ANPIYGKD-KKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTE---INLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDD-VFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGK 1211
            RKGTAKL+ +K IE   Q++WE +K+FE  A    G++  KNKYF+TFPYPYMNG LHLGH F LSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKREME +G+PP FPE +     ++KT    I  +K KGKKSKAVAKSG  K+QW IM+  G+ D EI KF E ++W+ Y+PPL + ++KR+G+KVDWRRSFITTD NPFYDSFVRWQF+ LK+  KI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +PYP  L  +K   VFLVAATLRPETM+GQTNCWI P ++YV  ++    + I  +R+ARNM+YQ   T + G V ++   +G+
Sbjct:    4 RKGTAKLDFLKKIEEEVQQKWEQDKLFENEAPATIGENTNKNKYFITFPYPYMNGRLHLGHTFCLSKCEFAVGYQRLKGKQCLFPFGLHCTGMPIKACADKLKREMELYGYPPQFPEEDEEEEEQKKTSDDVIIKDKTKGKKSKAVAKSGSSKFQWDIMKSLGLQDAEIVKFAEAEHWLDYFPPLAVEDLKRMGLKVDWRRSFITTDVNPFYDSFVRWQFINLKERKKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKMKVVEPYPTKLGALKGKTVFLVAATLRPETMFGQTNCWIRPDMKYVVFETANGDLFISTQRSARNMSYQG-FTKENGVVPVIMNIMGQ 356          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: lars (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548548])

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 607/1202 (50.50%), Postives = 815/1202 (67.80%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPV----AIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKD-DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVA-GNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLIDMSDKE-GKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            RKGTAK++ +K IE   Q++W+  K+FE N   +  ++ K KY VTFPYPYMNG LHLGH FSLSKCEF++GY+R+KGK  L+ FG HCTGMPIK+ ADKLKRE E FG+PP FPE E       A +E   I  +K KGKKSKA AKSG  KYQW IM+  G++DEEI +F+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NPFYDSFV+WQFL LK+ N+I FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +P P  L  +K  +VFLVAATLRPETM+GQTNCW+ P + Y+A ++    + IC +RAARNM+YQ    D  G V ++ + +G++L+G AL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRDLK+K+  R  Y I+D  VLPFEPV +IDIP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +I+  Y G  VQ  K+ IQ  +I  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +  WK+ T  CL  + TF +E RRNFEA+L  L E+ACSR+YGLG+R+PWDEQ+L+ESLSDSTIYMAYYTV H+LQG  L G+ G +  GI    MT + W+Y+           +  E   KL+ L++EF +WYPVDLRVSGKDLVPNHL+Y+L+NH A+WPE+S + WP  +RANGHLLLN+EKMSKSTGNFLT+SEA+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ +  ++R+G     +D VFA+ IN  I +TE NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++IW+ +L K  S+M  SWP+ G VDE L    +YL   +H+ R +          ++ +           I++AK+YPPWQ   L +L    +   G+LPDNK + + L+  PELKK MK+ M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L LD  ++E+K++ + +D+K+ + CCP +P   F V + +     P V                V +VNP   +G  S +I I +GDS  ++ RR+   D+  I+D T V+L  + D     R +P+  +       I   A F +  ++  +  + NG+   IG+
Sbjct:    4 RKGTAKVDFLKKIEKDIQEKWDAQKLFEVNASDLQAQNSKGKYLVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRMKGKICLFPFGLHCTGMPIKACADKLKRETELFGYPPQFPEEEEEEEETSAKKEDEVIIKDKAKGKKSKAAAKSGSSKYQWGIMKSLGLSDEEIIRFSEAEHWLDYFPPLAVEDLKSMGLKVDWRRSFITTDVNPFYDSFVKWQFLTLKERNRIKFGKRYTIYSPRDGQPCMDHDRQTGEGVGPQEYTLIKMKVLEPIPTKLSGLKGRNVFLVAATLRPETMFGQTNCWLRPDMPYIAFETANGDIFICTQRAARNMSYQGFTKDN-GVVPVVKELMGEDLLGAALSAPLTSYKVIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDLKKKQALRQKYGIKDEMVLPFEPVPIIDIPGYGNLSAPMVCDELKIQSQNDREKLTEAKEKVYLKGFYEGVMIVPGYEGQKVQDVKKPIQKLMIEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGEANWKTQTTECLKSLETFCEETRRNFEASLGWLQEHACSRTYGLGSRLPWDEQWLIESLSDSTIYMAYYTVCHLLQGKELSGQ-GASPLGIRPEQMTKEVWDYIFFKKAPFPKTTIQKE---KLEKLKQEFEFWYPVDLRVSGKDLVPNHLSYFLYNHVAMWPEDSGK-WPVAVRANGHLLLNSEKMSKSTGNFLTLSEAVEKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLANFDSLRSGTSHTFNDRVFASEINAGIVKTEQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFKFIETQTLLLAPICPHLCEHIWS-LLGKTDSLMKASWPVTGPVDEVLIRSSQYLTETAHDLRLRLKNYMAPAKGKKVDKQPPQKPSHCTIYVAKNYPPWQHKTLLTLRKHYEANAGQLPDNKVIATELNALPELKKYMKRVMPFVAMIKENLEKKGLRVLDLEL-EFDEQTVLLENIVYLTNSLELD--QIEVKFASD-ADDKVKEDCCPGKP---FSVFRTE-----PGV---------------PVFLVNPQPANGHFSTKIAIREGDSRESIIRRLMKTDR-GIKDVTKVKLMRYDDPVLGPRRVPVLGKEEVGKSVISPKAAFHIDLNEKKVHIADNGLKTDIGD 1170          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: lars (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548548])

HSP 1 Score: 1129.78 bits (2921), Expect = 0.000e+0
Identity = 574/1069 (53.70%), Postives = 757/1069 (70.81%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPV----AIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKD-DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLIDMSDKE-GKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITF 3329
            RKGTAK++ +K IE   Q++W+  K+FE N   +  K    KY VTFPYPYMNG LHLGH FSLSKCEF++GY+R+KGK  L+ FG HCTGMPIK+ ADKLKRE E FG+PP FPE E       A +E   I  +K KGKKSKA AKSG  KYQW IM+  G++DEEI +F+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NPFYDSFV+WQFL LK+ N+I FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +P P  L  +K  +VFLVAATLRPETM+GQTNCW+ P + Y+A ++    + IC +RAARNM+YQ    D  G V ++ + +G++L+G AL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRDLK+K+  R  Y I+D  VLPFEPV +IDIP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +I+  Y G  VQ  K+ IQ  +I  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +  WK+ T  CL  + TF +E RRNFEA+L  L E+ACSR+YGLG+R+PWDEQ+L+ESLSDSTIYMAYYTV H+LQG  L G+ G +  GI    MT + W+Y+             +   KL+ L++EF +WYPVDLRVSGKDLVPNHL+Y+L+NH A+WPE+S + WP  +RANGHLLLN+EKMSKSTGNFLT+SEA+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ +  ++R+G     +D VFA+ IN  I +TE NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++IW+ +L K  S+M  SWP+ G VDE L    +YL   +H+ R +          ++ +           I++AK+YPPWQ   L +L    +   G+LPDNK + + L+  PELKK MK+ M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L LD  ++E+K++ + +D+K+ + CCP +P   F
Sbjct:    4 RKGTAKVDFLKKIEKDIQEKWDAQKLFEVNASDLQHKTSICKYLVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRMKGKICLFPFGLHCTGMPIKACADKLKRETELFGYPPQFPEEEEEEEETSAKKEDEVIIKDKAKGKKSKAAAKSGSSKYQWGIMKSLGLSDEEIIRFSEAEHWLDYFPPLAVEDLKSMGLKVDWRRSFITTDVNPFYDSFVKWQFLTLKERNRIKFGKRYTIYSPRDGQPCMDHDRQTGEGVGPQEYTLIKMKVLEPIPTKLSGLKGRNVFLVAATLRPETMFGQTNCWLRPDMPYIAFETANGDIFICTQRAARNMSYQGFTKDN-GVVPVVKELMGEDLLGAALSAPLTSYKVIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDLKKKQALRQKYGIKDEMVLPFEPVPIIDIPGYGNLSAPMVCDELKIQSQNDREKLTEAKEKVYLKGFYEGVMIVPGYEGQKVQDVKKPIQKLMIEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGEANWKTQTTECLKSLETFCEETRRNFEASLGWLQEHACSRTYGLGSRLPWDEQWLIESLSDSTIYMAYYTVCHLLQGKELSGQ-GASPLGIRPEQMTKEVWDYIFFKKAPFPKTTIQK--EKLEKLKQEFEFWYPVDLRVSGKDLVPNHLSYFLYNHVAMWPEDSGK-WPVAVRANGHLLLNSEKMSKSTGNFLTLSEAVEKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLANFDSLRSGTSHTFNDRVFASEINAGIVKTEQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFKFIETQTLLLAPICPHLCEHIWS-LLGKTDSLMKASWPVTGPVDEVLIRSSQYLTETAHDLRLRLKNYMAPAKGKKVDKQPPQKPSHCTIYVAKNYPPWQHKTLLTLRKHYEANAGQLPDNKVIATELNALPELKKYMKRVMPFVAMIKENLEKKGLRVLDLEL-EFDEQTVLLENIVYLTNSLELD--QIEVKFASD-ADDKVKEDCCPGKPFSVF 1062          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: lars (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548548])

HSP 1 Score: 1104.35 bits (2855), Expect = 0.000e+0
Identity = 592/1199 (49.37%), Postives = 795/1199 (66.31%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPV----AIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKD-DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLIDMSDKE-GKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            RKGTAK++ +K IE   Q++W+  K+FE N     D K KY VTFPYPYMNG LHLGH FSLSKCE S     L+          H     +++ ADKLKRE E FG+PP FPE E       A +E   I  +K KGKKSKA AKSG  KYQW IM+  G++DEEI +F+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NPFYDSFV+WQFL LK+ N+I FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +P P  L  +K  +VFLVAATLRPETM+GQTNCW+ P + Y+A ++    + IC +RAARNM+YQ    D  G V ++ + +G++L+G AL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRDLK+K+  R  Y I+D  VLPFEPV +IDIP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +I+  Y G  VQ  K+ IQ  +I  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +  WK+ T  CL  + TF +E RRNFEA+L  L E+ACSR+YGLG+R+PWDEQ+L+ESLSDSTIYMAYYTV H+LQG  L G+ G +  GI    MT + W+Y+             +   KL+ L++EF +WYPVDLRVSGKDLVPNHL+Y+L+NH A+WPE+S + WP  +RANGHLLLN+EKMSKSTGNFLT+SEA+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ +  ++R+G     +D VFA+ IN  I +TE NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++IW+ +L K  S+M  SWP+ G VDE L    +YL   +H+ R +          ++ +           I++AK+YPPWQ   L +L    +   G+LPDNK + + L+  PELKK MK+ M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L LD  ++E+K++ + +D+K+ + CCP +P   F V + +     P V                V +VNP   +G  S +I I +GDS  ++ RR+   D+  I+D T V+L  + D     R +P+  +       I   A F +  ++  +  + NG+   IG+
Sbjct:    4 RKGTAKVDFLKKIEKDIQEKWDAQKLFEVN---ASDFKGKYLVTFPYPYMNGRLHLGHTFSLSKCEVSACISTLRKSYVTNPVTTH-----LQACADKLKRETELFGYPPQFPEEEEEEEETSAKKEDEVIIKDKAKGKKSKAAAKSGSSKYQWGIMKSLGLSDEEIIRFSEAEHWLDYFPPLAVEDLKSMGLKVDWRRSFITTDVNPFYDSFVKWQFLTLKERNRIKFGKRYTIYSPRDGQPCMDHDRQTGEGVGPQEYTLIKMKVLEPIPTKLSGLKGRNVFLVAATLRPETMFGQTNCWLRPDMPYIAFETANGDIFICTQRAARNMSYQGFTKDN-GVVPVVKELMGEDLLGAALSAPLTSYKVIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDLKKKQALRQKYGIKDEMVLPFEPVPIIDIPGYGNLSAPMVCDELKIQSQNDREKLTEAKEKVYLKGFYEGVMIVPGYEGQKVQDVKKPIQKLMIEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGEANWKTQTTECLKSLETFCEETRRNFEASLGWLQEHACSRTYGLGSRLPWDEQWLIESLSDSTIYMAYYTVCHLLQGKELSGQ-GASPLGIRPEQMTKEVWDYIFFKKAPFPKTTIQK--EKLEKLKQEFEFWYPVDLRVSGKDLVPNHLSYFLYNHVAMWPEDSGK-WPVAVRANGHLLLNSEKMSKSTGNFLTLSEAVEKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLANFDSLRSGTSHTFNDRVFASEINAGIVKTEQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFKFIETQTLLLAPICPHLCEHIWS-LLGKTDSLMKASWPVTGPVDEVLIRSSQYLTETAHDLRLRLKNYMAPAKGKKVDKQPPQKPSHCTIYVAKNYPPWQHKTLLTLRKHYEANAGQLPDNKVIATELNALPELKKYMKRVMPFVAMIKENLEKKGLRVLDLEL-EFDEQTVLLENIVYLTNSLELD--QIEVKFASD-ADDKVKEDCCPGKP---FSVFRTE-----PGV---------------PVFLVNPQPANGHFSTKIAIREGDSRESIIRRLMKTDR-GIKDVTKVKLMRYDDPVLGPRRVPVLGKEEVGKSVISPKAAFHIDLNEKKVHIADNGLKTDIGD 1160          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: lars (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548548])

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 588/1201 (48.96%), Postives = 794/1201 (66.11%), Query Frame = 3
Query:  168 NRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPV----AIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKD-DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVA-GNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLIDMSDKE-GKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
             RKGTAK++ +K IE   Q++W+  K+FE N     D   +Y                  FS  KC F++GY+R+KGK  L+ FG HCTGMPIK+ ADKLKRE E FG+PP FPE E       A +E   I  +K KGKKSKA AKSG  KYQW IM+  G++DEEI +F+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NPFYDSFV+WQFL LK+ N+I FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +P P  L  +K  +VFLVAATLRPETM+GQTNCW+ P + Y+A ++    + IC +RAARNM+YQ    D  G V ++ + +G++L+G AL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRDLK+K+  R  Y I+D  VLPFEPV +IDIP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +I+  Y G  VQ  K+ IQ  +I  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +  WK+ T  CL  + TF +E RRNFEA+L  L E+ACSR+YGLG+R+PWDEQ+L+ESLSDSTIYMAYYTV H+LQG  L G+ G +  GI    MT + W+Y+           +  E   KL+ L++EF +WYPVDLRVSGKDLVPNHL+Y+L+NH A+WPE+S + WP  +RANGHLLLN+EKMSKSTGNFLT+SEA+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ +  ++R+G     +D VFA+ IN  I +TE NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++IW+ +L K  S+M  SWP+ G VDE L    +YL   +H+ R +          ++ +           I++AK+YPPWQ   L +L    +   G+LPDNK + + L+  PELKK MK+ M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L LD  ++E+K++ + +D+K+ + CCP +P   F V + +     P V                V +VNP   +G  S +I I +GDS  ++ RR+   D+  I+D T V+L  + D     R +P+  +       I   A F +  ++  +  + NG+   IG+
Sbjct:    3 GRKGTAKVDFLKKIEKDIQEKWDAQKLFEVN---ASDLFERY----------------KTFSKGKCIFAVGYQRMKGKICLFPFGLHCTGMPIKACADKLKRETELFGYPPQFPEEEEEEEETSAKKEDEVIIKDKAKGKKSKAAAKSGSSKYQWGIMKSLGLSDEEIIRFSEAEHWLDYFPPLAVEDLKSMGLKVDWRRSFITTDVNPFYDSFVKWQFLTLKERNRIKFGKRYTIYSPRDGQPCMDHDRQTGEGVGPQEYTLIKMKVLEPIPTKLSGLKGRNVFLVAATLRPETMFGQTNCWLRPDMPYIAFETANGDIFICTQRAARNMSYQGFTKDN-GVVPVVKELMGEDLLGAALSAPLTSYKVIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDLKKKQALRQKYGIKDEMVLPFEPVPIIDIPGYGNLSAPMVCDELKIQSQNDREKLTEAKEKVYLKGFYEGVMIVPGYEGQKVQDVKKPIQKLMIEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGEANWKTQTTECLKSLETFCEETRRNFEASLGWLQEHACSRTYGLGSRLPWDEQWLIESLSDSTIYMAYYTVCHLLQGKELSGQ-GASPLGIRPEQMTKEVWDYIFFKKAPFPKTTIQKE---KLEKLKQEFEFWYPVDLRVSGKDLVPNHLSYFLYNHVAMWPEDSGK-WPVAVRANGHLLLNSEKMSKSTGNFLTLSEAVEKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLANFDSLRSGTSHTFNDRVFASEINAGIVKTEQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFKFIETQTLLLAPICPHLCEHIWS-LLGKTDSLMKASWPVTGPVDEVLIRSSQYLTETAHDLRLRLKNYMAPAKGKKVDKQPPQKPSHCTIYVAKNYPPWQHKTLLTLRKHYEANAGQLPDNKVIATELNALPELKKYMKRVMPFVAMIKENLEKKGLRVLDLEL-EFDEQTVLLENIVYLTNSLELD--QIEVKFASD-ADDKVKEDCCPGKP---FSVFRTE-----PGV---------------PVFLVNPQPANGHFSTKIAIREGDSRESIIRRLMKTDR-GIKDVTKVKLMRYDDPVLGPRRVPVLGKEEVGKSVISPKAAFHIDLNEKKVHIADNGLKTDIGD 1149          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: lars (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548548])

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 577/1164 (49.57%), Postives = 775/1164 (66.58%), Query Frame = 3
Query:  282 KNKYFVTFPYPYMNGNLHLGHAFSLSKCEFS--MGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPV----AIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKD-DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLIDMSDKE-GKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            K KY VTFPYPYMNG LHLGH FSLSKCE S  +  +RL+          H     +++ ADKLKRE E FG+PP FPE E       A +E   I  +K KGKKSKA AKSG  KYQW IM+  G++DEEI +F+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NPFYDSFV+WQFL LK+ N+I FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +P P  L  +K  +VFLVAATLRPETM+GQTNCW+ P + Y+A ++    + IC +RAARNM+YQ    D  G V ++ + +G++L+G AL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRDLK+K+  R  Y I+D  VLPFEPV +IDIP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +I+  Y G  VQ  K+ IQ  +I  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +  WK+ T  CL  + TF +E RRNFEA+L  L E+ACSR+YGLG+R+PWDEQ+L+ESLSDSTIYMAYYTV H+LQG  L G+ G +  GI    MT + W+Y+             +   KL+ L++EF +WYPVDLRVSGKDLVPNHL+Y+L+NH A+WPE+S + WP  +RANGHLLLN+EKMSKSTGNFLT+SEA+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ +  ++R+G     +D VFA+ IN  I +TE NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ ++IW+ +L K  S+M  SWP+ G VDE L    +YL   +H+ R +          ++ +           I++AK+YPPWQ   L +L    +   G+LPDNK + + L+  PELKK MK+ M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L LD  ++E+K++ + +D+K+ + CCP +P   F V + +     P V                V +VNP   +G  S +I I +GDS  ++ RR+   D+  I+D T V+L  + D     R +P+  +       I   A F +  ++  +  + NG+   IG+
Sbjct:   15 KGKYLVTFPYPYMNGRLHLGHTFSLSKCEVSACISTKRLRKSYVTNPVTTH-----LQACADKLKRETELFGYPPQFPEEEEEEEETSAKKEDEVIIKDKAKGKKSKAAAKSGSSKYQWGIMKSLGLSDEEIIRFSEAEHWLDYFPPLAVEDLKSMGLKVDWRRSFITTDVNPFYDSFVKWQFLTLKERNRIKFGKRYTIYSPRDGQPCMDHDRQTGEGVGPQEYTLIKMKVLEPIPTKLSGLKGRNVFLVAATLRPETMFGQTNCWLRPDMPYIAFETANGDIFICTQRAARNMSYQGFTKDN-GVVPVVKELMGEDLLGAALSAPLTSYKVIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDLKKKQALRQKYGIKDEMVLPFEPVPIIDIPGYGNLSAPMVCDELKIQSQNDREKLTEAKEKVYLKGFYEGVMIVPGYEGQKVQDVKKPIQKLMIEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGEANWKTQTTECLKSLETFCEETRRNFEASLGWLQEHACSRTYGLGSRLPWDEQWLIESLSDSTIYMAYYTVCHLLQGKELSGQ-GASPLGIRPEQMTKEVWDYIFFKKAPFPKTTIQK--EKLEKLKQEFEFWYPVDLRVSGKDLVPNHLSYFLYNHVAMWPEDSGK-WPVAVRANGHLLLNSEKMSKSTGNFLTLSEAVEKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLANFDSLRSGTSHTFNDRVFASEINAGIVKTEQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFKFIETQTLLLAPICPHLCEHIWS-LLGKTDSLMKASWPVTGPVDEVLIRSSQYLTETAHDLRLRLKNYMAPAKGKKVDKQPPQKPSHCTIYVAKNYPPWQHKTLLTLRKHYEANAGQLPDNKVIATELNALPELKKYMKRVMPFVAMIKENLEKKGLRVLDLEL-EFDEQTVLLENIVYLTNSLELD--QIEVKFASD-ADDKVKEDCCPGKP---FSVFRTE-----PGV---------------PVFLVNPQPANGHFSTKIAIREGDSRESIIRRLMKTDR-GIKDVTKVKLMRYDDPVLGPRRVPVLGKEEVGKSVISPKAAFHIDLNEKKVHIADNGLKTDIGD 1139          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Lars (leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1913808])

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 602/1203 (50.04%), Postives = 815/1203 (67.75%), Query Frame = 3
Query:  168 NRKGTAKLNTIKDIEVAKQKEWENNKVFEANPI----YGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINL---NXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLID-MSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
             RKGTAK++ +K+IE   Q++WE  KVFE +        +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK+ L+ FG HCTGMPIK+ ADKLKRE+E +G PP FPE E           ++   +K KGKKSKA AK+G  KYQW IM+  G++D++I KF+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTL+K+K+ +PYP  L  +K  ++FLVAATLRPETM+GQTNCW+ P ++Y+  ++    + IC +RAARNM+YQ   T   G V ++ + +G+E++G +L APLT YK +Y LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ + I D  VLPFEPV V++IP  G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++  + G  +Q  K+ IQ ++I +G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y DE WK  T  CL  + TF +E R+NFEA+L+ L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG L+G++  +  GI    MT D W+YV   D        P+   KLD L++EF +WYPVDLR SGKDL+PNHL+YY++NH A+WPE SD+ WP ++RANGHLLLN+EKMSKSTGNFLT+S+A++K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ S  ++R+GP    +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE      H +L+  F+E+Q ++L+P CPH+ ++IWT +L KP SIM+ SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK+YP WQ   L +L        GKLPDNK + S L   PELKK MKK M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F           P V                V++VNP   SG  S +I+I  GDS  ++ RR+   D+  I+D + V+L  F D     R +P+      +   I  NA F V      +  + NG+   IG+
Sbjct:    3 GRKGTAKVDFLKEIEKEAQQKWEAEKVFEVSASRLEKQKQSSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPEEEEEEEESSAKPGDIVVRDKAKGKKSKAAAKAGSSKYQWDIMKSLGLSDDDIVKFSEAEHWLDYFPPLAVQDLKTIGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLVKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETANGDIFICTQRAARNMSYQG-FTKHNGVVPVVKELMGEEILGASLSAPLTCYKVVYVLPMLTIKEDKGTGVVTSVPSDSPDDLAALRDLKKKQALRTKFGIRDDMVLPFEPVPVLEIPGIGNLPAVTVCDELKIQSQNDREKLAEAKEKLYLRGFYDGVMLVDGFKGQKIQHVKKTIQKNMIDAGDALIYMEPEKQVMSRSADECVVALCDQWYLDYGDENWKKQTFQCLKNMETFCEESRKNFEASLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGDLNGQAE-SPLGIRPQQMTKDVWDYVFFKDAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRASGKDLIPNHLSYYIYNHVAMWPEQSDK-WPVSVRANGHLLLNSEKMSKSTGNFLTLSQAVDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELATEGMHRELVFRFIEVQTILLTPFCPHLCEHIWT-LLGKPDSIMHASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMMPAKGKKTDKQPAQRPSHCTIYVAKNYPVWQHITLTTLRSHFEANNGKLPDNKVIASELGSLPELKKYMKKVMPFVAMIKENMEKKGPRVLDLEL-EFDEQAVLMENIVYLTNSLELE--HIEVKFASEAED-KVREECCPGKPLNVF--------RTEPGV---------------PVSLVNPQPSSGHFSTKIDIRQGDSCESIIRRLMKTDR-GIKDLSKVKLMRFDDPLLGPRRVPVLGREHSEKTLISENAVFHVDLVSKKVHLTENGLRTDIGD 1171          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Lars (leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1913808])

HSP 1 Score: 236.884 bits (603), Expect = 8.101e-71
Identity = 109/178 (61.24%), Postives = 141/178 (79.21%), Query Frame = 3
Query: 2019 GITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFA 2552
            GI    MT D W+YV   D        P+   KLD L++EF +WYPVDLR SGKDL+PNHL+YY++NH A+WPE SD+ WP ++RANGHLLLN+EKMSKSTGNFLT+S+A++K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ S  ++R+GP    +D VFA
Sbjct:    9 GIRPQQMTKDVWDYVFFKDAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRASGKDLIPNHLSYYIYNHVAMWPEQSDK-WPVSVRANGHLLLNSEKMSKSTGNFLTLSQAVDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFA 183          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Lars (leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1913808])

HSP 1 Score: 130.183 bits (326), Expect = 4.871e-35
Identity = 61/98 (62.24%), Postives = 74/98 (75.51%), Query Frame = 3
Query:  168 NRKGTAKLNTIKDIEVAKQKEWENNKVFEANPI----YGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIK 449
             RKGTAK++ +K+IE   Q++WE  KVFE +        +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK+ L+ FG HCTGMPIK
Sbjct:    3 GRKGTAKVDFLKEIEKEAQQKWEAEKVFEVSASRLEKQKQSSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIK 100          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Lars (leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1913808])

HSP 1 Score: 63.1586 bits (152), Expect = 1.572e-11
Identity = 44/99 (44.44%), Postives = 66/99 (66.67%), Query Frame = 3
Query:  444 IKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINL---NXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRL 731
            + + ADKLKRE+E +G PP FPE E           ++   +K KGKKSKA AK+G  KYQW IM+  G++D++I KF+E ++W+ Y+PPL + ++K +
Sbjct:    1 MAACADKLKREIELYGCPPDFPEEEEEEEESSAKPGDIVVRDKAKGKKSKAAAKAGSSKYQWDIMKSLGLSDDDIVKFSEAEHWLDYFPPLAVQDLKTI 99          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Lars (leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:1913808])

HSP 1 Score: 50.8322 bits (120), Expect = 9.494e-8
Identity = 17/41 (41.46%), Postives = 29/41 (70.73%), Query Frame = 3
Query: 2652 RDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWT 2774
            +D+YRE      H +L+  F+E+Q ++L+P CPH+ ++IWT
Sbjct:    4 KDKYRELATEGMHRELVFRFIEVQTILLTPFCPHLCEHIWT 44          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q9P2J5|SYLC_HUMAN (Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2)

HSP 1 Score: 1184.09 bits (3062), Expect = 0.000e+0
Identity = 609/1199 (50.79%), Postives = 820/1199 (68.39%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETP---VAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            RKGTAK++ +K IE   Q++W+  +VFE N   +  +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E      +++ +  I  +K KGKKSKA AK+G  KYQW IM+  G++DEEI KF+E ++W+ Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTL+K+K+ +PYP  L  +K  ++FLVAATLRPETM+GQTNCW+ P ++Y+  ++    + IC ++AARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ Y I D  VLPFEPV VI+IP +G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  +I +G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +E WK  T  CL  + TF +E RRNFEA L  L E+ACSR+YGLGT +PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG+L G++  +  GI    MT + W+YV   +         +   KLD L++EF +WYPVDLRVSGKDLVPNHL+YYL+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT+++AI+K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP S  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H +L+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G V+E L    +YL  ++H+ R +          ++ +           I++AK+YPPWQ + L  L        GKLPDNK + S L   PELKK MKK M  +  I+    +    +  L+  E DEK+V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F +         P V               +V++VNP   +G  S +IEI  GD+  ++ RR+      I+D + V+L  F D     R +P+  +   +  PI  +A F+V      I  + NG+   IG+
Sbjct:    4 RKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTEDIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETVNGDIFICTQKAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAEAKEKIYLKGFYEGIMLVDGFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQAE-SPLGIRPQQMTKEVWDYVFFKEAPFPKTQIAK--EKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDK-WPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQL-EFDEKAVLMENIVYLTNSLELE--HIEVKFASEAED-KIREDCCPGKPLNVFRI--------EPGV---------------SVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q8BMJ2|SYLC_MOUSE (Leucine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Lars1 PE=1 SV=2)

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 602/1203 (50.04%), Postives = 815/1203 (67.75%), Query Frame = 3
Query:  168 NRKGTAKLNTIKDIEVAKQKEWENNKVFEANPI----YGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINL---NXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLID-MSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
             RKGTAK++ +K+IE   Q++WE  KVFE +        +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK+ L+ FG HCTGMPIK+ ADKLKRE+E +G PP FPE E           ++   +K KGKKSKA AK+G  KYQW IM+  G++D++I KF+E ++W+ Y+PPL + ++K +G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTL+K+K+ +PYP  L  +K  ++FLVAATLRPETM+GQTNCW+ P ++Y+  ++    + IC +RAARNM+YQ   T   G V ++ + +G+E++G +L APLT YK +Y LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ + I D  VLPFEPV V++IP  G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++  + G  +Q  K+ IQ ++I +G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y DE WK  T  CL  + TF +E R+NFEA+L+ L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG L+G++  +  GI    MT D W+YV   D        P+   KLD L++EF +WYPVDLR SGKDL+PNHL+YY++NH A+WPE SD+ WP ++RANGHLLLN+EKMSKSTGNFLT+S+A++K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ S  ++R+GP    +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE      H +L+  F+E+Q ++L+P CPH+ ++IWT +L KP SIM+ SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK+YP WQ   L +L        GKLPDNK + S L   PELKK MKK M  +  I+    ++   V  L+  E DE++V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F           P V                V++VNP   SG  S +I+I  GDS  ++ RR+   D+  I+D + V+L  F D     R +P+      +   I  NA F V      +  + NG+   IG+
Sbjct:    3 GRKGTAKVDFLKEIEKEAQQKWEAEKVFEVSASRLEKQKQSSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPEEEEEEEESSAKPGDIVVRDKAKGKKSKAAAKAGSSKYQWDIMKSLGLSDDDIVKFSEAEHWLDYFPPLAVQDLKTIGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLVKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETANGDIFICTQRAARNMSYQG-FTKHNGVVPVVKELMGEEILGASLSAPLTCYKVVYVLPMLTIKEDKGTGVVTSVPSDSPDDLAALRDLKKKQALRTKFGIRDDMVLPFEPVPVLEIPGIGNLPAVTVCDELKIQSQNDREKLAEAKEKLYLRGFYDGVMLVDGFKGQKIQHVKKTIQKNMIDAGDALIYMEPEKQVMSRSADECVVALCDQWYLDYGDENWKKQTFQCLKNMETFCEESRKNFEASLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGDLNGQAE-SPLGIRPQQMTKDVWDYVFFKDAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRASGKDLIPNHLSYYIYNHVAMWPEQSDK-WPVSVRANGHLLLNSEKMSKSTGNFLTLSQAVDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELATEGMHRELVFRFIEVQTILLTPFCPHLCEHIWT-LLGKPDSIMHASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMMPAKGKKTDKQPAQRPSHCTIYVAKNYPVWQHITLTTLRSHFEANNGKLPDNKVIASELGSLPELKKYMKKVMPFVAMIKENMEKKGPRVLDLEL-EFDEQAVLMENIVYLTNSLELE--HIEVKFASEAED-KVREECCPGKPLNVF--------RTEPGV---------------PVSLVNPQPSSGHFSTKIDIRQGDSCESIIRRLMKTDR-GIKDLSKVKLMRFDDPLLGPRRVPVLGREHSEKTLISENAVFHVDLVSKKVHLTENGLRTDIGD 1171          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q5R614|SYLC_PONAB (Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii OX=9601 GN=LARS1 PE=2 SV=1)

HSP 1 Score: 1166.76 bits (3017), Expect = 0.000e+0
Identity = 608/1203 (50.54%), Postives = 821/1203 (68.25%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFG-----FPPVFPEIETPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQ---MSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            RKGTAK++ +K IE   Q++W+  +VFE N   +  +  K KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G           E ET V  E+ T I  +K KGKKSKA AK+G  KYQW IM+  G++DEEI KF+E ++W+ Y+PPL I ++KRLG+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTL+K+K+ +PYP  L  +K  ++FLVAATLRPET++GQTNCW+ P ++Y+  ++    + IC ++AARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ Y I D  VLPFEPV VI+IP +G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  +I +G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y +E WK  T  CL  + TF +E RRNFEA L  L E+ACSR+YGLGT +PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG+L G++  +  GI    MT + W+YV   +         +   KLD L++EF +WYPVDLRVSGKDLVPNHL+YYL+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT+++AI+K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP +  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H +L+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK+YPPWQ   +S+L    + +++  KLPDNK + S L   PELKK MKK M  +  I+    +    +  L+  E DEK+V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F +         P V               ++++VNP   +G  S +IEI  GD+  ++ RR+      I+D + V+L  F D     R +P+  +   +  PI  +A F+V      I  + NG+   IG+
Sbjct:    4 RKGTAKVDFLKKIEKEIQQKWDTERVFEVNASSLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEDEEEETNVKTED-TRIK-DKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRLGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETLFGQTNCWVRPDMKYIGFETVNGDIFICTQKAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAEAKEKIYLKGFYEGIMLVDGFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQAE-SPLGIRPQQMTKEVWDYVFFKEAPFPKTQIAK--EKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDK-WPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPANTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVDEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNR--KLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQL-EFDEKAVLMENIVYLTNSLELE--HIEVKFASEAED-KIREDCCPGKPLNVFRI--------EPGV---------------SISLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEHTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q09996|SYLC_CAEEL (Leucine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=lars-1 PE=3 SV=2)

HSP 1 Score: 1076.62 bits (2783), Expect = 0.000e+0
Identity = 563/1108 (50.81%), Postives = 738/1108 (66.61%), Query Frame = 3
Query:  186 KLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKT---EINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKH--GVLICVERAARNMAYQEILTDQPGEV---IILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESK-PNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMG---DYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXH------NAAIIWIAKSYPPWQMSILDSLIDMSD-KEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECS-DEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFS 3449
            K+  +++IE + Q+ WE+ K FEA+     D K KY VTFP+PYMNG LHLGH FS SKCEF+ G++RL+GK  L+ FGFHCTGMPIK+ ADKLKREM+ FG+PP FPE       EE +   EI  +K KGKKSK VAK+G  KYQWQIM+  G+ DEEIK+F++ ++W+ Y+PP  I ++K++G+K DWRRSFITTD NP++DSFVRWQF  L+   KI FGKR TI+SP D QPCMDHDR+SGEGVGPQEYTLIK+K+  P PQ L  IK+D++LVAATLRPETMYGQTNC++HP I+Y    +T++   V +   R+AR M+YQ  LT + G+V   + L K  G +++G  L APL  Y+ +Y LPM +IK +KGTG+VTSVPSDSPDD+AAL DLK+K+  R  Y + D  VLPFEPV +I I   G   AV+     KI+SQN+ DKL EAK++ Y  GFY G +++GKYAG      K++IQ DL   GLA  Y EPE++V+SRSG ECVVALCDQWYLNY + +WK+  K  L  + TF+DE RR  E  ++ LHEYACSRSYGLGT++PWD QYL+ESLSDSTIY AYYTVAH+LQ G+ DG S V  +GI    MT  +W YV   +   +  + P    KL  LR+EF YWYP+D+R SGKDL+ NHLTY LFNH AIWP ++ + WPK IRANGHLLLNNEKMSKSTGNF+T+ EAIEK+SADGMR++ ADAGD +EDANFV  MADA +LRL++ IEW+KE++E +   +        +D VFAN +N  I  TE NY+   +K  L+ GF E+Q+IRD YRE C G        L+  F+E Q LILSPICPHI +YIW  +L K   I+N  WP    VDEKL+   R++     EFR +       K             A+I++AK YPPWQ +ILD L   +    G LPDNK+++  + +   LKK  KKAM  +Q I+ +  ++  +     +P +D+ S++  N  ++   L+LD  ++ ++++DE   D  + ++  P+ P + F        + P    V R     N++    V +VN D  S
Sbjct:   10 KVAQLQEIEKSIQELWESKKAFEADA--RDDGKPKYLVTFPFPYMNGRLHLGHTFSASKCEFAAGFQRLQGKEVLFPFGFHCTGMPIKACADKLKREMQDFGYPPNFPEDVVEEVKEEVSAVDEIIKDKSKGKKSKLVAKTGNAKYQWQIMKSLGLCDEEIKEFSDPNHWLYYFPPHCIADLKKMGLKADWRRSFITTDVNPYFDSFVRWQFNLLRAAKKIDFGKRYTIYSPKDGQPCMDHDRASGEGVGPQEYTLIKLKVLDPKPQALSHIKEDIYLVAATLRPETMYGQTNCYLHPDIQYSVFYATENEKQVFVATARSARIMSYQG-LTKENGKVNYVLGLEKIAGSKILGAPLSAPLAKYERVYALPMLTIKDDKGTGVVTSVPSDSPDDFAALSDLKKKKPLREKYGLTDEMVLPFEPVPIIKIEGLGDLAAVEMCSRLKIESQNEKDKLEEAKKEVYLKGFYDGVMLVGKYAGKKTADVKKVIQDDLTAEGLATKYVEPEKKVMSRSGDECVVALCDQWYLNYGEAEWKAAAKKVLEPLRTFNDETRRGLETTVDWLHEYACSRSYGLGTKLPWDTQYLIESLSDSTIYNAYYTVAHLLQQGAFDG-SVVGPAGIKADQMTDASWSYVFLGEIYDSKTM-PVEEEKLKSLRKEFMYWYPIDMRASGKDLIGNHLTYLLFNHAAIWPTDTSK-WPKGIRANGHLLLNNEKMSKSTGNFMTLEEAIEKFSADGMRLSLADAGDGLEDANFVYAMADAAILRLFTMIEWIKEMIEQRDAGLLRKDAKKFADRVFANEMNSLIAATEQNYEATNFKDALKTGFFEYQAIRDTYRELCAGIDEPMSESLVFRFIETQMLILSPICPHIAEYIW-QLLGKDGLIVNAPWPTVDPVDEKLAIGARFITESLAEFRARLKTYMTPKKKALKEIPEVPTEAVIYVAKEYPPWQKTILDILEKQAKANNGALPDNKAISQLIGKEESLKKFAKKAMPFVQMIKERFEQKGVSALASSSP-VDQTSILNENIDFIMNALDLD--RVTIRHTDEEGIDANIVETTVPLVPMLNFT------PNRPTIKLVARNVQICNAMFDVDVPIVNGDSVS 1101          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q54N83|SYLC_DICDI (Leucine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=leuS PE=3 SV=1)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 486/1041 (46.69%), Postives = 681/1041 (65.42%), Query Frame = 3
Query:  180 TAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKN-KYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINLN--XXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDD---VFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDE--QWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPE----LVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXX-------XXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGK--LPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTP-EIDEKSVIESNFRYMAKTLNL 3236
            TAKL+ ++  E   Q +WE++K FE + +   D ++ KY  TFPYPYMNG LH+GH F+++K EF   ++RL GK  L+ F FHCTGMPIK+ ADKLK+E+E FG PPVFP IE     E  T +  +    K KK+KAVAKSGG  YQW+IM+  G++DEEI  F ++ YW+ Y+PP   +++K LG+ VDWRRSFITTD N +YDSFVRWQF  LK L K+ +GKR +I+S ID+Q C DH+R+ GEGVGPQ YTLIK+++ +P P+CL++I      ++LV  TLRPETMYGQTNCWI PT +Y A +     + +C ER+ARNM+YQ++ T + GE   L+KF G +++G AL+APL     +Y LPM +I +NKGTG+VTSVPSDSPDDYA+L+DLK K   R+ + I+D  VLPFE V +IDIP Y  + AV+  ++  IKSQND   L +AK+ CY+ GF  G + +G YAG  V + K+II+ +++ SG A++YSEP  +V+SRSG ECVVAL DQWY+NY D+  +WK+ T   L  +  +S E ++ FE  L  ++++ACSRS+GLGT +PWDE++L+ESLSDSTIYMA+YTVAH+LQG     + G  S+GIT   MT   W+YVL       G   PE       KL  L++EF YWYPVD+RVSG DL+ NHLT++L+ H AI+ +   ++ PK+IRANG + LN EKMSKSTGNFLT+ +++ K+SADG R+A ADAGDSIEDANFV+  A   LL+L++ I+WV+E ++S    R+GPL    D +F + IN  I E+E  Y++  ++  L L F + Q+ RD Y+ T +   H DL+  F+E+Q L++ PI PH    ++ ++L K  +I++  WP  G +D +   +  Y+    + FR +     K+K       +    + + I ++KSYP WQ  +L+ L  + +++ K    DN ++   L    E+K   K  M  + S      E  ++   L+T    DE S +  N  Y+ KTL L
Sbjct:    3 TAKLDFVRAYEKEVQNKWESDKQFEIDALDAPDAEHPKYLATFPYPYMNGRLHVGHVFTITKAEFMCQFQRLMGKRVLFPFAFHCTGMPIKACADKLKKEIEQFGCPPVFPVIEEKPIQEVTTAVKEDPLSFKSKKTKAVAKSGGAVYQWKIMQSLGISDEEIPMFADSAYWLNYFPPHCESDLKLLGVGVDWRRSFITTDVNGYYDSFVRWQFESLKALGKVKYGKRYSIWSTIDDQQCADHERAQGEGVGPQNYTLIKLEVVEPIPECLKEIHSQGKKIYLVPGTLRPETMYGQTNCWILPTGKYGAFEMANGDIFVCTERSARNMSYQQMTTGK-GEYKCLAKFEGSDILGAALKAPLAINPIVYVLPMLTIDENKGTGVVTSVPSDSPDDYASLQDLKAKAPLRAKFSIKDEWVLPFEVVPIIDIPGYSNESAVRAYKDLGIKSQNDRALLDQAKDLCYQKGFNDGVMSVGPYAGRKVSEVKKIIKDEMVASGQAVDYSEPTSKVVSRSGDECVVALSDQWYINYGDDDIEWKNQTIKQLESMEFYSAETKKKFEIALGWMNQWACSRSFGLGTHLPWDEKFLIESLSDSTIYMAFYTVAHLLQGDVNGSKPG--SAGITPKQMTSACWDYVL------MGKPYPEGCEVSEEKLKELKKEFTYWYPVDIRVSGADLIQNHLTFFLYTHAAIFEK---KFQPKSIRANGFVNLNGEKMSKSTGNFLTLVDSVAKFSADGTRVALADAGDSIEDANFVDQTAVTSLLKLHTQIQWVQETLDSIDKFRSGPLDRIQDTIFESEINNIIVESEKAYQKTNFRDALHLVFFDLQNARDHYKVTTLDQMHKDLVLRFIEVQALLIYPIAPHFAQKLF-NMLGK-GNILSAGWPKAGAIDYEALKKNNYVQQTIYNFRMKLQVYQKAKLKGKPAGTKAIPDQSTIIVSKSYPKWQQDVLEYLATIYNEDSKSFTKDNNAIAEELLSREEMKPHKKNLMGFVASAIQNVKESGKDA--LQTSLSFDETSTLTDNIDYICKTLEL 1027          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A2Y9E0T2 (leucine--tRNA ligase, cytoplasmic OS=Trichechus manatus latirostris OX=127582 GN=LOC101349569 PE=3 SV=1)

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 620/1199 (51.71%), Postives = 824/1199 (68.72%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVA-IEEKTE--INLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLID-MSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVAD-KISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            RKGTAK++ +K IE   Q++W+  KVFE N   +  +  K+KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK+ L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E     I  KTE  I  +K KGKKSKA AK+G  KYQW IMR  G++DEEI KF+E ++W+ Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLI++K+ +PYP  L  +K  ++FLVAATLRPETM+GQTNCW+ P ++Y+  ++    + IC +RAARNMAYQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD AALRDLK+K+  R+ Y I D  VLPFEPV VI++P +G   AV   +E KI+SQND +KL EAKEK Y  GFY G +++ ++ G  VQ  K+ IQ  +I  G A  Y EPE+QV+SRS  ECVVALCDQWYL+Y +E WK  T  CL  + TF +E RRNFEA L+ L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMA+YTVAH+LQGG+L G+ G +   I    MT D W+Y+   +        P+   KLD L++EF +WYPVDLRVSGKDLVPNHL+YYL+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT+++AI+K+SADGMRMA ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP S  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H +L+  F+E+Q L+L+P CPH+ ++IWT +L KP SIM  SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK+YPPWQ + L  L +      GKLPDNK + S L+  PELKK MKK M  +  I+    +    V  L+  E DE++V+  N  Y+  +L L+   +E+K++ E  D K+ + CCP +P   F       ++ P  +                V++VNP   SG  S +IEI  GD+  ++ RR+      I+D + V+L  F D     R IP+  +   +  PI  +A F V  +   I  + NG+   IG+
Sbjct:    4 RKGTAKVDFLKKIEKEIQQKWDAEKVFEVNASDLEKQSSKSKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIKACADKLKREIELYGCPPEFPDEEEEEEEINVKTEDIIIKDKAKGKKSKATAKAGSSKYQWGIMRSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIRLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETVTGDIFICTQRAARNMAYQGFTKDD-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEVPGFGSLSAVTICDELKIQSQNDREKLAEAKEKLYLKGFYDGVMLVDEFKGEKVQDVKKTIQKKMIDMGDAFIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRNFEATLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQ-GESPLDIRPQQMTKDVWDYIFFKEAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDK-WPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRMALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRELVFWFIEVQTLLLTPFCPHLCEHIWT-LLGKPGSIMKASWPVAGPVDEALIRSSQYLMEVAHDLRLRLKNYMMPARGKKTDKQPPQRPSHCTIYVAKNYPPWQHTTLSVLRNHFEANSGKLPDNKVIASELANLPELKKYMKKVMPFVAMIKENLEKLGPRVLDLQL-EFDEQAVLMENIVYLTNSLELE--HIEVKFASEAED-KVKEDCCPGKPLNVF-------RTEPGVL----------------VSLVNPQPSSGHFSTKIEIRQGDNHDSIIRRLMKMDRGIKDLSRVKLMRFDDPLLGPRQIPVLGKEYSEKTPISEHAVFHVDLTSKKIHLTENGLKADIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A2J7PZ40 (Leucine--tRNA ligase, cytoplasmic OS=Cryptotermes secundus OX=105785 GN=Lars PE=3 SV=1)

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 602/1203 (50.04%), Postives = 802/1203 (66.67%), Query Frame = 3
Query:  165 MNRKGTAKLNTIKDIEVAKQKEWENNKVFEAN-PIYGKDKKN-KYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEE-KTEINLNXXXXXXXXXXXXXXGF-KYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDD-VFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHG--VLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRE-TCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEF----------RXXXXXXXXXXXXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDEC-SDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATF--SVSKSGISFSVNGVAHRIG 3710
            ++RKGT K+  ++ IE   Q  WE  K++E + P+  K   + K+F TFP+PYMNG LHLGH FSLSKCEF+  Y+RLKGK  L+ FGFHCTGMPIK+ +DKLKREME FGFPP FP     V  EE K +  +      K        G  KYQWQIM+  G+ D+EIKKF +  +W+ ++PPL + +++R+GI VDWRR+FITTD+NPF+D FVRWQFL+LK  NK+M+GKR T+FSP DNQPCMDHDRS+GEGVGPQEYTLIKMKL +P+   L  +K   VFLVAATLRPETMYGQTNCW+ P ++Y+A  +T     V IC  R+ARNMAYQ   T + G++ +L +  G+++MG ALQAPLT+   IYTLPM +IK++KGTG+VTSVPSDSPDDYAAL DLK+K+  R  Y IED  VLPFEP+ +ID+P+YG   AV   E+ KI+SQND DKL EAK+  Y  GFY G +++G + G  VQ  K+ +Q  LI    A+ Y EPE+Q+ISRSG ECVVALCDQWYL+Y +E+WK+     LN++NT+ +EV++NF A L  LHEYACSR+YGLGT++PWDE++L+ESLSDSTIYMA+YTVAH+LQGG+ +G +  NS GI    MTP+ W Y+   D     N N      LD +RREF YWYPVDLR SGKDL+ NHLT++++NHCA+WP++  + WP  IRANGHLLLN+ KMSKS GNFLT+SEA+EK+SADGMR   AD+GDS+EDANFVE  ADAG+LRLY+FIEWVKE+   K   R GP    +D VF++ IN  I ET+ NY++M++K  L+ GF E Q+ RD+YRE T +   H DL+  F+++Q L+LSP+CPH+ +++W ++L +  SI++E WPI G +DE L     YL   +H F          RK +        SE+ N A IW+AK +P WQ ++L +L  + DK   LPDNK + S LS+ PELKK MK+ M   Q+ R K +        L T E DE  V+  +  Y+  T  LD+  +ELKYSD   + E++ + CCP  P I F V              P ++M          T++NP   SG  +H + + DGD+   +  ++     + D  +++L+ + D +   R +P      + +  I+ NA F  +V+K  I  +VNG  + +G
Sbjct:    5 LDRKGTFKVEYLRKIEQDVQARWEEEKIYEVDAPVEPKKSLDEKFFCTFPFPYMNGRLHLGHTFSLSKCEFAARYQRLKGKRVLFPFGFHCTGMPIKACSDKLKREMEEFGFPPEFPATAFEVEPEESKADAVVKDKSKGKKSKAVAKSGSGKYQWQIMQSLGLCDDEIKKFADASHWLDHFPPLAVKDLRRIGIHVDWRRTFITTDSNPFFDQFVRWQFLQLKARNKVMYGKRYTVFSPRDNQPCMDHDRSTGEGVGPQEYTLIKMKLLEPFTSKLSSLKGKPVFLVAATLRPETMYGQTNCWVRPDLQYIAFSTTTGPGEVFICTRRSARNMAYQG-FTREEGKLDVLLELTGQDIMGVALQAPLTSNTKIYTLPMLTIKEDKGTGVVTSVPSDSPDDYAALLDLKKKQALREKYGIEDEMVLPFEPIPIIDVPDYGSLSAVTLYEKLKIQSQNDKDKLQEAKDLIYLKGFYDGVMLVGDFKGKKVQDVKKALQKQLIDKYEAVTYYEPEKQIISRSGDECVVALCDQWYLDYGEERWKAQAVKVLNRMNTYHEEVKKNFMATLNWLHEYACSRTYGLGTKLPWDEKWLIESLSDSTIYMAFYTVAHLLQGGTFNG-NKTNSFGIKAEQMTPEVWNYIFYKDAEFPANTNIS-KASLDVMRREFEYWYPVDLRCSGKDLIQNHLTFFIYNHCALWPDDESK-WPLGIRANGHLLLNSAKMSKSEGNFLTLSEAVEKFSADGMRFCLADSGDSVEDANFVESTADAGILRLYTFIEWVKEVQNLKATFRVGPADTFNDKVFSSEINLKIRETDDNYQKMLFKEALRTGFFELQASRDKYRELTLVEGMHKDLVIRFIKVQALLLSPVCPHVAEHVW-ELLGEKRSILHEQWPIAGPIDEVLVKSSCYLMEAAHMFRIFLKNHMQPRKSNKVTVSGSVSEKPNQATIWVAKKFPSWQATVLMTLKQLLDKTAYLPDNKVIASELSKKPELKKYMKRVMPFAQATREKIDTVGVQALNL-TLEFDELEVLSRSIVYLKST--LDVESIELKYSDSAEATERIREDCCPGIPYIAFTV-------------CPSMSM----------TLINPQPQSGHFTHVVSVRDGDNVAKLTAQLTRADQLIDPNSIQLWRYDDPELGPRKMPAFNSPTQGVVRIEDNAVFCVNVAKKNIELAVNGTRYPVG 1176          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A481ADW1 (Leucine--tRNA ligase, cytoplasmic OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 608/1202 (50.58%), Postives = 820/1202 (68.22%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVA-IEEKTE-INLNXXXXXXXXXXXXXXGF-KYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQ---MSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            RKGT K++ +K IE   Q++W+  KVFE N   +  +  K+KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E     I  KTE I L      K    +   G  KYQW IM+  G++DEEI KF+E ++W++Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIK+K+ +PYP  L  +K  +VFLVAATLRPETM+GQTNCW+HP I+Y+  ++    + IC  RAARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD+AA RDLK+K+  R+ Y I D  VLPFEPV +I+IP +G+  AV   +E K++SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ I++ +I +G A  Y EPE+QV+SRS  ECVVALCDQWYL+Y +E+WK  T  CL  + TF +E RRNFEA L+ L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMA+YT AH+LQGG + G++  +  GI    MT + W+Y+   +        P+   KLD L++EF +WYPVDLRVSGKDL+PNHL+Y+L+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT++EA++KYSADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP +  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK YP WQ   +S+L S  + S   GKLPDNK + S L   PELKK MKK M  +  I+    +    V  L+  E DE++V+  N  Y+  +L L+  ++E+K++ E  D K+ + CCP +P   F       ++ P  +                V++VNP  FSG  S +IEI  GD+  +V RR+   D+  I+D + V+L  F D     R +P+  +   +  PI   A F V  +   +  + NG+   IG+
Sbjct:    4 RKGTTKVDFLKKIEKEIQQKWDTEKVFEVNASNLEKQTSKDKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKTCLYPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEEINAKTEDIILKDKAKGKKSKASAKTGSSKYQWDIMKSLGLSDEEIVKFSEAEHWLEYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKLKVLEPYPCKLSGLKGKNVFLVAATLRPETMFGQTNCWVHPEIKYIGFETVNGDIFICTPRAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDFAAFRDLKKKQALRAKYGIRDDMVLPFEPVPIIEIPGFGKLSAVTLCDELKVQSQNDREKLAEAKEKLYLKGFYDGIMLVDGFEGQKVQDVKKSIRNRMIDTGDAYAYMEPEKQVMSRSSDECVVALCDQWYLDYGEEKWKEQTCQCLKNLETFCEETRRNFEATLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAFYTAAHLLQGGDIRGQAE-SPLGIRPQQMTKEVWDYIFFKEAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRVSGKDLIPNHLSYFLYNHVAMWPEESDK-WPVAVRANGHLLLNSEKMSKSTGNFLTLTEALDKYSADGMRLALADAGDTVEDANFVEAMADAGVLRLYTWVEWVKEMVANWDSLRSGPANTFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMTPAKGKKPDKQPPQKPSHCTIYVAKDYPSWQHVTLSVLRSHFETSS--GKLPDNKVIASELGNLPELKKYMKKVMPFVAMIKENLEKTGPRVLDLQL-EFDEQAVLMENIVYLTNSLELE--RIEVKFASEAED-KVREDCCPGKPLNVF-------RTEPGVL----------------VSLVNPQPFSGHFSAKIEIRQGDNRDSVIRRLMKVDR-GIKDLSKVKLMRFDDPLLGPRRVPVLGKEHTEKTPISEQAVFHVDLTSKKVHLTENGLRADIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A481AHZ8 (Leucine--tRNA ligase, cytoplasmic OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 608/1202 (50.58%), Postives = 820/1202 (68.22%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVA-IEEKTE-INLNXXXXXXXXXXXXXXGF-KYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQ---MSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            RKGT K++ +K IE   Q++W+  KVFE N   +  +  K+KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E     I  KTE I L      K    +   G  KYQW IM+  G++DEEI KF+E ++W++Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIK+K+ +PYP  L  +K  +VFLVAATLRPETM+GQTNCW+HP I+Y+  ++    + IC  RAARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD+AA RDLK+K+  R+ Y I D  VLPFEPV +I+IP +G+  AV   +E K++SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ I++ +I +G A  Y EPE+QV+SRS  ECVVALCDQWYL+Y +E+WK  T  CL  + TF +E RRNFEA L+ L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMA+YT AH+LQGG + G++  +  GI    MT + W+Y+   +        P+   KLD L++EF +WYPVDLRVSGKDL+PNHL+Y+L+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT++EA++KYSADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP +  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK YP WQ   +S+L S  + S   GKLPDNK + S L   PELKK MKK M  +  I+    +    V  L+  E DE++V+  N  Y+  +L L+  ++E+K++ E  D K+ + CCP +P   F       ++ P  +                V++VNP  FSG  S +IEI  GD+  +V RR+   D+  I+D + V+L  F D     R +P+  +   +  PI   A F V  +   +  + NG+   IG+
Sbjct:    4 RKGTTKVDFLKKIEKEIQQKWDTEKVFEVNASDLEKQTSKDKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKTCLYPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEEINAKTEDIILKDKAKGKKSKASAKTGSSKYQWDIMKSLGLSDEEIVKFSEAEHWLEYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKLKVLEPYPCKLSGLKGKNVFLVAATLRPETMFGQTNCWVHPEIKYIGFETVNGDIFICTPRAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDFAAFRDLKKKQALRAKYGIRDDMVLPFEPVPIIEIPGFGKLSAVTLCDELKVQSQNDREKLAEAKEKLYLKGFYDGIMLVDGFEGQKVQDVKKSIRNRMIDTGDAYAYMEPEKQVMSRSSDECVVALCDQWYLDYGEEKWKEQTCQCLKNLETFCEETRRNFEATLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAFYTAAHLLQGGDIRGQAE-SPLGIRPQQMTKEVWDYIFFKEAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRVSGKDLIPNHLSYFLYNHVAMWPEESDK-WPVAVRANGHLLLNSEKMSKSTGNFLTLTEALDKYSADGMRLALADAGDTVEDANFVEAMADAGVLRLYTWVEWVKEMVANWDSLRSGPANTFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMTPAKGKKPDKQPPQKPSHCTIYVAKDYPSWQHVTLSVLRSHFETSS--GKLPDNKVIASELGNLPELKKYMKKVMPFVAMIKENLEKTGPRVLDLQL-EFDEQAVLMENIVYLTNSLELE--RIEVKFASEAED-KVREDCCPGKPLNVF-------RTEPGVL----------------VSLVNPQPFSGHFSAKIEIRQGDNRDSVIRRLMKVDR-GIKDLSKVKLMRFDDPLLGPRRVPVLGKEHTEKTPISEQAVFHVDLTSKKVHLTENGLRADIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A480JIP6 (Leucine--tRNA ligase, cytoplasmic OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 608/1202 (50.58%), Postives = 820/1202 (68.22%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP--IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVA-IEEKTE-INLNXXXXXXXXXXXXXXGF-KYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQ---MSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSV--SKSGISFSVNGVAHRIGE 3713
            RKGT K++ +K IE   Q++W+  KVFE N   +  +  K+KYFVTFPYPYMNG LHLGH FSLSKCEF++GY+RLKGK  L+ FG HCTGMPIK+ ADKLKRE+E +G PP FP+ E     I  KTE I L      K    +   G  KYQW IM+  G++DEEI KF+E ++W++Y+PPL I ++KR+G+KVDWRRSFITTD NP+YDSFVRWQFL L++ NKI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIK+K+ +PYP  L  +K  +VFLVAATLRPETM+GQTNCW+HP I+Y+  ++    + IC  RAARNM+YQ    D  G V ++ + +G+E++G +L APLT+YK IY LPM +IK++KGTG+VTSVPSDSPDD+AA RDLK+K+  R+ Y I D  VLPFEPV +I+IP +G+  AV   +E K++SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ I++ +I +G A  Y EPE+QV+SRS  ECVVALCDQWYL+Y +E+WK  T  CL  + TF +E RRNFEA L+ L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMA+YT AH+LQGG + G++  +  GI    MT + W+Y+   +        P+   KLD L++EF +WYPVDLRVSGKDL+PNHL+Y+L+NH A+WPE SD+ WP  +RANGHLLLN+EKMSKSTGNFLT++EA++KYSADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE+V +  ++R+GP +  +D VFA+ +N  I +T+ NY++MM+K  L+ GF EFQ+ +D+YRE  +   H DL+  F+E+Q L+L+P CPH+ ++IWT +L KP SIMN SWP+ G VDE L    +YL  ++H+ R +          ++ +           I++AK YP WQ   +S+L S  + S   GKLPDNK + S L   PELKK MKK M  +  I+    +    V  L+  E DE++V+  N  Y+  +L L+  ++E+K++ E  D K+ + CCP +P   F       ++ P  +                V++VNP  FSG  S +IEI  GD+  +V RR+   D+  I+D + V+L  F D     R +P+  +   +  PI   A F V  +   +  + NG+   IG+
Sbjct:    4 RKGTTKVDFLKKIEKEIQQKWDTEKVFEVNASNLEKQTSKDKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKTCLYPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEEINAKTEDIILKDKAKGKKSKASAKTGSSKYQWDIMKSLGLSDEEIVKFSEAEHWLEYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKLKVLEPYPCKLSGLKGKNVFLVAATLRPETMFGQTNCWVHPEIKYIGFETVNGDIFICTPRAARNMSYQGFTKDN-GVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDFAAFRDLKKKQALRAKYGIRDDMVLPFEPVPIIEIPGFGKLSAVTMCDELKVQSQNDREKLAEAKEKLYLKGFYDGIMLVDGFEGQKVQDVKKSIRNRMIDTGDAYAYMEPEKQVMSRSSDECVVALCDQWYLDYGEEKWKEQTCQCLKNLETFCEETRRNFEATLDWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAFYTAAHLLQGGDIRGQAE-SPLGIRPQQMTKEVWDYIFFKEAPFPKTQIPK--EKLDQLKQEFEFWYPVDLRVSGKDLIPNHLSYFLYNHVAMWPEESDK-WPVAVRANGHLLLNSEKMSKSTGNFLTLTEALDKYSADGMRLALADAGDTVEDANFVEAMADAGVLRLYTWVEWVKEMVANWDSLRSGPANTFNDRVFASEMNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAIEGMHRDLVFRFIEVQTLLLAPFCPHLCEHIWT-LLGKPDSIMNASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMTPAKGKKPDKQPPQKPSHCTIYVAKDYPSWQHVTLSVLRSHFETSS--GKLPDNKVIASELGNLPELKKYMKKVMPFVAMIKENLEKTGPRVLDLQL-EFDEQAVLMENIVYLTNSLELE--RIEVKFASEAED-KVREDCCPGKPLNVF-------RTEPGVL----------------VSLVNPQPFSGHFSAKIEIRQGDNRDSVIRRLMKVDR-GIKDLSKVKLMRFDDPLLGPRRVPVLGKEHTEKTPISEQAVFHVDLTSKKVHLTENGLRADIGD 1169          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: lars1b (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103037167])

HSP 1 Score: 1174.07 bits (3036), Expect = 0.000e+0
Identity = 612/1203 (50.87%), Postives = 817/1203 (67.91%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDK---KNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEIN-----LNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNP-ELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHN--------AAIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKI-SIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            RKGTAKL+ ++ IE   Q++WE  K FE + +   ++   KNKYFVTFPYPYMNG LHLGH F LSKCEFSMGY+RLKGK  L+ FG HCTGMPIK+ ADKLKREME +G PP FP+ E   A EEK + N      +K KGKKSKA AK+GG K+QW IM+  G+ D++I KF   ++W++Y+PPL + ++K++G+KVDWRRSFITTD NPFYDSFVRWQFL LK+  KI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +PYP  L  +K ++VFLVAATLRPETM+GQTNCW+ P ++Y+A ++    V I  +R+ARNMAYQ   T + G V ++ + +G++++GCAL APLT+YKTIY LPM +IK++KGTG+VTSVPSD+PDD AALRD+K+K+  R  Y IED+ VLPFEPV +I+IP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  ++  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y D++WK    + L  + TF DE R+NFEA L  L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMAYYTVAH+LQGG L+G+ G +  GI    MT + W+Y+            P E + KL G   EF YWYPVD R+SGKDLVPNHL+YYL+NH A+WPE+S + WPK +RANGHLLLN+EKMSKSTGNFLT+S+AI K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ ++ N+RTGP    +D VF + +N  I +TE +Y++MMYK  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ +Y WT +L K  S+M  SWP+ G VDE L    +YL   +H+ R +     +   +++ +           +++AKSYPPWQ S L  L        G LPDNK +   L   PELKK MK+ M  +  I+    +    V  L+  E DE++V+  N  Y+  +L LD  ++++ ++ E +DEK+ + CCP +P   F         + P V               +V+++NP   +G  S  I+I  GDS  ++ RR++     I+D + V+L  F D     R +P+  +  +   P+   + F +S  +  +  S NG+   IG+
Sbjct:    4 RKGTAKLDFLRKIEQDIQQKWEKEKAFECDALTTAEEIKNKNKYFVTFPYPYMNGRLHLGHTFCLSKCEFSMGYQRLKGKRCLFPFGLHCTGMPIKACADKLKREMELYGTPPQFPDEEEDGA-EEKPKTNDEIIIKDKAKGKKSKAAAKAGGSKFQWDIMKSLGLPDKDIVKFANAEHWLEYFPPLAVEDLKKMGVKVDWRRSFITTDVNPFYDSFVRWQFLTLKERKKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKMKIVEPYPAKLSDLKGNNVFLVAATLRPETMFGQTNCWVRPDMKYIAFETANGDVFISTQRSARNMAYQG-FTKENGVVPVVKQIMGQDILGCALSAPLTSYKTIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDIKKKQALREKYGIEDHMVLPFEPVPIIEIPGYGNLSAPVVCDELKIQSQNDREKLAEAKEKVYLKGFYEGIMLVDGFKGQKVQDVKKPIQKMMVEKGEALIYMEPEKQVMSRSADECVVALCDQWYLDYGDKEWKQQAVNVLEPMETFCDETRKNFEATLAWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAYYTVAHLLQGGVLNGQ-GSSPLGIRPEQMTREVWDYIFFKTAPFPKTTIPKECLQKLKG---EFEYWYPVDARISGKDLVPNHLSYYLYNHVAMWPEDSGK-WPKAVRANGHLLLNSEKMSKSTGNFLTLSQAINKFSADGMRLALADAGDTVEDANFVETMADAGILRLYTWVEWVKEMIANQNNLRTGPADTFNDRVFVSEMNSGIVKTEQHYERMMYKEALKSGFFEFQAAKDKYRELAIEGMHRDLVFKFIENQTLLLAPICPHLCEYTWT-LLGKTGSLMKASWPVAGPVDEILIRSSQYLMETAHDLRLRLKAYLQPPKNKKGDNRPPGKPSHCTVYVAKSYPPWQHSALSLLGKHYKSNNGTLPDNKVIAMELGAMPELKKYMKRVMPFVAMIKDNLEKNGPRVLDLEL-EFDERAVLLENIVYLTNSLELD--QIDVLFASE-ADEKVKEDCCPGKPFSVF--------RSEPGV---------------SVSLLNPQPSNGLFSTRIDIRQGDSKDSIIRRLSKTSRGIKDLSKVKLMRFEDPVLGPRRVPVLGKEEQGKLPVSDKSVFHISLEEKKVHLSDNGLKVDIGD 1171          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: lars1b (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103037167])

HSP 1 Score: 1174.07 bits (3036), Expect = 0.000e+0
Identity = 612/1203 (50.87%), Postives = 817/1203 (67.91%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDK---KNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEIN-----LNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNP-ELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHN--------AAIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKI-SIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            RKGTAKL+ ++ IE   Q++WE  K FE + +   ++   KNKYFVTFPYPYMNG LHLGH F LSKCEFSMGY+RLKGK  L+ FG HCTGMPIK+ ADKLKREME +G PP FP+ E   A EEK + N      +K KGKKSKA AK+GG K+QW IM+  G+ D++I KF   ++W++Y+PPL + ++K++G+KVDWRRSFITTD NPFYDSFVRWQFL LK+  KI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +PYP  L  +K ++VFLVAATLRPETM+GQTNCW+ P ++Y+A ++    V I  +R+ARNMAYQ   T + G V ++ + +G++++GCAL APLT+YKTIY LPM +IK++KGTG+VTSVPSD+PDD AALRD+K+K+  R  Y IED+ VLPFEPV +I+IP YG   A    +E KI+SQND +KL EAKEK Y  GFY G +++  + G  VQ  K+ IQ  ++  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y D++WK    + L  + TF DE R+NFEA L  L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMAYYTVAH+LQGG L+G+ G +  GI    MT + W+Y+            P E + KL G   EF YWYPVD R+SGKDLVPNHL+YYL+NH A+WPE+S + WPK +RANGHLLLN+EKMSKSTGNFLT+S+AI K+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ ++ N+RTGP    +D VF + +N  I +TE +Y++MMYK  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ +Y WT +L K  S+M  SWP+ G VDE L    +YL   +H+ R +     +   +++ +           +++AKSYPPWQ S L  L        G LPDNK +   L   PELKK MK+ M  +  I+    +    V  L+  E DE++V+  N  Y+  +L LD  ++++ ++ E +DEK+ + CCP +P   F         + P V               +V+++NP   +G  S  I+I  GDS  ++ RR++     I+D + V+L  F D     R +P+  +  +   P+   + F +S  +  +  S NG+   IG+
Sbjct:    4 RKGTAKLDFLRKIEQDIQQKWEKEKAFECDALTTAEEIKNKNKYFVTFPYPYMNGRLHLGHTFCLSKCEFSMGYQRLKGKRCLFPFGLHCTGMPIKACADKLKREMELYGTPPQFPDEEEDGA-EEKPKTNDEIIIKDKAKGKKSKAAAKAGGSKFQWDIMKSLGLPDKDIVKFANAEHWLEYFPPLAVEDLKKMGVKVDWRRSFITTDVNPFYDSFVRWQFLTLKERKKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKMKIVEPYPAKLSDLKGNNVFLVAATLRPETMFGQTNCWVRPDMKYIAFETANGDVFISTQRSARNMAYQG-FTKENGVVPVVKQIMGQDILGCALSAPLTSYKTIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDIKKKQALREKYGIEDHMVLPFEPVPIIEIPGYGNLSAPVVCDELKIQSQNDREKLAEAKEKVYLKGFYEGIMLVDGFKGQKVQDVKKPIQKMMVEKGEALIYMEPEKQVMSRSADECVVALCDQWYLDYGDKEWKQQAVNVLEPMETFCDETRKNFEATLAWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAYYTVAHLLQGGVLNGQ-GSSPLGIRPEQMTREVWDYIFFKTAPFPKTTIPKECLQKLKG---EFEYWYPVDARISGKDLVPNHLSYYLYNHVAMWPEDSGK-WPKAVRANGHLLLNSEKMSKSTGNFLTLSQAINKFSADGMRLALADAGDTVEDANFVETMADAGILRLYTWVEWVKEMIANQNNLRTGPADTFNDRVFVSEMNSGIVKTEQHYERMMYKEALKSGFFEFQAAKDKYRELAIEGMHRDLVFKFIENQTLLLAPICPHLCEYTWT-LLGKTGSLMKASWPVAGPVDEILIRSSQYLMETAHDLRLRLKAYLQPPKNKKGDNRPPGKPSHCTVYVAKSYPPWQHSALSLLGKHYKSNNGTLPDNKVIAMELGAMPELKKYMKRVMPFVAMIKDNLEKNGPRVLDLEL-EFDERAVLLENIVYLTNSLELD--QIDVLFASE-ADEKVKEDCCPGKPFSVF--------RSEPGV---------------SVSLLNPQPSNGLFSTRIDIRQGDSKDSIIRRLSKTSRGIKDLSKVKLMRFEDPVLGPRRVPVLGKEEQGKLPVSDKSVFHISLEEKKVHLSDNGLKVDIGD 1171          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005898.1 (pep scaffold:Pmarinus_7.0:GL480199:186:9945:1 gene:ENSPMAG00000005301.1 transcript:ENSPMAT00000005898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 485.337 bits (1248), Expect = 5.250e-158
Identity = 261/630 (41.43%), Postives = 386/630 (61.27%), Query Frame = 3
Query: 1881 LGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNES-WPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA---------AIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRV--ADK-ISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVSKS------GISFSVNGVAHRIGE 3713
            +GTR+PWDE++L+ESLSDSTIYMA+YTV H+LQGG+LDG  GV+  GI   DM+   W+YVL  D  V  ++  +   KLD LRREF +WYP+DLRVSGKDLVPNHLTYYL+NH A+WP++S+  WP+ +RANGHLLLN+EKMSKSTGNFLT+SEAI K+SADGMR+A ADAGD++EDANFVE +A++G+LRL++++EW +++++S    R GP S  +D VF + +N  + +TE  Y++MM+K  L+ GF EFQ+ RDRYRE  +   + DL+  F+E+Q L+L+P+CPH+ +++W  +L KP S++ E+ WP+    DE L     Y+   +H+ R +      S  S   +           I ++AK+YPPWQ   L +L       GKLPDNK ++  L   PELKK +K+ M  +  I+     +      L+  E DE++V+  N  Y+  TL +D  ++ + ++ E +++++ D C P +P + F V         P V               +V +VN +L +G  S  + + DGD    + RR+  +D+ I +   + V L  ++D     R IP     M    PI R+A F ++ +      GI  S+ G +H +G+
Sbjct:    1 VGTRLPWDERWLIESLSDSTIYMAFYTVCHLLQGGTLDGH-GVSPLGIRPEDMSCAVWDYVLFPDAPVPDSVISK--EKLDLLRREFQFWYPMDLRVSGKDLVPNHLTYYLYNHVAMWPKHSEM-WPRAVRANGHLLLNSEKMSKSTGNFLTLSEAISKFSADGMRLALADAGDTVEDANFVESVAESGVLRLHAWVEWARDVLQSPHGQRLGPASSFNDRVFISEMNAGVHKTEKLYEKMMFKEALKTGFFEFQACRDRYRELALDGMNRDLLLRFIELQTLLLAPVCPHVCEHVW-GLLGKPGSVVREARWPVVDAPDEILLRSAEYMREATHDARIRLKVSLASTHSRSPSPLQPHRPPSHCIFYVAKNYPPWQHVTLTTLQRHYQANGKLPDNKQISVELGAKPELKKHLKRVMPFVVMIKDNLERQGPRALDLQL-EFDERAVLMENITYLTTTLEVD--EVRVLFASE-AEQRIRDECRPGKPHVNFYV--------EPGV---------------SVMLVNHELSNGHFSTRVTVHDGDCTDRIIRRLMKSDRGIKMPVLSQVSLLRYLDPNMGPRTIPHLGSPMHGTAPIPRDALFHITGTPSDGGCGIRVSIGGESHEVGD 598          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000019.1 (pep scaffold:Pmarinus_7.0:GL486658:1337:8958:-1 gene:ENSPMAG00000000017.1 transcript:ENSPMAT00000000019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 336.65 bits (862), Expect = 1.090e-106
Identity = 164/283 (57.95%), Postives = 202/283 (71.38%), Query Frame = 3
Query:  891 MDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIK-DDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQW 1736
            MDHDR +GEGVGPQEYTLIKMKL +P+P  L  +  + VFLVAATLRPETM+GQTNCW+ P + YVA ++    V +C  RAARNM+YQ   T   G V  L++  G +LMG AL APL ++  IYTLPM ++K++KGTG+VTSVPSDSPDD AALRDLKRK   R  Y I D  VLPFEPV +I++P  G   AV  ++E  I SQN+ D+L  AKE+ Y  GFY G +++  Y G  VQ  K++IQ  LI+ G A+ Y EPERQV+SRSG ECVVALCDQW
Sbjct:    1 MDHDRQTGEGVGPQEYTLIKMKLLEPFPAKLSHLAGESVFLVAATLRPETMFGQTNCWLGPDVRYVAFRTACGSVFVCTARAARNMSYQG-FTTADGHVDKLAQLTGVDLMGAALSAPLCSFPVIYTLPMLTVKEDKGTGVVTSVPSDSPDDIAALRDLKRKSALREKYGITDAMVLPFEPVPIIEVPGLGPLAAVTVLDEMGISSQNERDRLALAKERVYLKGFYEGVMLVAGYEGCRVQDVKKVIQGKLISDGHAVLYMEPERQVMSRSGDECVVALCDQW 282          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: mars2 (methionyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-111201-1])

HSP 1 Score: 53.5286 bits (127), Expect = 2.927e-7
Identity = 36/108 (33.33%), Postives = 51/108 (47.22%), Query Frame = 3
Query: 2148 WYPVDLRVSGKDLVPNHLTYYLFNHCAIWPE---NSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANF----VEDMADAGL 2450
            W+P DL V GKD++  H  Y        WP     +    P+ +  + H  +   KMSKS GN +  +E I +YSADG+R      G    D ++    VE M +A L
Sbjct:  254 WWPCDLHVLGKDILKFHALY--------WPAFLMAAGLEPPRRLLVHSHWTVAGRKMSKSLGNSVDPNEDINRYSADGLRYFLLRQGVPESDGDYYPEKVEKMLNAEL 353          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: mars2 (methionyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-111201-1])

HSP 1 Score: 53.1434 bits (126), Expect = 3.141e-7
Identity = 36/105 (34.29%), Postives = 51/105 (48.57%), Query Frame = 3
Query: 2148 WYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANF----VEDMADAGL 2450
            W+P DL V GKD++  H  Y+     A   E      P+ +  + H  +   KMSKS GN +  +E I +YSADG+R      G    D ++    VE M +A L
Sbjct:  288 WWPCDLHVLGKDILKFHALYWPAFLMAAGLEP-----PRRLLVHSHWTVAGRKMSKSLGNSVDPNEDINRYSADGLRYFLLRQGVPESDGDYYPEKVEKMLNAEL 387          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: CDC60 (Cytosolic leucyl tRNA synthetase; ligates leucine to the appropriate tRNA; human homolog LARS can complement yeast temperature-sensitive mutant at restrictive temperature [Source:SGD;Acc:S000006081])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 443/1058 (41.87%), Postives = 620/1058 (58.60%), Query Frame = 3
Query:  180 TAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKK------------NKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFG----FPPVFPEIETPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIK---MKLEKPYPQCLEQIKD-----DVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLP----FEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGK-VDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHN-------AAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVK-CNERSENV--SRLKTPEIDEKSVIESNFRYMAKTLNL 3236
            TA+ + +  IE   QK W     FE +    +D+              K+  +  YPYMNG +H GH F+LSK EFS+G+ER+ GK AL+  GFHCTGMPI + ADKLKRE E FG      P   E        EK   ++ K K KKSKA AK G  KYQ++IM   G+  EEI KF +  YW+ Y+PPL  ++   LG ++DWRRSF+TTDANP+YD+F+RWQ  KLK   KI FG+R TI+S  D Q CMDHDR SGEGV PQEY  +K   ++      + ++   D       + VAATLRPETMYGQT C++ PTIEY  +        I  ERA +NM+YQ+ LT + G    +    GK  +G  + AP + Y  +  LPM ++   KGTG+VT VPS+SPDDY   +DL        L+K E Y + P     E V ++   +YG   A   VEE KI+S  D + L EAK+  YK  +Y+G +I G Y G  V++AK  +++D+I +G A  Y+EPE QV+SRSG +C+V+L DQWY++Y +E WK     CL  +  F+ EV+  FE  L+ L  +A  R+YGLGTR+PWDE+YLVESLSDSTIY ++YT+AH+L         G    GI+   MT + ++Y+      V     P  +  L  LRREF Y+YP+D+ +SGKDL+PNHLT++++ H A++P+   ++WPK IRANGHL+LNN KMSKSTGNF+T+ + +EK+ AD  R+AFADAGD++EDANF E  A+A +LRL++  EW +EI + + N+RTG ++   D+ F + +N  IE+T   Y    YK  L+ G  +FQ+ RD YRE   G  H DLI  ++E Q L+L+PI PH  +YI+ ++L   +S+ N  +P   K VD+ +     YL  +    R+   Q  K K  +             + I++S+P WQ   ++ ++     E  L DNK +   +       K MK+AM  I  ++ +  NE+ E+V    L+  EID       N +  A+ L +
Sbjct:   10 TARRDALIAIEKKYQKIWAEEHQFEIDAPSIEDEPITMDSEELHRTYPKFMSSMAYPYMNGVMHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADKLKREAELFGKNFDNVPAEEEEIKEETPAEKDHEDVTKFKAKKSKAAAKKGRGKYQFEIMLQLGIPREEIIKFADAKYWLTYFPPLCESDCTSLGARIDWRRSFVTTDANPYYDAFIRWQMNKLKAAGKIKFGERYTIYSEKDGQACMDHDRQSGEGVTPQEYIGVKIEALEFADDAAKIIDSSSDLDKSKKFYFVAATLRPETMYGQTCCFVSPTIEY-GIFDAGDSYFITTERAFKNMSYQK-LTPKRGFYKPIVTVPGKAFIGTKIHAPQSVYPELRILPMETVIATKGTGVVTCVPSNSPDDYITTKDL--------LHKPEYYGIKPEWIDHEIVPIMHTEKYGDLTAKAIVEEKKIQSPKDKNLLAEAKKIAYKEDYYTGTMIYGPYKGEKVEQAKNKVKADMIAAGEAFVYNEPESQVMSRSGDDCIVSLEDQWYVDYGEESWKKQAIECLEGMQLFAPEVKNAFEGVLDWLKNWAVCRTYGLGTRLPWDEKYLVESLSDSTIYQSFYTIAHLLFKDYYGNEIG--PLGISADQMTDEVFDYIFQHQDDVKNTNIP--LPALQKLRREFEYFYPLDVSISGKDLIPNHLTFFIYTHVALFPK---KFWPKGIRANGHLMLNNSKMSKSTGNFMTLEQTVEKFGADAARIAFADAGDTVEDANFDESNANAAILRLFNLKEWAEEITK-ESNLRTGEITDFFDIAFEHEMNALIEKTYEQYALTNYKNALKYGLFDFQAARDYYREAS-GVMHKDLIARYIETQALLLAPIAPHFAEYIYREVLGNQTSVQNAKFPRASKPVDKGVLAALDYLRNLQRSIREGEGQALKKKKGKSAEIDASKPVKLTLLISESFPEWQSQCVE-IVRKLFSEQTLDDNKKVREHIE-----PKEMKRAMPFISLLKQRLANEKPEDVFERELQFSEIDTVKAAARNVKKAAQALKI 1042          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: YNL247W_mRNA (Cysteinyl-tRNA synthetase; may interact with ribosomes, based on co-purification experiments; human gene CARS allows growth of the yeast haploid null mutant after sporulation of a heterozygous diploid [Source:SGD;Acc:S000005191])

HSP 1 Score: 48.521 bits (114), Expect = 6.446e-6
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 3
Query: 2157 VDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFA 2390
            +D+   G DL   H    L    A +    +Q W       GHL +  +KMSKS  NF+TI EA++K+S   +R+AFA
Sbjct:  381 IDIHSGGIDLAFPHHDNELAQSEARF---DNQQWINYFLHTGHLHIEGQKMSKSLKNFITIQEALKKFSPRQLRLAFA 455          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO40441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S766])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 295/504 (58.53%), Postives = 368/504 (73.02%), Query Frame = 3
Query:  612 YQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQI---------------KDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKS-TKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDD 2075
            YQWQIM+  G+  EEI KF ETDYW+ Y+PPL   ++K +G+K DWRRS+ITTD NP+YDSFVRW F  LK+  K+ FGKR TIFSP D+QPCMDHDR SGEGVGPQEY +IKMK+  P+ + L                    +V+LVAATLRPETMYGQTNCW+ P ++Y+A ++   + V IC +RAARNM+YQ   T +   V IL+K  G+++MG AL+APLT+ K IYTLPM +IK++KGTGIVTSVPSD+PDDYAALRD+++K D R  Y I D   LPF P+ +I++P YG  CAVK  E+ KIKSQND D L+EAKE  YK GFY G +I+G++AG  VQ+ K+++Q  ++ +G A  Y EPE+ VISRSG ECVVALCDQWYL+Y +  W++     L+Q NTFS+E RRNF A L+ LHE+ACSRSYGLGTR+PWDEQYLVESLSDSTIY AYYTVAH+LQGG  DG +G +  GI    MT   W+YV   D
Sbjct:   14 YQWQIMQSLGIPQEEIPKFAETDYWLSYFPPLAKEDLKSMGLKTDWRRSYITTDVNPYYDSFVRWHFWNLKERGKVKFGKRYTIFSPADDQPCMDHDRQSGEGVGPQEYNVIKMKVVPPFKEKLRYSVIPELFLSHANFVLEGKNVYLVAATLRPETMYGQTNCWVRPDMKYIAFETNVPNDVYICTQRAARNMSYQG-FTAKESHVNILAKLTGQDIMGIALEAPLTSNKIIYTLPMLTIKEDKGTGIVTSVPSDAPDDYAALRDIQKKPDFRKKYGITDEMALPFNPIPIINVPGYGDLCAVKACEDMKIKSQNDRDLLLEAKELSYKKGFYEGTMIVGEFAGQKVQEVKKLVQMKMLQAGDARIYMEPEKLVISRSGDECVVALCDQWYLDYGEPAWRAQATEALSQCNTFSEETRRNFVATLDWLHEHACSRSYGLGTRLPWDEQYLVESLSDSTIYNAYYTVAHLLQGGVFDGSAG-SPVGIMPEQMTKAVWDYVFFHD 515          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO40444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S771])

HSP 1 Score: 256.529 bits (654), Expect = 1.302e-76
Identity = 137/328 (41.77%), Postives = 196/328 (59.76%), Query Frame = 3
Query: 2373 MRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSLIDM-SDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITF 3329
            MR+A ADAGD++EDANFVE MADAG+LRLY+F EW++E++ SK  +RTGP + + D VF + IN+ I +TE NY+QM Y+  ++ GF+E Q+ RD+YRE C+   H DL+  F+E+Q L+LSPICPH+ + IW  ++ K  SI+N  WP+ G VDE L     YL   +HEFR +       K  +Q +A         ++++A S+PPWQ   L +L  +     G  PDN+ + + L +  E+KK MKK M  +Q +R    ER    +   T   +E  V+  N  Y+ K   LDL  LE+K S E  D K+ + C P +P   F
Sbjct:    1 MRLALADAGDTLEDANFVEKMADAGILRLYTFHEWIREMIASKDQLRTGPKTSYEDRVFESEINQAIRQTELNYEQMTYRDAVKTGFYELQASRDKYREMCLNGMHRDLVFRFIEVQTLLLSPICPHLCEDIW-KVIGKSGSILNADWPVAGDVDETLLKSAVYLTSSTHEFRLRIKNLLAPKGKKQKDAPPPAKPTHGLVYVASSFPPWQHVTLTTLKQLYHSNGGAFPDNRIIMNSLKDAAEVKKYMKKLMPFVQYVRSNV-ERDGPSAMDTTVPFNELEVLRENEGYLKKA--LDLVHLEIKPSSE-GDAKVQEECAPGKPFTVF 323          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO40440 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S765])

HSP 1 Score: 146.362 bits (368), Expect = 6.888e-41
Identity = 72/119 (60.50%), Postives = 89/119 (74.79%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEAN-PIYGKD--KKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIE 518
            RK TAK++ +K IE   Q++WE  K+FE + P  G D  KK K+F TFPYPYMNG LHLGH F+L+K  F+ G++RLKGKN L+ F FHCTGMPIK+ ADKLKREME FG PP FP ++
Sbjct:    2 RKSTAKVDFLKGIETDVQQQWEKMKIFEIDAPDPGSDAAKKGKFFCTFPYPYMNGKLHLGHTFTLAK--FASGFQRLKGKNTLYPFAFHCTGMPIKACADKLKREMEQFGNPPRFPAVD 118          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: lars1b (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101154887])

HSP 1 Score: 1142.1 bits (2953), Expect = 0.000e+0
Identity = 591/1208 (48.92%), Postives = 798/1208 (66.06%), Query Frame = 3
Query:  171 RKGTAKLNTIKDIEVAKQKEWENNKVFEANP---IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKT--EINLNXXXXXXXXXXXXXXGFK-YQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQI--------KDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKIS--IRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            RKGTAKL+ ++ IE+  Q++WE  K FE +    +     KNKYFVTFPYPYMNG LHLGH FSLSKCEF++GY+ LKG+  L+ FG HCTGMPIK+ ADKLKREME +G PP FP+ E     + K   EI +      K        G   +QW IMR  G+ND+EI +F   ++W++Y+PPL I ++K++G+KVDWRRSFITTD NPFYDSFVRWQF+ LK+  KI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +PY    +            ++FLVAATLRPETM+GQTNCW+ P ++YVA ++    V I   R+ARNM++Q   T + G V ++ + LG++L+GCAL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRD+K+K+  R  Y IED  VLPFEP+ +I+IP YG   A    +E KI+SQND +KL+EAKEK Y  GFY G +++  Y G  VQ  K+ IQ  ++  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y D +WK      L  + TF +E RRNFEA L  L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMAYYTVAH+LQGG L+GR G +  GI    MT + W+++            P+    L  LRREF YWYPVD+RVSGKDLVPNHL+Y+L+NH A+WP+++ + WP+ +RANGHLLLN+EKMSKSTGNFLT+S+A+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ ++ N+RTGP    +D VFA+ +N  I +TE +Y++MMYK  L+ GF EFQ+ +D+YRE  +   H DL+  F+E Q L+L+PICPH+ +Y W  +L K +S+M  SWP  G VDE L    +YL   +H+ R +         +++ +           I++AKSYPPWQ S L  L        G LPDNK +   L   PELKK MK+ M  +  I+    +    V  L+  E DE++V+  N  Y+  +L L+  ++++ ++ E +D+K+ + CCP +P   F         + P V                V++VNP   +G  S +++I  GDS   V RR+A K++  I+D + V+L  + D     R +P+  +  +   PI   + F V+  +  ++ + N +   IG+
Sbjct:    4 RKGTAKLDYLRKIELDIQEKWEKEKTFERDAPTTVGESSNKNKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQSLKGRKCLFPFGLHCTGMPIKACADKLKREMELYGTPPQFPDDEEEEKEKPKASDEIIIKDKAKGKKSKAVAKAGSSSFQWDIMRSLGLNDKEIVRFANAEHWLEYFPPLAIKDLKKMGVKVDWRRSFITTDVNPFYDSFVRWQFVTLKERKKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKMKIVEPYTAKFKSKVFYSSGMKGKNLFLVAATLRPETMFGQTNCWVRPDMKYVAFETASGDVFISTRRSARNMSFQG-FTKENGVVPVIMEILGQDLLGCALSAPLTSYKIIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDIKKKQALREKYGIEDKMVLPFEPIPIIEIPGYGNLSAPLVCDELKIQSQNDKEKLVEAKEKVYLKGFYEGIMLVDGYKGQKVQDVKKPIQKMMVEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGDAEWKKQATEALKSLETFCEETRRNFEATLAWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAYYTVAHLLQGGVLNGR-GDSPLGIKPEQMTREVWDFIFFKTAPFPKTDIPK--EHLQKLRREFEYWYPVDVRVSGKDLVPNHLSYFLYNHVAVWPKDNKK-WPQAVRANGHLLLNSEKMSKSTGNFLTLSQAVEKFSADGMRLALADAGDTVEDANFVETMADAGILRLYTWVEWVKEMIANQNNLRTGPADTFNDRVFASEMNAGIIKTEQHYERMMYKEALKSGFFEFQAAKDKYRELAIEGMHRDLVFQFIERQTLLLAPICPHLCEYTW-GLLVKTTSLMKASWPAAGPVDEILVRSSQYLMETAHDLRLRLKAYMLPPKNKKGDTKPPVKPSHCNIYVAKSYPPWQHSALCLLGKHYRSNNGVLPDNKVIAGELGALPELKKYMKRVMPFVAMIKENLEKNGPRVLDLEL-EFDERTVLMENLVYLTNSLELE--QIDVLFATE-ADDKVKEDCCPGKPFSVF--------RSEPGV---------------CVSLVNPQPSNGLFSTKVDIRQGDSKDNVIRRLA-KVNRLIKDLSQVKLMRYEDPVLGPRRVPVLGQEEKGKLPISEKSVFHVNLEEKRVTLADNSLTVDIGD 1177          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: lars1b (leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101154887])

HSP 1 Score: 1051.2 bits (2717), Expect = 0.000e+0
Identity = 549/1148 (47.82%), Postives = 740/1148 (64.46%), Query Frame = 3
Query:  318 MNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKT--EINLNXXXXXXXXXXXXXXGFK-YQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNA--------AIIWIAKSYPPWQMSILDSL-IDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKIS--IRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVS--KSGISFSVNGVAHRIGE 3713
            MNG LHLGH FSLSKCEF++GY+ LKG+  L+ FG HCTGMPIK+ ADKLKREME +G PP FP+ E     + K   EI +      K        G   +QW IMR  G+ND+EI +F   ++W++Y+PPL I ++K++G+KVDWRRSFITTD NPFYDSFVRWQF+ LK+  KI FGKR TI+SP D QPCMDHDR +GEGVGPQEYTLIKMK+ +PY    +    ++FLVAATLRPETM+GQTNCW+ P ++YVA ++    V I   R+ARNM++Q   T + G V ++ + LG++L+GCAL APLT+YK IY LPM +IK++KGTG+VTSVPSD+PDD AALRD+K+K+  R  Y IED  VLPFEP+ +I+IP YG   A    +E KI+SQND +KL+EAKEK Y  GFY G +++  Y G  VQ  K+ IQ  ++  G A+ Y EPE+QV+SRS  ECVVALCDQWYL+Y D +WK      L  + TF +E RRNFEA L  L E+ACSR+YGLGTR+PWDEQ+L+ESLSDSTIYMAYYTVAH+LQGG L+GR G +  GI    MT + W+++            P+    L  LRREF YWYPVD+RVSGKDLVPNHL+Y+L+NH A+WP+++ + WP+ +RANGHLLLN+EKMSKSTGNFLT+S+A+EK+SADGMR+A ADAGD++EDANFVE MADAG+LRLY+++EWVKE++ ++ N+RTGP    +D VFA                                 +D+YRE  +   H DL+  F+E Q L+L+PICPH+ +Y W  +L K +S+M  SWP  G VDE L    +YL   +H+ R +         +++ +           I++AKSYPPWQ S L  L        G LPDNK +   L   PELKK MK+ M  +  I+    +    V  L+  E DE++V+  N  Y+  +L L+  ++++ ++ E +D+K+ + CCP +P   F         + P V                V++VNP   +G  S +++I  GDS   V RR+A K++  I+D + V+L  + D     R +P+  +  +   PI   + F V+  +  ++ + N +   IG+
Sbjct:    1 MNGRLHLGHTFSLSKCEFAVGYQSLKGRKCLFPFGLHCTGMPIKACADKLKREMELYGTPPQFPDDEEEEKEKPKASDEIIIKDKAKGKKSKAVAKAGSSSFQWDIMRSLGLNDKEIVRFANAEHWLEYFPPLAIKDLKKMGVKVDWRRSFITTDVNPFYDSFVRWQFVTLKERKKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLIKMKIVEPYTAKFKSKGKNLFLVAATLRPETMFGQTNCWVRPDMKYVAFETASGDVFISTRRSARNMSFQG-FTKENGVVPVIMEILGQDLLGCALSAPLTSYKIIYALPMLTIKEDKGTGVVTSVPSDAPDDIAALRDIKKKQALREKYGIEDKMVLPFEPIPIIEIPGYGNLSAPLVCDELKIQSQNDKEKLVEAKEKVYLKGFYEGIMLVDGYKGQKVQDVKKPIQKMMVEKGEAMIYMEPEKQVMSRSADECVVALCDQWYLDYGDAEWKKQATEALKSLETFCEETRRNFEATLAWLQEHACSRTYGLGTRLPWDEQWLIESLSDSTIYMAYYTVAHLLQGGVLNGR-GDSPLGIKPEQMTREVWDFIFFKTAPFPKTDIPK--EHLQKLRREFEYWYPVDVRVSGKDLVPNHLSYFLYNHVAVWPKDNKK-WPQAVRANGHLLLNSEKMSKSTGNFLTLSQAVEKFSADGMRLALADAGDTVEDANFVETMADAGILRLYTWVEWVKEMIANQNNLRTGPADTFNDRVFA--------------------------------AKDKYRELAIEGMHRDLVFQFIERQTLLLAPICPHLCEYTW-GLLVKTTSLMKASWPAAGPVDEILVRSSQYLMETAHDLRLRLKAYMLPPKNKKGDTKPPVKPSHCNIYVAKSYPPWQHSALCLLGKHYRSNNGVLPDNKVIAGELGALPELKKYMKRVMPFVAMIKENLEKNGPRVLDLEL-EFDERTVLMENLVYLTNSLELE--QIDVLFATE-ADDKVKEDCCPGKPFSVF--------RSEPGV---------------CVSLVNPQPSNGLFSTKVDIRQGDSKDNVIRRLA-KVNRLIKDLSQVKLMRYEDPVLGPRRVPVLGQEEKGKLPISEKSVFHVNLEEKRVTLADNSLTVDIGD 1082          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000031601.1 (SMESG000031601.1)

HSP 1 Score: 2402.86 bits (6226), Expect = 0.000e+0
Identity = 1180/1183 (99.75%), Postives = 1181/1183 (99.83%), Query Frame = 3
Query:  165 MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVSKSGISFSVNGVAHRIGE 3713
            MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFG HCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINLNKVKGKKSKAVAKSGGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYL+NHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPA EVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVSKSGISFSVNGVAHRIGE
Sbjct:    1 MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGLHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINLNKVKGKKSKAVAKSGGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLYNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAAEVPRVAMESNSLMRATVTVVNPDLFSGFVSHEIEILDGDSFVTVARRVADKISIRDSTAVELYHFIDEKASARLIPLSTEMMRDLQPIDRNATFSVSKSGISFSVNGVAHRIGE 1183          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000029599.1 (SMESG000029599.1)

HSP 1 Score: 2117.81 bits (5486), Expect = 0.000e+0
Identity = 1048/1100 (95.27%), Postives = 1059/1100 (96.27%), Query Frame = 3
Query:  162 HMNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQY--LVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGF 3455
            H++RKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFG HCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEIN+NKVKGKKSKAVAKSGGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQ  + +                           R+ W+ ++  +    SDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYL+NHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPA EVPRVAMESNSLMRATVTVVNPDLFSG 
Sbjct:   17 HVDRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGLHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEININKVKGKKSKAVAKSGGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQKTSMNTPAH----------------------ARMDWEREFPGMNNIWSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLYNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAAEVPRVAMESNSLMRATVTVVNPDLFSGL 1094          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000029599.1 (SMESG000029599.1)

HSP 1 Score: 2116.66 bits (5483), Expect = 0.000e+0
Identity = 1049/1099 (95.45%), Postives = 1058/1099 (96.27%), Query Frame = 3
Query:  165 MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEINLNXXXXXXXXXXXXXXGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDEVRRNFEANLENLHEYACSRSYGLGTRIPWDEQY--LVESLSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRXXXXXXXXXXXXXXHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGF 3455
            MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFG HCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEIN+NKVKGKKSKAVAKSGGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQ  + +                           R+ W+ ++  +    SDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYL+NHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPA EVPRVAMESNSLMRATVTVVNPDLFSG 
Sbjct:    1 MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGLHCTGMPIKSSADKLKREMESFGFPPVFPEIETPVAIEEKTEININKVKGKKSKAVAKSGGFKYQWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFITTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSGEGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWIHPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKELMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDLKRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQNDADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAINYSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQKTSMNTPAH----------------------ARMDWEREFPGMNNIWSDSTIYMAYYTVAHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVGKLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLYNHCAIWPENSDQYWPKNIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIEDANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAINRTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFVEIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERYLDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMSDKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRLKTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPMEPKITFLVVKEDDKSAPPAAEVPRVAMESNSLMRATVTVVNPDLFSGL 1077          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000031004.1 (SMESG000031004.1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.217e-6
Identity = 26/75 (34.67%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  264 IYGKDKKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESF 488
            ++   K N YF+T P  Y N   H+GH ++   C+    + RLKGKN ++  G    G+ I+ SA+ LK     F
Sbjct:   13 LFNFKKLNSYFITSPIYYPNDKPHIGHLYTNCLCDVIARWNRLKGKNVIFSTGTDEHGIKIQKSAENLKMNYNKF 87          
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000031004.1 (SMESG000031004.1)

HSP 1 Score: 51.2174 bits (121), Expect = 3.479e-6
Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 3
Query:  279 KKNKYFVTFPYPYMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADKLKREMESF 488
            K N YF+T P  Y N   H+GH ++   C+    + RLKGKN ++  G    G+ I+ SA+ LK     F
Sbjct:   18 KLNSYFITSPIYYPNDKPHIGHLYTNCLCDVIARWNRLKGKNVIFSTGTDEHGIKIQKSAENLKMNYNKF 87          
The following BLAST results are available for this feature:
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LARS10.000e+050.79leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
LARS10.000e+050.78leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
LARS11.398e-11440.43leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
LARS11.441e-4362.93leucyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lars-10.000e+050.81Leucine--tRNA ligase [Source:UniProtKB/Swiss-Prot... [more]
lars-10.000e+050.81Leucine--tRNA ligase [Source:UniProtKB/Swiss-Prot... [more]
Y105E8A.201.766e-735.11pep chromosome:WBcel235:I:14486890:14495252:-1 gen... [more]
Y105E8A.201.766e-735.11pep chromosome:WBcel235:I:14486898:14495255:-1 gen... [more]
Y105E8A.202.066e-735.11pep chromosome:WBcel235:I:14486878:14496560:-1 gen... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LeuRS0.000e+049.57gene:FBgn0284253 transcript:FBtr0345640[more]
LeuRS0.000e+049.57gene:FBgn0284253 transcript:FBtr0077562[more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lars1b0.000e+045.58leucyl-tRNA synthetase 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
lars1b0.000e+044.24leucyl-tRNA synthetase 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
lars1a1.455e-13160.17leucyl-tRNA synthetase 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lars0.000e+050.50leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548... [more]
lars0.000e+053.70leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548... [more]
lars0.000e+049.37leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548... [more]
lars0.000e+048.96leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548... [more]
lars0.000e+049.57leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lars0.000e+050.04leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
Lars8.101e-7161.24leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
Lars4.871e-3562.24leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
Lars1.572e-1144.44leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
Lars9.494e-841.46leucyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P2J5|SYLC_HUMAN0.000e+050.79Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens ... [more]
sp|Q8BMJ2|SYLC_MOUSE0.000e+050.04Leucine--tRNA ligase, cytoplasmic OS=Mus musculus ... [more]
sp|Q5R614|SYLC_PONAB0.000e+050.54Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii ... [more]
sp|Q09996|SYLC_CAEEL0.000e+050.81Leucine--tRNA ligase OS=Caenorhabditis elegans OX=... [more]
sp|Q54N83|SYLC_DICDI0.000e+046.69Leucine--tRNA ligase, cytoplasmic OS=Dictyostelium... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9E0T20.000e+051.71leucine--tRNA ligase, cytoplasmic OS=Trichechus ma... [more]
A0A2J7PZ400.000e+050.04Leucine--tRNA ligase, cytoplasmic OS=Cryptotermes ... [more]
A0A481ADW10.000e+050.58Leucine--tRNA ligase, cytoplasmic OS=Sus scrofa OX... [more]
A0A481AHZ80.000e+050.58Leucine--tRNA ligase, cytoplasmic OS=Sus scrofa OX... [more]
A0A480JIP60.000e+050.58Leucine--tRNA ligase, cytoplasmic OS=Sus scrofa OX... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lars1b0.000e+050.87leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103... [more]
lars1b0.000e+050.87leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000005898.15.250e-15841.43pep scaffold:Pmarinus_7.0:GL480199:186:9945:1 gene... [more]
ENSPMAT00000000019.11.090e-10657.95pep scaffold:Pmarinus_7.0:GL486658:1337:8958:-1 ge... [more]
mars22.927e-733.33methionyl-tRNA synthetase 2, mitochondrial [Source... [more]
mars23.141e-734.29methionyl-tRNA synthetase 2, mitochondrial [Source... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CDC600.000e+041.87Cytosolic leucyl tRNA synthetase; ligates leucine ... [more]
YNL247W_mRNA6.446e-637.18Cysteinyl-tRNA synthetase; may interact with ribos... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO404410.000e+058.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404441.302e-7641.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404406.888e-4160.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lars1b0.000e+048.92leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101... [more]
lars1b0.000e+047.82leucyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Leucine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031601.10.000e+099.75SMESG000031601.1[more]
SMESG000029599.10.000e+095.27SMESG000029599.1[more]
SMESG000029599.10.000e+095.45SMESG000029599.1[more]
SMESG000031004.13.217e-634.67SMESG000031004.1[more]
SMESG000031004.13.479e-637.14SMESG000031004.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024910 ID=SMED30024910|Name=Leucine--tRNA ligase, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=3785bp
CTTCATTTCATATTGATTTTAGATTCATTTTTCTCACAATTATTATAAAT
TATAATTAATATTAATATTAGAGTTTTATTTAAAAATTAATTAATTAGAA
ATTCAAATTAAAACAGTTTGTATAAATATTATTATTTGAATTGGTTGTAT
CGAAAATTTACCACATGAACAGAAAAGGAACAGCTAAATTAAATACTATA
AAAGACATTGAGGTTGCTAAACAAAAAGAATGGGAAAATAATAAAGTTTT
TGAAGCTAATCCAATCTATGGTAAAGATAAAAAAAACAAGTATTTTGTTA
CATTTCCATATCCTTATATGAATGGCAATTTGCATCTAGGCCATGCATTT
TCATTGTCTAAATGTGAATTTTCAATGGGATATGAACGATTAAAAGGAAA
AAATGCACTTTGGGGATTTGGATTTCACTGTACTGGTATGCCAATTAAAT
CTAGCGCAGACAAACTTAAAAGAGAAATGGAAAGTTTTGGATTTCCACCA
GTTTTTCCTGAAATCGAAACACCTGTTGCAATAGAAGAAAAAACTGAAAT
TAATTTAAATAAAGTTAAAGGAAAAAAATCGAAAGCTGTTGCTAAATCTG
GAGGCTTTAAATACCAATGGCAAATTATGAGACACAATGGAATGAATGAC
GAAGAAATTAAAAAGTTTACTGAAACTGATTATTGGATAAAATACTATCC
TCCATTAACTATCACAAACATGAAACGCTTAGGAATCAAAGTCGATTGGA
GACGATCTTTTATAACTACGGATGCTAATCCATTTTATGATTCTTTTGTT
AGATGGCAATTCCTAAAATTGAAGAAACTAAATAAAATTATGTTTGGTAA
GCGACAAACTATTTTCTCACCAATTGACAATCAGCCATGTATGGATCACG
ACAGAAGCAGCGGTGAAGGTGTTGGACCACAAGAATATACTCTCATTAAA
ATGAAACTAGAGAAACCTTATCCTCAATGCTTAGAACAAATAAAGGATGA
TGTATTCCTCGTGGCAGCTACACTGCGACCAGAAACAATGTATGGCCAAA
CGAATTGTTGGATACACCCTACGATAGAATATGTCGCAGTTAAAAGCACT
AAACACGGAGTTTTAATTTGCGTGGAACGTGCGGCACGAAATATGGCTTA
CCAAGAAATCCTTACTGATCAACCAGGAGAAGTGATAATTTTATCAAAAT
TCCTCGGCAAAGAATTAATGGGCTGTGCGTTGCAAGCTCCATTAACGACA
TATAAAACGATTTACACTCTCCCAATGTTCAGTATCAAACAAAATAAAGG
GACCGGCATAGTAACAAGTGTTCCCAGTGATTCTCCTGATGATTATGCTG
CTTTACGAGATCTCAAACGTAAAGAGGACACTCGATCACTCTACAAAATA
GAAGATTACAAAGTGTTACCATTCGAACCGGTGGAAGTCATTGACATTCC
AGAATACGGTCGCCAATGTGCTGTCAAATGCGTCGAGGAATTCAAAATCA
AAAGTCAAAACGACGCAGATAAATTAATGGAAGCGAAAGAAAAGTGTTAT
AAACTCGGATTTTATTCCGGCAAATTGATTATCGGTAAATACGCAGGGAT
GCCTGTGCAGAAGGCGAAAGAAATCATCCAATCAGATTTAATCACGAGCG
GTTTGGCTATCAACTATTCTGAACCCGAGAGACAAGTGATTTCGAGAAGC
GGCGGTGAGTGCGTCGTTGCTCTTTGTGATCAATGGTATCTGAACTACAA
GGACGAGCAGTGGAAATCGATTACTAAATCGTGCTTAAATCAAGTGAACA
CATTTTCAGATGAAGTTCGACGCAACTTTGAAGCGAATCTAGAAAACCTC
CATGAATACGCCTGCTCACGCTCGTATGGATTGGGAACGAGAATTCCCTG
GGATGAACAATATCTGGTCGAATCTCTGTCGGATTCGACGATCTATATGG
CGTATTACACAGTTGCCCATGTGCTTCAGGGGGGCTCATTGGATGGGCGT
TCCGGGGTGAATTCATCGGGAATTACCATTACAGATATGACTCCCGATGC
CTGGGAATACGTTCTTGGTGATGATCGATCGGTGGCCGGCAATCTGAACC
CGGAATTGGTTGGGAAATTGGATGGGTTACGCCGGGAATTCCACTATTGG
TACCCAGTCGATCTCAGGGTCAGTGGGAAAGATCTTGTACCGAATCATTT
GACTTATTACCTTTTCAACCATTGCGCAATCTGGCCGGAAAATTCCGATC
AATATTGGCCGAAAAATATCCGTGCCAACGGTCACCTGTTGCTTAACAAC
GAGAAAATGTCGAAATCTACCGGAAATTTTCTGACGATCAGTGAAGCGAT
TGAGAAATATTCTGCCGATGGAATGAGAATGGCTTTCGCCGATGCCGGAG
ATTCGATTGAGGACGCAAATTTCGTTGAGGACATGGCGGACGCGGGTCTG
TTGCGGTTGTACTCGTTTATCGAGTGGGTCAAGGAAATCGTGGAATCGAA
ACCGAACATGAGAACCGGGCCGTTGAGTCTGCACAGCGATTTGGTATTCG
CAAATGCGATCAACCGCACAATCGAAGAAACGGAAACCAATTACAAACAG
ATGATGTACAAGCGGGTGCTCCAACTCGGGTTCCACGAGTTCCAATCGAT
CCGGGACCGATACCGAGAGACCTGCATGGGCGACTATCACGCCGATCTAA
TCACGCTATTTGTCGAGATCCAATGCTTGATCCTGTCCCCGATTTGTCCC
CACATCACCGATTACATTTGGACAGACATCCTCAACAAGCCCAGCTCGAT
AATGAACGAATCTTGGCCGATTCCGGGAAAAGTCGACGAGAAACTCTCCA
CCGAAGAAAGATATCTCGACGGAATTTCCCACGAGTTCCGAAAGCAATCG
CTACAGAAACCGAAATCCAAATCTTCAGAGCAGCACAATGCGGCAATAAT
CTGGATCGCGAAATCCTACCCGCCTTGGCAGATGTCGATTCTGGACTCGC
TGATCGATATGTCGGATAAGGAGGGAAAATTGCCGGACAACAAATCGCTT
AACTCGAGGCTCAGTGAGAATCCCGAGCTGAAGAAACGGATGAAGAAGGC
GATGGATTTGATCCAATCGATCCGGGTGAAATGCAATGAGCGATCGGAAA
ACGTTTCACGGCTTAAAACGCCGGAAATCGATGAGAAATCGGTGATTGAG
AGCAATTTTCGTTACATGGCGAAAACTTTGAATCTCGATTTGGGAAAGCT
GGAACTCAAATATTCCGATGAGTGTTCCGATGAGAAATTGTTTGATTCCT
GCTGTCCGATGGAGCCGAAAATCACTTTTCTTGTGGTCAAGGAAGACGAT
AAATCGGCACCACCGGCTGTGGAGGTGCCACGAGTCGCCATGGAATCGAA
TTCCTTAATGAGAGCAACGGTAACCGTGGTTAATCCGGATTTGTTTTCCG
GTTTTGTGAGTCACGAAATCGAGATTCTCGATGGGGATTCCTTTGTAACC
GTTGCTAGGAGGGTTGCGGATAAAATTTCCATCCGGGATTCTACAGCTGT
GGAGCTCTATCATTTCATTGACGAGAAAGCAAGCGCCAGATTGATTCCTC
TCTCGACTGAAATGATGAGAGATCTACAGCCCATTGATAGGAATGCAACC
TTTTCCGTTTCTAAGTCCGGAATTAGTTTCTCCGTTAATGGAGTTGCTCA
TAGGATTGGAGAGAAAATTAAATATTTTATTCGAAAATTTTAATTTTTTA
GGTTATAATATATTTTAGCGTTGCTTAAAAAAAAA
back to top

protein sequence of SMED30024910-orf-1

>SMED30024910-orf-1 ID=SMED30024910-orf-1|Name=SMED30024910-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1193bp
MNRKGTAKLNTIKDIEVAKQKEWENNKVFEANPIYGKDKKNKYFVTFPYP
YMNGNLHLGHAFSLSKCEFSMGYERLKGKNALWGFGFHCTGMPIKSSADK
LKREMESFGFPPVFPEIETPVAIEEKTEINLNKVKGKKSKAVAKSGGFKY
QWQIMRHNGMNDEEIKKFTETDYWIKYYPPLTITNMKRLGIKVDWRRSFI
TTDANPFYDSFVRWQFLKLKKLNKIMFGKRQTIFSPIDNQPCMDHDRSSG
EGVGPQEYTLIKMKLEKPYPQCLEQIKDDVFLVAATLRPETMYGQTNCWI
HPTIEYVAVKSTKHGVLICVERAARNMAYQEILTDQPGEVIILSKFLGKE
LMGCALQAPLTTYKTIYTLPMFSIKQNKGTGIVTSVPSDSPDDYAALRDL
KRKEDTRSLYKIEDYKVLPFEPVEVIDIPEYGRQCAVKCVEEFKIKSQND
ADKLMEAKEKCYKLGFYSGKLIIGKYAGMPVQKAKEIIQSDLITSGLAIN
YSEPERQVISRSGGECVVALCDQWYLNYKDEQWKSITKSCLNQVNTFSDE
VRRNFEANLENLHEYACSRSYGLGTRIPWDEQYLVESLSDSTIYMAYYTV
AHVLQGGSLDGRSGVNSSGITITDMTPDAWEYVLGDDRSVAGNLNPELVG
KLDGLRREFHYWYPVDLRVSGKDLVPNHLTYYLFNHCAIWPENSDQYWPK
NIRANGHLLLNNEKMSKSTGNFLTISEAIEKYSADGMRMAFADAGDSIED
ANFVEDMADAGLLRLYSFIEWVKEIVESKPNMRTGPLSLHSDLVFANAIN
RTIEETETNYKQMMYKRVLQLGFHEFQSIRDRYRETCMGDYHADLITLFV
EIQCLILSPICPHITDYIWTDILNKPSSIMNESWPIPGKVDEKLSTEERY
LDGISHEFRKQSLQKPKSKSSEQHNAAIIWIAKSYPPWQMSILDSLIDMS
DKEGKLPDNKSLNSRLSENPELKKRMKKAMDLIQSIRVKCNERSENVSRL
KTPEIDEKSVIESNFRYMAKTLNLDLGKLELKYSDECSDEKLFDSCCPME
PKITFLVVKEDDKSAPPAVEVPRVAMESNSLMRATVTVVNPDLFSGFVSH
EIEILDGDSFVTVARRVADKISIRDSTAVELYHFIDEKASARLIPLSTEM
MRDLQPIDRNATFSVSKSGISFSVNGVAHRIGEKIKYFIRKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009008Val/Leu/Ile-tRNA-synth_edit
IPR009080tRNAsynth_Ia_anticodon-bd
IPR002300aa-tRNA-synth_Ia
IPR013155M/V/L/I-tRNA-synth_anticd-bd
IPR014729Rossmann-like_a/b/a_fold
IPR015413Methionyl/Leucyl_tRNA_Synth
IPR001412aa-tRNA-synth_I_CS
Vocabulary: biological process
TermDefinition
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation
GO:0006429leucyl-tRNA aminoacylation
GO:0006438valyl-tRNA aminoacylation
GO:0006450regulation of translational fidelity
Vocabulary: molecular function
TermDefinition
GO:0002161aminoacyl-tRNA editing activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0004823leucine-tRNA ligase activity
GO:0004832valine-tRNA ligase activity
GO:0005515protein binding
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016604nuclear body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..29