Wee1-like protein kinase

Overview
NameWee1-like protein kinase
Smed IDSMED30024908
Length (bp)1576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Wee1-like protein kinase (SMED30024908) t-SNE clustered cells

Violin plots show distribution of expression levels for Wee1-like protein kinase (SMED30024908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Wee1-like protein kinase (SMED30024908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Wee1-like protein kinase (SMED30024908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024908h1SMcG0012553 SmedASXL_007157SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30024908h1SMcG0012553 dd_Smed_v6_17244_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30024908h1SMcG0012553 dd_Smed_v4_17244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024908h1SMcG0012553 SMED_27054_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30024908h1SMcG0012553 SMED_27054_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Wee1-like protein kinase vs. Ensembl Human
Match: WEE1 (WEE1 G2 checkpoint kinase [Source:HGNC Symbol;Acc:HGNC:12761])

HSP 1 Score: 95.1301 bits (235), Expect = 2.183e-20
Identity = 78/291 (26.80%), Postives = 130/291 (44.67%), Query Frame = 1
Query:  538 ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISS----CSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGI----INQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            I S +   ++ C  R +   Y +K   K  +  + E +   + EV    ++G+HSHVV ++ AW ED+   +Q  + +GGSL D I  N                YRI S         +L  +   L Y+H  +++ H DIKPSN+ +          S+          D   + ++ FK+ D G     S+  +++EGD R+L       +  HL  +  DI+AL LT+  C  G      N +    IR+G   + P+ +S+ +  L+K M H D   R +A  +++
Sbjct:   91 IGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQN--ALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISEN----------------YRIMSYFKEAELKDLLLQVGRGLRYIHS-MSLVHMDIKPSNIFISRT-------SIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSP-QVEEGDSRFLANEVLQENYTHLPKA--DIFALALTVV-CAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVK 351          
BLAST of Wee1-like protein kinase vs. Ensembl Human
Match: WEE2 (WEE2 oocyte meiosis inhibiting kinase [Source:HGNC Symbol;Acc:HGNC:19684])

HSP 1 Score: 95.5153 bits (236), Expect = 3.503e-20
Identity = 94/306 (30.72%), Postives = 146/306 (47.71%), Query Frame = 1
Query:  490 LFETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNS---NRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSA-LLDSNPNPRLRFKLCDFGRSGATS-NVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            L ETN M S+Y  + L    I   +   +Y C  R +   Y +K   K+ +   +E+S   ++EV    ++G H HVV +Y +W ED+   +Q  + +GGSL   I  N+   N F    +  KL+            +L  IS  L Y+H   ++ H DIKPSN+ +     + +   + ++E  +   L +N    + +K+ D G   ATS N  K++EGD R+L          HL  +  DI+ALGLTI    G      N  +   IRKGN+   P+ +SE++  L+K M   D   R +A
Sbjct:  199 LRETN-MASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENS--ALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAAISENTKSGNHF----EEPKLKD-----------ILLQISLGLNYIHNS-SMVHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLSAN----VMYKIGDLGH--ATSINKPKVEEGDSRFLANEILQEDYRHLPKA--DIFALGLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSA 477          
BLAST of Wee1-like protein kinase vs. Ensembl Human
Match: WEE2 (WEE2 oocyte meiosis inhibiting kinase [Source:HGNC Symbol;Acc:HGNC:19684])

HSP 1 Score: 95.5153 bits (236), Expect = 3.503e-20
Identity = 94/306 (30.72%), Postives = 146/306 (47.71%), Query Frame = 1
Query:  490 LFETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNS---NRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSA-LLDSNPNPRLRFKLCDFGRSGATS-NVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            L ETN M S+Y  + L    I   +   +Y C  R +   Y +K   K+ +   +E+S   ++EV    ++G H HVV +Y +W ED+   +Q  + +GGSL   I  N+   N F    +  KL+            +L  IS  L Y+H   ++ H DIKPSN+ +     + +   + ++E  +   L +N    + +K+ D G   ATS N  K++EGD R+L          HL  +  DI+ALGLTI    G      N  +   IRKGN+   P+ +SE++  L+K M   D   R +A
Sbjct:  199 LRETN-MASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENS--ALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAAISENTKSGNHF----EEPKLKD-----------ILLQISLGLNYIHNS-SMVHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLSAN----VMYKIGDLGH--ATSINKPKVEEGDSRFLANEILQEDYRHLPKA--DIFALGLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSA 477          
BLAST of Wee1-like protein kinase vs. Ensembl Human
Match: WEE1 (WEE1 G2 checkpoint kinase [Source:HGNC Symbol;Acc:HGNC:12761])

HSP 1 Score: 94.7449 bits (234), Expect = 8.445e-20
Identity = 83/311 (26.69%), Postives = 139/311 (44.69%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISS----CSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGI----INQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            + E+N M S+Y  +      I S +   ++ C  R +   Y +K   K  +  + E +   + EV    ++G+HSHVV ++ AW ED+   +Q  + +GGSL D I  N                YRI S         +L  +   L Y+H  +++ H DIKPSN+ +          S+          D   + ++ FK+ D G     S+  +++EGD R+L       +  HL  +  DI+AL LT+  C  G      N +    IR+G   + P+ +S+ +  L+K M H D   R +A  +++
Sbjct:  286 ITESN-MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQN--ALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISEN----------------YRIMSYFKEAELKDLLLQVGRGLRYIHS-MSLVHMDIKPSNIFISRT-------SIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSP-QVEEGDSRFLANEVLQENYTHLPKA--DIFALALTVV-CAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVK 565          
BLAST of Wee1-like protein kinase vs. Ensembl Human
Match: WEE2 (WEE2 oocyte meiosis inhibiting kinase [Source:HGNC Symbol;Acc:HGNC:19684])

HSP 1 Score: 62.003 bits (149), Expect = 1.968e-10
Identity = 58/198 (29.29%), Postives = 96/198 (48.48%), Query Frame = 1
Query:  562 IYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNS---NRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATS-NVIKMDEGDGRYL 1143
            +Y C  R +   Y +K   K+ +   +E+S   ++EV    ++G H HVV +Y +W ED+   +Q  + +GGSL   I  N+   N F    +  KL+            +L  IS  L Y+H   ++ H DIKPSN+ +     + +   + ++E  +    S     + +K+ D G   ATS N  K++EGD R+L
Sbjct:    1 VYKCIKRLDGCVYAIKRSMKTFTELSNENSA--LHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAAISENTKSGNHF----EEPKLKD-----------ILLQISLGLNYIHNS-SMVHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLS---ANVMYKIGDLGH--ATSINKPKVEEGDSRFL 175          
BLAST of Wee1-like protein kinase vs. Ensembl Celegans
Match: sad-1 (Serine/threonine kinase SAD-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19469])

HSP 1 Score: 57.7658 bits (138), Expect = 1.794e-8
Identity = 69/320 (21.56%), Postives = 134/320 (41.88%), Query Frame = 1
Query:  502 NVMYSKYINKILISSTKLSEIYLC-QHRFNSQYYVVKSGY-KSNSHC---------------LSESS-REIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTS-NDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIIN------QESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            N + SK +++ ++S+  +++   C  ++        ++G  K+ +HC               LSES  +++  E+ I+ LI +H HV+  YD +   +  +L L  +SGG L D++V                ++ R+ S  A      I S L + H   NI H D+KP N+L+D        D  MA L+   ++L+++         C      A   VI+ ++ DGR                   D+++ G+ ++    G +       +     +++G +   P  +  + Q L++ M   D   RY+  ++ +
Sbjct:   21 NELSSKIMSENIVSTRPVAQAQYCGPYKLEKTLGKGQTGLVKTGTHCITGRKVAIKIVNKEKLSESVLQKVEREIAIMKLI-EHPHVLHLYDVYENKKYLYLLLEHVSGGELFDYLV----------------RKGRLMSKEARKFFRQIISALDFCH-AHNICHRDLKPENLLLDERNNIKVADFGMASLQVEGSMLETS---------CGSPHY-ACPEVIRGEKYDGRKA-----------------DVWSCGVILYALLVGALPFDDDNLRNLLEKVKRGVFH-IPHFVPADVQSLLRAMIEVDPGKRYSLADVFK 294          
BLAST of Wee1-like protein kinase vs. Ensembl Celegans
Match: sad-1 (Serine/threonine kinase SAD-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19469])

HSP 1 Score: 57.3806 bits (137), Expect = 1.865e-8
Identity = 69/321 (21.50%), Postives = 135/321 (42.06%), Query Frame = 1
Query:  502 NVMYSKYINKILISSTKLSEIYLC-QHRFNSQYYVVKSGY-KSNSHC---------------LSESS-REIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMV-RYTSNDLSMAKLECHSALLDSN-PNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIIN------QESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            N + SK +++ ++S+  +++   C  ++        ++G  K+ +HC               LSES  +++  E+ I+ LI +H HV+  YD +   +  +L L  +SGG L D++V                ++ R+ S  A      I S L + H   NI H D+KP N+L+D        D  MA L+   ++L+++  +P             A   VI+ ++ DGR                   D+++ G+ ++    G +       +     +++G +   P  +  + Q L++ M   D   RY+  ++ +
Sbjct:   21 NELSSKIMSENIVSTRPVAQAQYCGPYKLEKTLGKGQTGLVKTGTHCITGRKVAIKIVNKEKLSESVLQKVEREIAIMKLI-EHPHVLHLYDVYENKKYLYLLLEHVSGGELFDYLV----------------RKGRLMSKEARKFFRQIISALDFCH-AHNICHRDLKPENLLLDERNNIKVADFGMASLQVEGSMLETSCGSPHY-----------ACPEVIRGEKYDGRKA-----------------DVWSCGVILYALLVGALPFDDDNLRNLLEKVKRGVFH-IPHFVPADVQSLLRAMIEVDPGKRYSLADVFK 294          
BLAST of Wee1-like protein kinase vs. Ensembl Celegans
Match: T08D2.7 (pep chromosome:WBcel235:X:182691:191193:1 gene:WBGene00011612.1 transcript:T08D2.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08D2.7)

HSP 1 Score: 54.299 bits (129), Expect = 1.259e-7
Identity = 66/263 (25.10%), Postives = 105/263 (39.92%), Query Frame = 1
Query:  649 SREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRY-LPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG----------IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKC 1404
            +R+I NEV+++  +  H ++V  YD     +  ++ + ++ GG            F  + D SK  +     S   Y     I +VL Y+H V  I H DIKP N+L                        SN   R   KL DFG +  + N +K   G   Y  P +  N      +    DI++LG  +F  F G          +   E     R    E+W R I++  Q +I+ M   + + R +A E++    +KC
Sbjct:  215 TRDIQNEVEVMKKL-SHPNIVAIYDCITVAKYSYMVIEYVGGGEF----------FSKLVD-SKYNQMGLGESLGKYFAFQLIDAVL-YLHSV-GICHRDIKPENILC-----------------------SNKAERCILKLTDFGMAKNSVNRMKTHCGTPSYCAPEIVANQGVE--YTPKVDIWSLGCVLFITFSGYPPFSEEYTDLKMDEQVLTGRLFFHEQWHR-ITDETQNMIQWMLTVEPLIRPSAVELMSTQWMKC 437          
BLAST of Wee1-like protein kinase vs. Ensembl Celegans
Match: wee-1.3 (Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 [Source:UniProtKB/Swiss-Prot;Acc:O18209])

HSP 1 Score: 54.6842 bits (130), Expect = 1.366e-7
Identity = 79/338 (23.37%), Postives = 135/338 (39.94%), Query Frame = 1
Query:  442 PDSSSPVEKYIKDYPKLFETNVM-YSKYINKI--LISSTKLSEIYLCQHRFNSQYYVVKSGYKS-NSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLE---KRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLV--DMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG---RSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGGI---INQESASAIRKGN-WEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVK 1401
            P    P+E      PK   TN   + + + +I  +I      E++  + R +SQ Y VK        H +S+       E +   +I  H ++V FY AW E  R ++Q                      +CD S L+   +++ +     + +   +   + ++H   ++ H DIKP N+ +  DM+             C               KL DFG        ++V   +EGD +YL    LN   +       S DI++LG+TI +    +    N +S   IR G   +++   IS + + LI  M   D   R T+R++L+   +K
Sbjct:   84 PQGPKPLES-----PKYDHTNAQSFFEQVFQIDEIIGRGSFGEVFAARCREDSQLYAVKVSLAPIRQHSISK-----YREAESHMIIPPHKNLVKFYRAWEETGRLYIQ--------------------TELCDQSLLKYCTEKHALPEDEIWNIFVDLLQAVHHLHSN-DMIHDDIKPENIFLTKDMI-------------C---------------KLGDFGLVINLKNPNDVKSAEEGDSKYLAPEVLNGRPTK------SSDIFSLGMTILEATTDLDVPSNGDSWHQIRNGQIPDRFFAGISTDLRSLIALMLDSDPRIRPTSRDLLDHPVIK 356          
BLAST of Wee1-like protein kinase vs. Ensembl Celegans
Match: nekl-4 (Serine/threonine-protein kinase D1044.8 [Source:UniProtKB/Swiss-Prot;Acc:P84199])

HSP 1 Score: 51.9878 bits (123), Expect = 1.160e-6
Identity = 32/121 (26.45%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  655 EIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDM-VRYTSNDLSMAK 1014
            ++I+EVKI+    +H ++V +   ++E+ R ++ +  I G SL D I            I+  EK+        + M+  +   L Y+H+   I H D+KP+N+++    R    D  +AK
Sbjct:  506 DMISEVKIIKQQLRHPNIVRYRRIFVENHRLYIVMDLIQGCSLRDLI------------ITMKEKKGNFEEKKIWAMVVQMMLALRYLHKEKQIVHRDLKPNNIMMTTDERVVITDFGLAK 614          
BLAST of Wee1-like protein kinase vs. Ensembl Fly
Match: Wee1 (gene:FBgn0011737 transcript:FBtr0332329)

HSP 1 Score: 81.6481 bits (200), Expect = 5.248e-16
Identity = 83/315 (26.35%), Postives = 138/315 (43.81%), Query Frame = 1
Query:  490 LFETNVMYSK--YINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPN---PRLR-------FKLCDFGRSGATSNVIKMDEGDGRYLPT--LNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            L +TN+   K  ++   +I   +   ++ C +R +   Y +K   K  +   S   +  +NEV    ++GKH +VV +Y AW ED+   +Q  F  GGSL         R    C          +      I+L H+   L Y+H   ++ H D+KP N+   M     N   + +++      D   +     LR       +K+ D G   +      ++EGD RYLP   L+++ SN  LF +  DI++LG+T+F+  GG     N      +R G     P ++S ++  LI +M H     R T++ I 
Sbjct:  227 LHDTNISRFKREFMQVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAG--SSFEKRALNEVWAHAVLGKHDNVVRYYSAWAEDDHMLIQNEFCDGGSL-------HARIQDHC----------LGEAELKIVLMHVIEGLRYIHSN-DLVHMDLKPENIFSTM---NPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTYKIGDLGHVTSVKEPY-VEEGDCRYLPKEILHEDYSN--LFKA--DIFSLGITLFEAAGGGPLPKNGPEWHNLRDGKVPILP-SLSRDFNELIAQMMHPYPDKRPTSQSIF 512          
BLAST of Wee1-like protein kinase vs. Ensembl Fly
Match: Wee1 (gene:FBgn0011737 transcript:FBtr0079371)

HSP 1 Score: 81.6481 bits (200), Expect = 5.248e-16
Identity = 83/315 (26.35%), Postives = 138/315 (43.81%), Query Frame = 1
Query:  490 LFETNVMYSK--YINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPN---PRLR-------FKLCDFGRSGATSNVIKMDEGDGRYLPT--LNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            L +TN+   K  ++   +I   +   ++ C +R +   Y +K   K  +   S   +  +NEV    ++GKH +VV +Y AW ED+   +Q  F  GGSL         R    C          +      I+L H+   L Y+H   ++ H D+KP N+   M     N   + +++      D   +     LR       +K+ D G   +      ++EGD RYLP   L+++ SN  LF +  DI++LG+T+F+  GG     N      +R G     P ++S ++  LI +M H     R T++ I 
Sbjct:  227 LHDTNISRFKREFMQVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAG--SSFEKRALNEVWAHAVLGKHDNVVRYYSAWAEDDHMLIQNEFCDGGSL-------HARIQDHC----------LGEAELKIVLMHVIEGLRYIHSN-DLVHMDLKPENIFSTM---NPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTYKIGDLGHVTSVKEPY-VEEGDCRYLPKEILHEDYSN--LFKA--DIFSLGITLFEAAGGGPLPKNGPEWHNLRDGKVPILP-SLSRDFNELIAQMMHPYPDKRPTSQSIF 512          
BLAST of Wee1-like protein kinase vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 58.151 bits (139), Expect = 1.512e-8
Identity = 62/251 (24.70%), Postives = 106/251 (42.23%), Query Frame = 1
Query:  667 EVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTI------FDCFGGIINQESA--SAIRKGNWE---KWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            EV+++  +  H H++    +  ++   +L L ++SGG L D          AI  ++      R S   + IM+ H+ + + Y+H  + I H DIKP N+LV             KL+ H  +L+         KL DFG +   ++++    G   Y+         Y L     D++A G+ +      F  F    NQ+     AI  G +E    +   I +  + LI  M   D   R+T+ +IL+
Sbjct:  523 EVRVMKKL-NHPHIISLILSVDQNTNMYLVLEYVSGGDLFD----------AITQVT------RFSENQSRIMIRHLGAAMTYLHS-MGIVHRDIKPENLLV-------------KLDEHGNVLE--------LKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGL---KIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILD 731          
BLAST of Wee1-like protein kinase vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111277)

HSP 1 Score: 58.151 bits (139), Expect = 1.512e-8
Identity = 62/251 (24.70%), Postives = 106/251 (42.23%), Query Frame = 1
Query:  667 EVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTI------FDCFGGIINQESA--SAIRKGNWE---KWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            EV+++  +  H H++    +  ++   +L L ++SGG L D          AI  ++      R S   + IM+ H+ + + Y+H  + I H DIKP N+LV             KL+ H  +L+         KL DFG +   ++++    G   Y+         Y L     D++A G+ +      F  F    NQ+     AI  G +E    +   I +  + LI  M   D   R+T+ +IL+
Sbjct:  523 EVRVMKKL-NHPHIISLILSVDQNTNMYLVLEYVSGGDLFD----------AITQVT------RFSENQSRIMIRHLGAAMTYLHS-MGIVHRDIKPENLLV-------------KLDEHGNVLE--------LKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGL---KIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILD 731          
BLAST of Wee1-like protein kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 54.6842 bits (130), Expect = 1.960e-7
Identity = 42/151 (27.81%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  568 LCQHRFNSQYYVVKSGYKSNSHCLSESSR-EIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKL 1017
            LC+HR + ++Y VK   K+     S S+  +   EV+I+   G H ++V  Y  + +    +L +  + GG L+D       R  A+  + + E         A  +L  I+S + Y+HE   + H D+KPSN++   +R T   L +  L
Sbjct:  584 LCEHRASKKHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLD-------RILAVGQMCESE---------ASAVLRTIASAVAYLHE-HGVVHRDLKPSNMIYASMRQTPETLKLCDL 717          
BLAST of Wee1-like protein kinase vs. Ensembl Zebrafish
Match: wee1 (WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GENE-030131-5268])

HSP 1 Score: 99.7525 bits (247), Expect = 4.554e-22
Identity = 81/307 (26.38%), Postives = 139/307 (45.28%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            + E N+M S+Y ++      I S +   ++ C  R +   Y +K   K  +  + E +   + EV    ++G+H HVV +Y AW ED+   +Q  + +GG+L D I  N+ R             + +S      +L  +S  L Y+H    + H DIKPSN+ +   R  +  +   + E      +  P   + +K+ D G     +N  +++EGD R+L    L ++ SN        DI+AL LT+    G      N +    IR+G     P+ +S+ +  L+K M H D   R +  E++
Sbjct:   87 MMENNMM-SRYASEFHELEKIGSGQFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQN--ALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENNRRM------------HFLSELELKDLLLQVSRGLKYIHSTA-LVHMDIKPSNIFIS--RKPAASVEEFEDE------EDGPTTNVVYKIGDLGHVTTVTNP-QVEEGDSRFLANEVLQEDYSNL----KKADIFALALTVVSASGAEPLPTNGDKWHKIRQGILPHIPQVLSQEFLSLLKLMIHPDPTRRPSTSELV 364          
BLAST of Wee1-like protein kinase vs. Ensembl Zebrafish
Match: wee1 (WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GENE-030131-5268])

HSP 1 Score: 100.138 bits (248), Expect = 8.112e-22
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            + E N+M S+Y ++      I S +   ++ C  R +   Y +K   K  +  + E  +  + EV    ++G+H HVV +Y AW ED+   +Q  + +GG+L D I  N+ R             + +S      +L  +S  L Y+H    + H DIKPSN+ +          S+ + E      +  P   + +K+ D G     +N  +++EGD R+L    L ++ SN        DI+AL LT+    G      N +    IR+G     P+ +S+ +  L+K M H D   R +  E++
Sbjct:  252 MMENNMM-SRYASEFHELEKIGSGQFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDE--QNALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENNRRM------------HFLSELELKDLLLQVSRGLKYIHSTA-LVHMDIKPSNIFISRKPAA----SVEEFEDE----EDGPTTNVVYKIGDLGHVTTVTNP-QVEEGDSRFLANEVLQEDYSNL----KKADIFALALTVVSASGAEPLPTNGDKWHKIRQGILPHIPQVLSQEFLSLLKLMIHPDPTRRPSTSELV 529          
BLAST of Wee1-like protein kinase vs. Ensembl Zebrafish
Match: wee1 (WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GENE-030131-5268])

HSP 1 Score: 100.138 bits (248), Expect = 8.112e-22
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            + E N+M S+Y ++      I S +   ++ C  R +   Y +K   K  +  + E  +  + EV    ++G+H HVV +Y AW ED+   +Q  + +GG+L D I  N+ R             + +S      +L  +S  L Y+H    + H DIKPSN+ +          S+ + E      +  P   + +K+ D G     +N  +++EGD R+L    L ++ SN        DI+AL LT+    G      N +    IR+G     P+ +S+ +  L+K M H D   R +  E++
Sbjct:  252 MMENNMM-SRYASEFHELEKIGSGQFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDE--QNALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENNRRM------------HFLSELELKDLLLQVSRGLKYIHSTA-LVHMDIKPSNIFISRKPAA----SVEEFEDE----EDGPTTNVVYKIGDLGHVTTVTNP-QVEEGDSRFLANEVLQEDYSNL----KKADIFALALTVVSASGAEPLPTNGDKWHKIRQGILPHIPQVLSQEFLSLLKLMIHPDPTRRPSTSELV 529          
BLAST of Wee1-like protein kinase vs. Ensembl Zebrafish
Match: wee1 (WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GENE-030131-5268])

HSP 1 Score: 100.138 bits (248), Expect = 8.112e-22
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            + E N+M S+Y ++      I S +   ++ C  R +   Y +K   K  +  + E  +  + EV    ++G+H HVV +Y AW ED+   +Q  + +GG+L D I  N+ R             + +S      +L  +S  L Y+H    + H DIKPSN+ +          S+ + E      +  P   + +K+ D G     +N  +++EGD R+L    L ++ SN        DI+AL LT+    G      N +    IR+G     P+ +S+ +  L+K M H D   R +  E++
Sbjct:  252 MMENNMM-SRYASEFHELEKIGSGQFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDE--QNALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENNRRM------------HFLSELELKDLLLQVSRGLKYIHSTA-LVHMDIKPSNIFISRKPAA----SVEEFEDE----EDGPTTNVVYKIGDLGHVTTVTNP-QVEEGDSRFLANEVLQEDYSNL----KKADIFALALTVVSASGAEPLPTNGDKWHKIRQGILPHIPQVLSQEFLSLLKLMIHPDPTRRPSTSELV 529          
BLAST of Wee1-like protein kinase vs. Ensembl Zebrafish
Match: wee2 (WEE1 homolog 2 (S. pombe) [Source:NCBI gene;Acc:327471])

HSP 1 Score: 76.6406 bits (187), Expect = 2.082e-14
Identity = 78/302 (25.83%), Postives = 126/302 (41.72%), Query Frame = 1
Query:  508 MYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELD 1392
            M S+Y ++ L    I   +   +Y C  R +   Y +K   +  +   +E  +  + EV    ++G H HVV +Y AW ED+   +Q  +  GGSL D I              K E+    S      +L  +S  L Y+H    + H DIKPSN+ +   R T +       E       S     + +K+ D G   + S+  +++EGD R+L          HL  +  DI+ALGLT+    G      N +    +R+G     P  +   ++ L+K +   D   R +A  +   D
Sbjct:  175 MLSRYESEFLELACIGVGEFGSVYRCVKRLDGCMYAIKRSRRPIAGSANE--QLALKEVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCDGGSLHDAIT------------EKREQGEFFSVPELRDLLLQVSMGLKYIHNS-GLVHLDIKPSNIFI-CRRSTLSAGGEGDSEEEDESHSSG----VVYKIGDLGHVTSISSP-QVEEGDSRFLAYEVLREDYTHLPKA--DIFALGLTVLLAAGASPLPQNGDDWHRLRQGELPNLPHELPALFKDLLKSLLDPDPTARPSATALCRHD 453          
BLAST of Wee1-like protein kinase vs. Ensembl Xenopus
Match: ENSXETT00000020125.1 (WEE1 homolog 2 [Source:NCBI gene;Acc:100125126])

HSP 1 Score: 68.1662 bits (165), Expect = 9.016e-12
Identity = 57/186 (30.65%), Postives = 87/186 (46.77%), Query Frame = 1
Query:  448 SSSPVEKYI-KDYPKLF--------ETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSRE--IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPS 960
            S+ P  KY  K++P +F        ETN M S+Y  + L    I + +   ++ C  R +  +Y +K   K     L+ S+ E   + EV    ++G H HVV +Y AW ED+   +Q  + +GGSL D I+ N           K E R+ +       +L  +S  L Y+H    + H DIKPS
Sbjct:  181 SAEPQMKYAEKEHPAVFQSKRFVLRETN-MVSRYKTEFLEIEKIGAGEFGSVFKCVKRLDGCFYAIKRSKKP----LAGSTDEQLALREVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCNGGSLQDLIMEN-----------KKEGRF-VPEQELKEILLQVSMGLKYIHSS-GLVHIDIKPS 348          
BLAST of Wee1-like protein kinase vs. Ensembl Xenopus
Match: rps6ka1 (ribosomal protein S6 kinase A1 [Source:NCBI gene;Acc:100144704])

HSP 1 Score: 60.077 bits (144), Expect = 7.233e-9
Identity = 69/325 (21.23%), Postives = 124/325 (38.15%), Query Frame = 1
Query:  484 PKLFETNVMYSK-YINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGGIINQESASA----------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            PK    NV+++  Y  +  I     S    C H+  +  Y VK         + ++ R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A ++L  +   + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     +                   +R GNW     T+S++ + L+ +M H D   R TA+++L+
Sbjct:  352 PKTHSKNVLFTDVYTVRETIGVGSYSVCKRCVHKGTNMEYAVK--------VIDKTKRDPSEEIEILRRYGQHPNIITLKDVYEEGNSIYLVTELMRGGELLDRI---------------LRQKF-FSEREANLVLLTVCKTVEYLHSQ-GVVHRDLKPSNIL---------------------YVDESGNPE-SIRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILVYTMLAGYTPFANGPGDTPEEILARIGSGKFTLRGGNWN----TVSDSAKDLVSRMLHVDPHRRLTAKQVLQ 618          
BLAST of Wee1-like protein kinase vs. Ensembl Xenopus
Match: rps6ka1 (ribosomal protein S6 kinase A1 [Source:NCBI gene;Acc:100144704])

HSP 1 Score: 59.6918 bits (143), Expect = 8.296e-9
Identity = 69/325 (21.23%), Postives = 124/325 (38.15%), Query Frame = 1
Query:  484 PKLFETNVMYSK-YINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGGIINQESASA----------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            PK    NV+++  Y  +  I     S    C H+  +  Y VK         + ++ R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A ++L  +   + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     +                   +R GNW     T+S++ + L+ +M H D   R TA+++L+
Sbjct:  362 PKTHSKNVLFTDVYTVRETIGVGSYSVCKRCVHKGTNMEYAVK--------VIDKTKRDPSEEIEILRRYGQHPNIITLKDVYEEGNSIYLVTELMRGGELLDRI---------------LRQKF-FSEREANLVLLTVCKTVEYLHSQ-GVVHRDLKPSNIL---------------------YVDESGNPE-SIRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILVYTMLAGYTPFANGPGDTPEEILARIGSGKFTLRGGNWN----TVSDSAKDLVSRMLHVDPHRRLTAKQVLQ 628          
BLAST of Wee1-like protein kinase vs. Ensembl Xenopus
Match: rps6ka1 (ribosomal protein S6 kinase A1 [Source:NCBI gene;Acc:100144704])

HSP 1 Score: 59.6918 bits (143), Expect = 9.054e-9
Identity = 69/325 (21.23%), Postives = 124/325 (38.15%), Query Frame = 1
Query:  484 PKLFETNVMYSK-YINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGGIINQESASA----------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            PK    NV+++  Y  +  I     S    C H+  +  Y VK         + ++ R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A ++L  +   + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     +                   +R GNW     T+S++ + L+ +M H D   R TA+++L+
Sbjct:  403 PKTHSKNVLFTDVYTVRETIGVGSYSVCKRCVHKGTNMEYAVK--------VIDKTKRDPSEEIEILRRYGQHPNIITLKDVYEEGNSIYLVTELMRGGELLDRI---------------LRQKF-FSEREANLVLLTVCKTVEYLHSQ-GVVHRDLKPSNIL---------------------YVDESGNPE-SIRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILVYTMLAGYTPFANGPGDTPEEILARIGSGKFTLRGGNWN----TVSDSAKDLVSRMLHVDPHRRLTAKQVLQ 669          
BLAST of Wee1-like protein kinase vs. Ensembl Xenopus
Match: rps6ka1 (ribosomal protein S6 kinase A1 [Source:NCBI gene;Acc:100144704])

HSP 1 Score: 59.6918 bits (143), Expect = 9.379e-9
Identity = 73/337 (21.66%), Postives = 128/337 (37.98%), Query Frame = 1
Query:  448 SSSPVEKYIKDYPKLFETNVMYSK-YINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGGIINQESASA----------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            SS PV       PK    NV+++  Y  +  I     S    C H+  +  Y VK         + ++ R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A ++L  +   + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     +                   +R GNW     T+S++ + L+ +M H D   R TA+++L+
Sbjct:  396 SSPPV----LSVPKTHSKNVLFTDVYTVRETIGVGSYSVCKRCVHKGTNMEYAVK--------VIDKTKRDPSEEIEILRRYGQHPNIITLKDVYEEGNSIYLVTELMRGGELLDRI---------------LRQKF-FSEREANLVLLTVCKTVEYLHSQ-GVVHRDLKPSNIL---------------------YVDESGNPE-SIRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILVYTMLAGYTPFANGPGDTPEEILARIGSGKFTLRGGNWN----TVSDSAKDLVSRMLHVDPHRRLTAKQVLQ 670          
BLAST of Wee1-like protein kinase vs. Ensembl Mouse
Match: Wee1 (WEE 1 homolog 1 (S. pombe) [Source:MGI Symbol;Acc:MGI:103075])

HSP 1 Score: 94.3597 bits (233), Expect = 7.112e-20
Identity = 83/307 (27.04%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  508 MYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYI----MLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGGI----INQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            M S+Y  +      I S +   ++ C  R +   Y +K   K  +  + E  +  + EV    ++G+H HVV ++ AW ED+   +Q  + +GGSL D I  N                YR+ S    +    +L  +   L Y+H  +++ H DIKPSN+ +          S+          D   + ++ FK+ D G     S+  +++EGD R+L    L +N S  HL  +  DI+AL LT+  C  G      N E    IR+G   + P+ +S+    L++ M H D   R +A E+++
Sbjct:  290 MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDE--QNALREVYAHAVLGQHPHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISEN----------------YRVMSYLTEVELKDLLLQVGRGLRYIHS-MSLVHMDIKPSNIFISRT-------SIPNAVSEEGDEDDWISNKVMFKIGDLGHVTRISSP-QVEEGDSRFLANEVLQENYS--HLPKA--DIFALALTVV-CAAGAEPLPRNGEQWHEIRQGRLPRIPQVLSQEVTELLRVMIHPDPERRPSAMELVK 564          
BLAST of Wee1-like protein kinase vs. Ensembl Mouse
Match: Wee2 (WEE1 homolog 2 (S. pombe) [Source:MGI Symbol;Acc:MGI:3027899])

HSP 1 Score: 89.7373 bits (221), Expect = 1.761e-18
Identity = 91/304 (29.93%), Postives = 140/304 (46.05%), Query Frame = 1
Query:  490 LFETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNS---NRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            L ETN M S+Y  +      I   +   +Y C  R +   Y +K   KS S   +E     ++EV    ++G H HVV +Y +WIED+   +Q  + +GGSL   I  N+   N F       KL+            +L  IS  L Y+H    + H DIKPSN+ +       + +   + E  +   D   N  + +K+ D G + + S   K++EGD R+L       +  HL  +  DI+ALGLTI    G     IN +    IRKGN+ +  + +S+++  L+K M H     R +A
Sbjct:  195 LQETN-MASRYEKEFFEIEKIGVGEFGTVYKCIKRLDGCIYAIKRSAKSFSGLSNELD---LHEVYAHAVLGHHPHVVRYYSSWIEDDHVVIQNEYCNGGSLQAAISENTASNNHF----QEPKLKD-----------ILLQISLGLKYIHNS-GMVHLDIKPSNIFICHKMQCDSPVGPEEAESEA---DWFLNASVMYKIGDLGHATSISKP-KVEEGDTRFLANEILQENYQHLPKA--DIFALGLTIAVAAGAESLPINGDMWHHIRKGNFPEISQELSDDFYGLLKNMIHPAPKERPSA 472          
BLAST of Wee1-like protein kinase vs. Ensembl Mouse
Match: Rps6ka1 (ribosomal protein S6 kinase polypeptide 1 [Source:MGI Symbol;Acc:MGI:104558])

HSP 1 Score: 60.8474 bits (146), Expect = 2.414e-9
Identity = 73/324 (22.53%), Postives = 125/324 (38.58%), Query Frame = 1
Query:  487 KLFETNVMYS-KYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGG---IINQESAS-------------AIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            +L   N+++S  Y+ K  I     S    C H+  +  Y VK         + +S R+   E++IL   G+H +++   D + + +  +L    + GG L+D                K+ ++   S   A  +L  IS  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     N  S +              +  GNW     T+SE  + L+ KM H D   R TA+++L+
Sbjct:  296 QLHGKNLVFSDGYVVKETIGVGSYSVCKRCVHKATNMEYAVK--------VIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLD----------------KILRQKFFSEREASFVLHTISKTVEYLHSQ-GVVHRDLKPSNILY---------------------VDESGNPEC-LRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNW----NTVSETAKDLVSKMLHVDPHQRLTAKQVLQ 561          
BLAST of Wee1-like protein kinase vs. Ensembl Mouse
Match: Rps6ka1 (ribosomal protein S6 kinase polypeptide 1 [Source:MGI Symbol;Acc:MGI:104558])

HSP 1 Score: 61.2326 bits (147), Expect = 2.473e-9
Identity = 73/324 (22.53%), Postives = 125/324 (38.58%), Query Frame = 1
Query:  487 KLFETNVMYS-KYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGG---IINQESASA-------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            +L   N+++S  Y+ K  I     S    C H+  +  Y VK         + +S R+   E++IL   G+H +++   D + + +  +L    + GG L+D                K+ ++   S   A  +L  IS  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     N  S +              +  GNW     T+SE  + L+ KM H D   R TA+++L+
Sbjct:  407 QLHGKNLVFSDGYVVKETIGVGSYSVCKRCVHKATNMEYAVK--------VIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLD----------------KILRQKFFSEREASFVLHTISKTVEYLHSQ-GVVHRDLKPSNILY---------------------VDESGNPEC-LRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWN----TVSETAKDLVSKMLHVDPHQRLTAKQVLQ 672          
BLAST of Wee1-like protein kinase vs. Ensembl Mouse
Match: Rps6ka1 (ribosomal protein S6 kinase polypeptide 1 [Source:MGI Symbol;Acc:MGI:104558])

HSP 1 Score: 60.8474 bits (146), Expect = 2.568e-9
Identity = 74/324 (22.84%), Postives = 126/324 (38.89%), Query Frame = 1
Query:  487 KLFETNVMYS-KYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSR-----DIYALGLTIFDCFGG---IINQESASA-------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            +L   N+++S  Y+ K  I     S    C H+  +  Y VK         + +S R+   E++IL   G+H +++   D + + +  +L    + GG L+D I               L +++  S   A  +L  IS  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +          DI++LG+ ++    G     N  S +              +  GNW     T+SE  + L+ KM H D   R TA+++L+
Sbjct:  412 QLHGKNLVFSDGYVVKETIGVGSYSVCKRCVHKATNMEYAVK--------VIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKI---------------LRQKF-FSEREASFVLHTISKTVEYLHSQ-GVVHRDLKPSNILY---------------------VDESGNPEC-LRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWN----TVSETAKDLVSKMLHVDPHQRLTAKQVLQ 677          
BLAST of Wee1-like protein kinase vs. UniProt/SwissProt
Match: sp|A4QNA8|WEE2_XENTR (Wee1-like protein kinase 2 OS=Xenopus tropicalis OX=8364 GN=wee2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.243e-21
Identity = 95/327 (29.05%), Postives = 150/327 (45.87%), Query Frame = 1
Query:  448 SSSPVEKYI-KDYPKLF--------ETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSRE--IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRY-TSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            S+ P  KY  K++P +F        ETN M S+Y  + L    I + +   ++ C  R +  +Y +K   K     L+ S+ E   + EV    ++G H HVV +Y AW ED+   +Q  + +GGSL D I+ N           K E R+ +       +L  +S  L Y+H    + H DIKPSN+ +   +     D S  + +  SA         + +K+ D G   +  N  +++EGD R+L   N+     +      DI+ALGLTI    G      N++S   IRKGN    P+ ++  +  L+K + H D + R  A
Sbjct:  181 SAEPQMKYAEKEHPAVFQSKRFVLRETN-MVSRYKTEFLEIEKIGAGEFGSVFKCVKRLDGCFYAIKRSKKP----LAGSTDEQLALREVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCNGGSLQDLIMEN-----------KKEGRF-VPEQELKEILLQVSMGLKYIHSS-GLVHMDIKPSNIFICRKQTEVGQDESDGEDDLSSA--------SVLYKIGDLGHVTSILNP-QVEEGDSRFL--ANEILQEDYRQLPKADIFALGLTITLAAGAGPLPCNEDSWHHIRKGNLPHIPQPLTPAFLALLKLLVHPDPVMRPPA 478          
BLAST of Wee1-like protein kinase vs. UniProt/SwissProt
Match: sp|O57473|WEE2B_XENLA (Wee1-like protein kinase 2-B OS=Xenopus laevis OX=8355 GN=wee2-b PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.490e-19
Identity = 89/317 (28.08%), Postives = 144/317 (45.43%), Query Frame = 1
Query:  475 KDYPKLF--------ETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSRE--IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRY-TSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTI---FDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            K++P +F        ETN M S+Y  + L    I + +   ++ C  R +  +YV+K   K     L+ S+ E   + EV    ++G H HVV +Y AW ED+   +Q  + +GGSL D I+ N+ +   + +    E            +L  +S  L Y+H    + H DIKPSN+ +   +     D S  + +  SA         + +K+ D G   +  N  +++EGD R+L   N+     +      DI+ALGLTI           N++    IRKGN    P+ ++  +  L+K + H D  TR  A
Sbjct:  187 KEHPAVFQSKRFVLRETN-MESRYKTEFLEIEKIGAGEFGSVFKCVKRLDGCFYVIKRSKKP----LAGSTDEQLALREVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCNGGSLQDLIMENNKKGQFVPEQELKE------------ILLQVSMGLKYIHGS-GLVHMDIKPSNIFICRKQTEVGEDESDGEDDVASA--------SVLYKIGDLGHVTSILNP-QVEEGDSRFL--ANEILQEDYRQLPKADIFALGLTIALAAGAAPLPCNEDGWHHIRKGNLPHIPQPLTPAFLALLKLLVHPDPATRPPA 474          
BLAST of Wee1-like protein kinase vs. UniProt/SwissProt
Match: sp|P0C1S8|WEE2_HUMAN (Wee1-like protein kinase 2 OS=Homo sapiens OX=9606 GN=WEE2 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 1.682e-19
Identity = 94/306 (30.72%), Postives = 146/306 (47.71%), Query Frame = 1
Query:  490 LFETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNS---NRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSA-LLDSNPNPRLRFKLCDFGRSGATS-NVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            L ETN M S+Y  + L    I   +   +Y C  R +   Y +K   K+ +   +E+S   ++EV    ++G H HVV +Y +W ED+   +Q  + +GGSL   I  N+   N F    +  KL+            +L  IS  L Y+H   ++ H DIKPSN+ +     + +   + ++E  +   L +N    + +K+ D G   ATS N  K++EGD R+L          HL  +  DI+ALGLTI    G      N  +   IRKGN+   P+ +SE++  L+K M   D   R +A
Sbjct:  199 LRETN-MASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENS--ALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAAISENTKSGNHF----EEPKLKD-----------ILLQISLGLNYIHNS-SMVHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLSAN----VMYKIGDLGH--ATSINKPKVEEGDSRFLANEILQEDYRHLPKA--DIFALGLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSA 477          
BLAST of Wee1-like protein kinase vs. UniProt/SwissProt
Match: sp|Q6DFE0|WEE2C_XENLA (Wee1-like protein kinase 2-C OS=Xenopus laevis OX=8355 GN=wee2-c PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.881e-19
Identity = 89/317 (28.08%), Postives = 144/317 (45.43%), Query Frame = 1
Query:  475 KDYPKLF--------ETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSRE--IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRY-TSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTI---FDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            K++P +F        ETN M S+Y  + L    I + +   ++ C  R +  +YV+K   K     L+ S+ E   + EV    ++G H HVV +Y AW ED+   +Q  + +GGSL D I+ N+ +   + +    E            +L  +S  L Y+H    + H DIKPSN+ +   +     D S  + +  SA         + +K+ D G   +  N  +++EGD R+L   N+     +      DI+ALGLTI           N++    IRKGN    P+ ++  +  L+K + H D  TR  A
Sbjct:  187 KEHPSVFQSKRFVLRETN-MESRYKTEFLEIEKIGAGEFGSVFKCVKRLDGCFYVIKRSKKP----LAGSTDEQLALREVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCNGGSLQDLIMENNKKGQFVPEQELKE------------ILLQVSMGLKYIHGS-GLVHMDIKPSNIFICRKQTEVGEDESDGEDDVSSA--------SVLYKIGDLGHVTSILNP-QVEEGDSRFL--ANEILQEDYRQLPKADIFALGLTIALAAGAAPLPCNEDGWHHIRKGNLPHIPQPLTPAFLALLKLLVHPDPATRPPA 474          
BLAST of Wee1-like protein kinase vs. UniProt/SwissProt
Match: sp|P30291|WEE1_HUMAN (Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 4.055e-19
Identity = 83/311 (26.69%), Postives = 139/311 (44.69%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISS----CSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGI----INQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            + E+N M S+Y  +      I S +   ++ C  R +   Y +K   K  +  + E +   + EV    ++G+HSHVV ++ AW ED+   +Q  + +GGSL D I  N                YRI S         +L  +   L Y+H  +++ H DIKPSN+ +          S+          D   + ++ FK+ D G     S+  +++EGD R+L       +  HL  +  DI+AL LT+  C  G      N +    IR+G   + P+ +S+ +  L+K M H D   R +A  +++
Sbjct:  286 ITESN-MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQN--ALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISEN----------------YRIMSYFKEAELKDLLLQVGRGLRYIHS-MSLVHMDIKPSNIFISRT-------SIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSP-QVEEGDSRFLANEVLQENYTHLPKA--DIFALALTVV-CAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVK 565          
BLAST of Wee1-like protein kinase vs. TrEMBL
Match: A0A5K3FSD8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.749e-31
Identity = 102/344 (29.65%), Postives = 168/344 (48.84%), Query Frame = 1
Query:  481 YPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSR-------EIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSL-------------------IDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVR------YTSNDL-SMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDE-GDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKCFI 1410
            +  +F +      Y     +S T+L+ +YL +HR     + +K      S C SE  +       E+ NEV+ L ++ KH+++V +Y++W+E     +QL F  GGSL                   +D   GN++    + D  +L  R R+   +  ++LAHISS L Y+H   ++ HGD+KPSN+L+ + +      YT +++   AK  C+S L  ++P+  + FKL DFGR+         D  GDGRYLP L+D  S     A  RDIYALG+T++   GG +N      +R          +  + + ++K M       R TA E++   +++ F+
Sbjct:  230 FSPMFNSPCAVGSYSFLTELSRTRLAIVYLGRHRLTGILHCLK-----RSRCESEREKNFGSTLPEMYNEVQALAIL-KHNNIVQYYNSWLEAGSIFMQLEFCLGGSLFHYLHPGRPLDTCHSLQKTVDRPNGNADA-SVVSDSMELVGR-RLPLAALTMLLAHISSALSYLHSTWSMVHGDVKPSNILIQLKQAENHPAYTKDEMVHEAKSLCYSILESTDPS-GVDFKLADFGRASKAGEDRDGDNLGDGRYLPRLDDPGSP-ECAAIGRDIYALGVTMYHAAGGPMNSSVWEHLRAVGSVPDLSVVPSSLRPIVKNMLKPLSQDRPTAAEVINWPSLRPFL 563          
BLAST of Wee1-like protein kinase vs. TrEMBL
Match: A0A5J4NC56 (Wee1-like protein kinase OS=Paragonimus westermani OX=34504 GN=DEA37_0004917 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.691e-30
Identity = 106/356 (29.78%), Postives = 165/356 (46.35%), Query Frame = 1
Query:  457 PVEKYIKDYP----KLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSE-------SSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFI---------------------VGNSNRFCA-------ICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVR---YTSNDLSMAKLE----CHSALLDSNPNPRLRFKLCDFGR-SGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            P EK+ ++ P     +F  N +   + N   IS T+L+ +Y  +HR +   Y +K      S C  E       SS E++NEV+ L L+ +H +++ FY +W E +  + QL F  GGSL  F+                      GN +           +   S   K   +S  S +++ AHI   L Y+H   ++ HGD+KPSN+L+ + R   Y ++     +LE    CH  LL  +    L FKL DFGR S A  +    D GDGRYLP LND S      A+ RD+YALG+T++   GG ++      +R+ +       +  +   ++K +       R TA E++
Sbjct:  261 PGEKFSEERPVGINPIFNCNNLAGSFSNITDISRTRLAVLYKARHRLSGVLYCLK-----RSRCEFEVERPYGSSSAEMLNEVQALALL-QHPNIIRFYGSWYEADSIYTQLEFCLGGSLFHFLHPDRQLDTSEAVPRITSSLMEFGNVDDLTEANCVDSNVASPSSATKANVLSEKSLHVLTAHILGALHYIHTNWSMVHGDVKPSNILIQLARPEAYLASTKEFIELEAKHHCHKLLLAGDTTGIL-FKLSDFGRASRAGEDRDGEDLGDGRYLPRLNDPSPPARA-ATGRDLYALGITLYHAAGGPMSASVWERLREADCLPDLSVLPTSLMPVVKGLLRPLAQDRPTAAELV 608          
BLAST of Wee1-like protein kinase vs. TrEMBL
Match: A0A3P6HUQ3 (Protein kinase domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3466 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.751e-29
Identity = 106/348 (30.46%), Postives = 166/348 (47.70%), Query Frame = 1
Query:  481 YPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSR-------EIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSL-------------------IDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVR------YTSNDL-SMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDE-GDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKD-EMTRYTAREILELDNVKCFIQPE 1419
            +  +F +      Y     +S T+L+ +YL +HR     + +K      S C SE  +       E+ NEV+ L ++ KH+++V +Y++W+E     +QL F  GGSL                   +D   GN++    + D  +L  R R+   +  ++LAHISS L Y+H   ++ HGD+KPSN+L+ + +      YT +++   AK  C+S L  ++P+  + FKL DFGR+         D  GDGRYLP L+D  S     A  RDIYALG+T++   GG +N                   S  W+ L    S  D  +   + R I++LD   CF+  E
Sbjct:   61 FSPMFNSPCAVGSYSFLTELSRTRLAIVYLGRHRLTGILHCLK-----RSRCESEREKNFGSTLPEMYNEVQALAIL-KHNNIVQYYNSWLEAGSIFMQLEFCLGGSLFHYLHPGRPLDTCHSLQKTVDRPNGNADA-SVVSDSMELVGR-RLPLAALTMLLAHISSALSYLHSTWSMVHGDVKPSNILIQLKQAENHPAYTKDEMVHEAKSLCYSILESTDPS-GVDFKLADFGRASKAGEDRDGDNLGDGRYLPRLDDPGSP-ECAAIGRDIYALGVTMYHAAGGPMN-------------------SSVWEHLRAVGSVPDLSVVPSSLRPIVKLDT--CFVYSE 377          
BLAST of Wee1-like protein kinase vs. TrEMBL
Match: H2KVT2 (Wee1-like protein kinase OS=Clonorchis sinensis OX=79923 GN=Wee1 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 9.920e-29
Identity = 108/373 (28.95%), Postives = 170/373 (45.58%), Query Frame = 1
Query:  442 PDSSSPVEKYIKDYPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSE-------SSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSL----------------------IDFIVGNSNRFCAI---------CDISK----LEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVR---YTSNDLSMAKLE----CHSALLDSNPNPRLRFKLCDFGR-SGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKCFI 1410
            P   S  E+ I   P +F  N +   + N   IS T+L+ +Y  +HR +   Y +K      S C  E       SS E++NEV+ L L+ +H +++ FY +W E +  + QL F  GGSL                      +D + GN+    A          C  S       +R  ++  +  ++ AH+   L YMH   ++ HGD+KPSN+L+ + R   Y ++     +LE    CH  LL +     + FKL DFGR S A  +    D GDGRYLP LND S      A+ RD+YALG+T++D  GG ++      +R+ +       +  +   ++K +       R TA E++     + F+
Sbjct:   94 PGEVSGEERPITIDP-VFNCNNLAGSFSNISDISRTRLAVLYKARHRLSGVLYCLK-----RSRCEFEVERPFGGSSGEMLNEVQALALL-QHPNIIRFYGSWHEADSIYTQLEFCLGGSLFHFLHPDRQLDTSEAIPRTFSPMDLVNGNATSKDAASEQHQQPDDCSTSPSSTDAARRTGLAEKALLVLAAHMLGALYYMHTNWSMVHGDVKPSNILIQLTRPEAYLASTKEFIELEAKQHCHK-LLHAGETTGILFKLGDFGRASRAGEDRDGEDLGDGRYLPRLNDPSPPARA-ATGRDMYALGITLYDAAGGPMSPSVWERLRETDCLPDLSVLPNSLMSVVKGLLRPLAQDRPTAAELVNCPLFRPFL 457          
BLAST of Wee1-like protein kinase vs. TrEMBL
Match: A0A095CET5 (Wee1-like protein kinase OS=Schistosoma haematobium OX=6185 GN=MS3_09836 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.932e-28
Identity = 98/316 (31.01%), Postives = 154/316 (48.73%), Query Frame = 1
Query:  454 SPVEKYIKDYP----KLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYK--SNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIV----GNSNRFCAICDISKLEK---------------RYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSM-------AKLECHSALLDSNPNPRLRFKLCDFGR-SGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRT 1302
            +P EKY ++ P     +F  N +   + N + I  T+L+ +Y  +HR +   Y +K         H    SS E++NEV+ L L+ +HS+++ F+ +W E +  + QL    GGSL   +      +++   ++   + ++                R R+S     ++ +H+ S L YMH   ++ HGD+KPSN+L+ + R  +   S        AK  CH  LL  +    + FKL DFGR S A  +    D GDGRYLP LND S      A+ RD+YALG+T++   GG +   SAS      WE+   T
Sbjct:  221 TPGEKYQEERPIGMNPIFNCNNLAGSFSNLVDICRTRLAVLYKARHRLSGVLYCLKRSRCDFELEHLNGSSSVEMLNEVQALALL-QHSNIIRFFGSWYEADSVYTQLELCLGGSLFHLLYPDRQNDTSEAVSLVSTNHIDNEIPGSPTSGSPSDANRNRLSEKPLIVLASHVLSALHYMHTNWSMVHGDVKPSNILIQLSRPEAYLASAKECIEMDAKRHCHKLLLAGD-TAGIVFKLSDFGRASRAGEDRDGEDLGDGRYLPRLNDPSPPARA-ATGRDLYALGITLYHSAGGPM---SASV-----WERLRET 525          
BLAST of Wee1-like protein kinase vs. Ensembl Cavefish
Match: wee1 (WEE1 G2 checkpoint kinase [Source:NCBI gene;Acc:103022665])

HSP 1 Score: 99.7525 bits (247), Expect = 8.841e-22
Identity = 83/307 (27.04%), Postives = 141/307 (45.93%), Query Frame = 1
Query:  490 LFETNVMYSKYINKI----LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            + E N+M S+Y ++      I S +   ++ C  R +   Y +K   K  +  + E +   + EV    ++G+H HVV +Y AW ED+   +Q  + +GG+L D I  N  R             + +S      +L  +S  L Y+H  + + H DIKPSN+ +   R  +  +   + E   A      N  + +K+ D G     +N  +++EGD RYL    L ++ SN     +  DI+AL LT+    G      N E    IR+G     P+ +S+++  L+K M H D   R +  +++
Sbjct:  256 MMENNMM-SRYASEFHELEKIGSGQFGAVFKCVKRLDGCIYAIKRSKKPLAGSVDEQN--ALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENYRRM------------HFLSELELKDLLLQVSRGLKYIHS-MALVHMDIKPSNIFIS--RKPAVSVEEFEDEEDEA------NTSVIYKIGDLGHVTRVTNP-QVEEGDSRYLANEVLQEDYSNL----TKADIFALALTVVSASGAEPLPTNGEKWHQIRQGILPHIPQVLSQDFLSLLKLMIHPDPTRRPSTSDLI 533          
BLAST of Wee1-like protein kinase vs. Ensembl Cavefish
Match: WEE1 (WEE1 G2 checkpoint kinase [Source:HGNC Symbol;Acc:HGNC:12761])

HSP 1 Score: 93.5893 bits (231), Expect = 2.375e-20
Identity = 77/287 (26.83%), Postives = 125/287 (43.55%), Query Frame = 1
Query:  538 ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALL-DSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREI 1380
            I   +   ++ C  R +   Y +K   K  +    E +   + EV    ++G+H  VV +Y +W EDE   +Q  F +GG+L D I  NS R       +KL      S  S   +L  +S  L ++H    + H DIKPSN+ +             K   H A+  D      + +K+ D G     +N  +++EGD R+L    L ++  N        D++A  L++    G      N E   +IR+G     P+ +S  +Q L+K M H D   R +A ++
Sbjct:   54 IGCGEFGAVFKCVKRLDGCIYAIKRSKKPMADSAEEQA--ALREVYAHAVVGQHPQVVRYYSSWTEDEHLLIQSEFCNGGTLADLISENSRR-------TKLP-----SEASLKDLLLQLSRGLKFIHSA-GLVHMDIKPSNIFLSR-----------KSPVHDAITEDDGLYSEVLYKIGDLGHV-THANSPRVEEGDSRFLANEILQEDYRNL----PKADVFAAALSVISAAGAGPLPKNGEPWHSIRRGQLPHIPQLLSPEFQLLLKAMIHPDSSCRPSASDL 309          
BLAST of Wee1-like protein kinase vs. Ensembl Cavefish
Match: wee2 (WEE2 oocyte meiosis inhibiting kinase [Source:NCBI gene;Acc:103034180])

HSP 1 Score: 78.1814 bits (191), Expect = 7.480e-15
Identity = 80/319 (25.08%), Postives = 140/319 (43.89%), Query Frame = 1
Query:  448 SSSPVEKYIKDYPKLFETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSRE--IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGGII---NQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTA 1371
            +SS  E Y     +     +M S++ ++ L    I   +   +Y C  R +   Y +K   +     L+ SS E   + EV    ++G H HVV +Y AW ED+   +Q  +  GGSL+D I              K E+           +L  +S  L Y+H    + H DIKPSN+ +   R + +  ++   E       S+P+  + +K+ D G   + S+  +++EGD R+L    L+++ +         DI+ALGLT+    G      N +    +R+ +    P+ +  + + L++ M   D   R +A
Sbjct:  164 TSSEDESYFLPSKRPAVPALMLSRFESEFLELGRIGVGEFGAVYRCVKRLDGCMYAIKRLRRP----LAGSSNEQLALKEVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCDGGSLLDVIT------------EKEEQGEFFREPELRDLLLQVSMGLKYIH-TSGLVHLDIKPSNIFI-CYRPSCSTGAVGDSEEEDDSYPSSPSSGVVYKIGDLGHVTSVSSP-QVEEGDSRFLAGEVLHEDYTQL----PKADIFALGLTVLLAAGAPPLPQNGDEWHHLRQAHLPSLPQELMPHLRNLLQMMLDPDPAVRPSA 459          
BLAST of Wee1-like protein kinase vs. Ensembl Cavefish
Match: si:ch211-255p10.4 (serine/threonine-protein kinase BRSK2-like [Source:NCBI gene;Acc:103033508])

HSP 1 Score: 56.225 bits (134), Expect = 6.582e-8
Identity = 65/262 (24.81%), Postives = 110/262 (41.98%), Query Frame = 1
Query:  625 NSHCLSESS-REIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDM---VRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIIN------QESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREI 1380
            N   LSES   ++  E+ IL LI +H HV+  +D +  ++  +L L  +SGG L D++V                K+ R++   A      I S L + H   +I H D+KP N+L+D    +R    D  MA L+   +LL+++         C      A   VI+ ++ DGR                   D+++ G+ +F    G +       ++    ++ G +   P  I  + Q L++ M   D   R T  +I
Sbjct:   49 NREKLSESVLMKVEREIAILKLI-EHPHVLKLHDVYENNKYLYLVLEHVSGGELFDYLV----------------KKGRLTPKEARKFFRQIISALDFCHN-HSICHRDLKPENLLLDEKNNIRIA--DFGMASLQVGDSLLETS---------CGSPHY-ACPEVIRGEKYDGRRA-----------------DVWSCGVILFALLVGALPFDHDNLRQLLEKVKSGVFH-MPHFIPPDCQALLRGMIEVDPEKRLTLEDI 262          
BLAST of Wee1-like protein kinase vs. Ensembl Cavefish
Match: rps6ka1 (ribosomal protein S6 kinase a, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-060929-516])

HSP 1 Score: 55.8398 bits (133), Expect = 9.045e-8
Identity = 58/277 (20.94%), Postives = 108/277 (38.99%), Query Frame = 1
Query:  598 YVVKSGYKSNSHC-LSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASA-------------IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            Y ++       HC + ++S +   E++IL   G+H +++   D +   ++ ++    + GG L+D I+                K+   S   A  +L  I+  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG     +  ++ D G       L       +  A     ++L    F CF    N    +              +  GNW+     +S++ + L+ KM H D   R TA+++L+
Sbjct:  405 YSIEHAVTDCGHCVIDKTSTDPSEEIEILLRYGQHPNIITLKDVYDNGKQVYVVTELMRGGELLDRIL----------------KQKFFSEREASAVLHTITKTVEYLHSQ-GVVHRDLKPSNIL---------------------YVDESGNPE-SLRICDFG----FAKQLRADNG------LLMTPCYTANFVAPEVIFFSLFFKSFYCFTPFANGPEDTPEEILSRIGSGHFTVTGGNWD----AVSDSAKELVSKMLHVDPHQRLTAKQVLK 628          
BLAST of Wee1-like protein kinase vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 61.2326 bits (147), Expect = 1.099e-10
Identity = 67/294 (22.79%), Postives = 117/294 (39.80%), Query Frame = 1
Query:  571 CQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHL-----FASSRDIYALGLTIFDCFG-------------GIINQESASA---IRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            C H+  +  Y VK         + +S R+   E++IL   G+H +V+   D + + +  +L    + GG L+D                K+ ++   S   A  +L  I+  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG  +     N + M        P    N     +     + ++ DI++LG+ ++                 G+I     S    +  GNW+    T+SE  + L+KKM H D   R+TA ++L
Sbjct:   29 CIHKTTNMEYAVKV-------IIDKSKRDPSEEIEILLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLD----------------KILRQKFFSEREASAVLQTIARTVEYLHS-QGVVHRDLKPSNIL---------------------YVDESGNPE-SLRICDFGFAKQLRAENGLLMT-------PCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLAGHTPFANGPDDTPGVILTRIGSGRFLLSGGNWD----TVSEAAKDLVKKMLHVDPHQRFTAAQVL 265          
BLAST of Wee1-like protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 3.954e-7
Identity = 59/255 (23.14%), Postives = 103/255 (40.39%), Query Frame = 1
Query:  655 EIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG--RSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGII------NQESASAIRKGNW---EKWPRTISENWQRLIKKMSHKDEMTRYTAREILE 1386
            E+ NE+ I+  + KH++++  YDA+     F L + +I GG L D IV                  Y ++   A I +  I   + YMH+   I H D+KP N+L   V    N +                      K+ DFG  R       +K+  G   +L        NY   +   D+++LG+  +    G+       + E+ + I   NW   ++    +SE  +  I ++  K++  R +A + L+
Sbjct:   74 EVNNEISIMNQL-KHNNLLQLYDAYESKNDFVLIMEYIHGGELFDRIVSED---------------YNLTELDAIIFIRQICEGIHYMHQQY-ILHLDLKPENILC--VNRKGNQI----------------------KIIDFGLARRYKPREKLKVHFGTPEFLAP---EVVNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGEDDNETLTNIVNVNWDFDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLK 284          
BLAST of Wee1-like protein kinase vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 47.3654 bits (111), Expect = 5.160e-6
Identity = 59/251 (23.51%), Postives = 93/251 (37.05%), Query Frame = 1
Query:  517 KYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREI----INEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVD---MVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVI---KMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG 1239
            KY  K ++ S   S +  C H+   Q + VK    +      E   +I    + EV IL  +  H H++   DA+     F L    +  G L D+                L ++  +S      ++  I  V+ ++H   NI H D+KP N+L+D    +R +    SM             P  RLR +LC  G  G  S  +    MDE    Y                  D++A G+ ++    G
Sbjct:   24 KYEPKEVLGSGVSSVVRRCVHKRTGQDFAVKIIDITPDRLSEEELEDIYSSTVKEVDILKAVSGHPHIITLIDAYESSTFFFLVFDLMKRGELFDY----------------LTEKVALSEKDTRSIMRSIFEVVHFLH-AKNIVHRDLKPENILLDDNMNIRLSDFGFSM----------QLRPGERLR-ELC--GTPGYLSPELLKCSMDESHPGY--------------GKEVDLWACGVIMYTLLAG 230          
BLAST of Wee1-like protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000985.1 (pep scaffold:Pmarinus_7.0:GL478231:26303:40782:-1 gene:ENSPMAG00000000890.1 transcript:ENSPMAT00000000985.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 5.849e-6
Identity = 43/155 (27.74%), Postives = 75/155 (48.39%), Query Frame = 1
Query:  520 YINKILISSTKLSEIYLCQHRFNSQYYV--VKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSC-SAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVD 975
            ++ K  + S +  E++ C H +     +  V SG  S+S  +  +S  + +E KIL  + K+  +V+ +   ++++ + L L ++  G+L+DF                L K   +  C  A IML  I  +L Y+H    I H D+KP NVLV+
Sbjct:   14 FVKKQSLGSGRYGEVHKCTHPYFGIVAIKQVFSGMGSSSQHMQLAS--LKDEAKILRKL-KNPCIVELFGVILQEDNYSLVLEYMCHGNLVDF----------------LHKGENVPWCLRARIMLEVIEGML-YVHS-QKIIHQDLKPENVLVN 147          
BLAST of Wee1-like protein kinase vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 52.7582 bits (125), Expect = 1.256e-7
Identity = 67/258 (25.97%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  658 IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMV--RYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGII--NQESAS----AIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKCF 1407
            I  E+ I+ LI  H++V+  ++ W      +L L ++ GG L D++V             KL +R  I           I   + Y H   NI H D+KP N+L+D    R    D  MA LE  + LL ++         C  G     S  I M    GR           YH   S  D+++ G+ +F    G +  N ++       ++ G ++  P  +S   + LI K+   D   R T +EIL+   +K +
Sbjct:  161 IEREIVIMKLIS-HTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSK----------GKLPEREAIH------YFKQIVEGVSYCHS-FNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTS---------C--GSPHYASPEIVM----GRP----------YHGGPS--DVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQ-MPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIKKY 372          
BLAST of Wee1-like protein kinase vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 50.0618 bits (118), Expect = 6.688e-7
Identity = 75/292 (25.68%), Postives = 118/292 (40.41%), Query Frame = 1
Query:  559 EIYLCQHRFNSQYYVVKSGYKS-----NSHCLSES--SREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVD-MVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGII--NQESASA------IRKGNWEKWPRT-ISENWQRLIKKMSHKDEMTRYTAREIL 1383
            ++ L QH        VK   KS      +H   +S     I  E+ I+ L+  H +V+  YD W  +   +L L +   G L + +V          D   L +R  I+ C   I++      + Y H  L I H D+KP N+L+D        D  MA L+  + LL+++         C      A   V          LP        Y  FAS  D+++ G+ +F    G +  ++E+ +       ++KG +E    T IS + Q LI K+   D   R   R+IL
Sbjct:   34 KVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLS-HPNVLSLYDVWETNNNLYLILEYAEKGELFNLLV----------DHGPLPEREAIN-CFRQIIIG-----ISYCH-ALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETS---------CGSPHYAAPEIV--------SGLP--------YEGFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDIL 280          
BLAST of Wee1-like protein kinase vs. Ensembl Yeast
Match: PBS2 (MAP kinase kinase of the HOG signaling pathway; activated under severe osmotic stress; mitophagy-specific regulator; plays a role in regulating Ty1 transposition [Source:SGD;Acc:S000003664])

HSP 1 Score: 48.521 bits (114), Expect = 1.746e-6
Identity = 55/202 (27.23%), Postives = 90/202 (44.55%), Query Frame = 1
Query:  652 REIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSG-ATSNVIKMDEGDGRYLP-----TLNDNSSNYHLFASSRDIYALGLTIFDCFGG 1239
            R+I+ E+++L       ++VDFY A+  +   ++ + ++ GGSL D I   S+    I D  +L          A+I  A I   L  + E  NI H D+KP+N+L    + T                          KLCDFG SG   +++ K + G   Y+      +LN + + Y +     DI++LGL+I +   G
Sbjct:  401 RQILMELEVLHKCNS-PYIVDFYGAFFIEGAVYMCMEYMDGGSL-DKIYDESSEIGGI-DEPQL----------AFIANAVIHG-LKELKEQHNIIHRDVKPTNILCSANQGT-------------------------VKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDRATYTV---QSDIWSLGLSILEMALG 560          
BLAST of Wee1-like protein kinase vs. Ensembl Yeast
Match: CHK1 (Serine/threonine kinase and DNA damage checkpoint effector; mediates cell cycle arrest via phosphorylation of Pds1p; phosphorylated by checkpoint signal transducer Mec1p; homolog of S. pombe and mammalian Chk1 checkpoint kinase [Source:SGD;Acc:S000000478])

HSP 1 Score: 48.521 bits (114), Expect = 1.810e-6
Identity = 61/263 (23.19%), Postives = 92/263 (34.98%), Query Frame = 1
Query:  646 SSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFG------RSGATSNVIKMDEGDGRYL-PTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKG-----------NWEKWPRTISENWQRLIKKMSHKDEMTRYTAREI 1380
            S ++I  EV + +   KH +V+   D  +  E   + L    GG L D                K+E    + S  A      + S + Y+H    + H DIKP N+                      LLD N N     KL DFG      R   T  V     G   Y+ P +  +   Y  +A   DI+++G+ +F    G    E  S   +            NW  W + I      L++K+   D   R T + +
Sbjct:   58 SDKDITKEVVLQSKCSKHPNVLRLIDCNVSKEYMWIILEMADGGDLFD----------------KIEPDVGVDSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENI----------------------LLDKNGN----LKLADFGLASQFRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGY--YADRTDIWSIGILLFVLLTGQTPWELPSLENEDFVFFIENDGNLNWGPWSK-IEFTHLNLLRKILQPDPNKRVTLKAL 275          
BLAST of Wee1-like protein kinase vs. Ensembl Nematostella
Match: EDO43725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU7])

HSP 1 Score: 98.5969 bits (244), Expect = 1.480e-22
Identity = 90/328 (27.44%), Postives = 151/328 (46.04%), Query Frame = 1
Query:  454 SPVEKYIKDYPKLFETNV--MYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLR---FKLCDFGR-SGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESAS---AIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKC 1404
            SP+++       L E+N+   + ++I    + S +   ++ C +R +   Y +K   K  +  + E +   + EV    ++G H HVV +Y AW ED    +Q  +  GGSL D I  N          +KL +  R+S     ++L  ++  L Y+H  L++ H DIKP N+ +   + T +        C     D   N   +   +K+ D G  + ATS   +++EGD R+LP   L ++ S         DI+ L LT++   GG    ++ S    IRKGN    P  +S  +  L+++M       R +A E+L+ D V C
Sbjct:    2 SPIQRL-----ALHESNISRFHEEFIELCTVGSGQFGSVHKCINRLDGCVYALKRSLKPVAGSVDEQN--ALREVYAHAVLGTHPHVVRYYSAWAEDNHMLIQNEYCDGGSLADRIQSN----------NKLGE--RLSEADLKMLLLQLAQGLKYIHS-LHLVHMDIKPGNIFISHSKDTDHS-------CDEGFDDDEANKEKKMVDYKIGDLGHVTSATSP--EVEEGDCRFLPCEILQEDYS----CLPKADIFGLALTVYLAGGGSELPKNGSEWHEIRKGNLPPLP-NVSAEFNALLRRMIDPVPSKRPSAVELLQ-DPVIC 294          
BLAST of Wee1-like protein kinase vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 54.6842 bits (130), Expect = 2.359e-8
Identity = 72/293 (24.57%), Postives = 118/293 (40.27%), Query Frame = 1
Query:  535 LISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYL-PTLNDNSSNYHLFASSRDIYALG------LTIFDCFGGIINQESASAIRKGNWE---KWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            +I     + +  C+HR  ++ Y +K   K+    +      I NE+ IL  + KH+H+V+  + +       L +  + GG L + IV  +                + +   A  M+  ++S L Y+H   +I H DIKP N+LV         L++             PN R   KL DFG +    + + +  G   Y+ P + D S     +    DI+A G      L  F  F      E    I  G +E    +   IS + + LI  M   D   RY+A+++L
Sbjct:    6 VIGDGNFAVVRECKHRKTNKEYALKIINKAK---VKGKEHMIENEISILRRV-KHNHIVELIEEYETPREIFLVMELVKGGDLFEAIVEAT----------------KYTEVHASHMVRDLASALDYLH-CNSIVHRDIKPENLLV---------LNL-------------PNGRKSLKLADFGLAMEVKSPMFLVCGTPTYVAPEILDESG----YGLKVDIWAAGVISYILLCGFPPFRSPDQDELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVL 251          
BLAST of Wee1-like protein kinase vs. Ensembl Nematostella
Match: EDO39163 (Ribosomal protein S6 kinase [Source:UniProtKB/TrEMBL;Acc:A7SAZ2])

HSP 1 Score: 53.9138 bits (128), Expect = 1.173e-7
Identity = 65/337 (19.29%), Postives = 135/337 (40.06%), Query Frame = 1
Query:  442 PDSSSPVEKYIKDYPKLFETNVMYSKY-INKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEG---DGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASA------------IRKG----NWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELD 1392
            P    P +  + DY  +FE +  +  Y I   ++     S    C H  + Q Y VK   +   H           EV+ L +   H ++V  YD + ++   +L +  ++GG L++                ++ K+   +  +A +++  I S + +MH+   + H D+KP N+L                      +D++ +  +  K+ DFG +       ++           P + D + +   +  S D+++LG+ ++    G +  +S+ +            I +G    + ++W ++IS   + LI+ +   D   R T +E+L  D
Sbjct:  370 PVQRRPAQGLV-DYASMFEGSHFFQNYRITSQVLGDGSFSTCRRCVHLRSGQEYAVKIISRRCDHT---------REVQSLKMCHGHPNIVTLYDVYQDEFHTYLVMELLAGGELLE----------------RIRKKKMFTESAASVIMRKIVSAVEFMHQ-RGVVHRDLKPENLL---------------------FVDNSEDAEI--KIVDFGFACVKPEAQQLQTPCFTLSYAAPEVLDQTVSNSGYDESCDLWSLGVILYTMLSGQVPFQSSGSWYKSSTGFVMQRITQGDVRFDGQQW-QSISPQAKDLIQGLLTVDPSQRLTVQEVLRHD 655          
BLAST of Wee1-like protein kinase vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 47.7506 bits (112), Expect = 6.020e-6
Identity = 42/180 (23.33%), Postives = 75/180 (41.67%), Query Frame = 1
Query:  517 KYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLV----DMVRYTSNDLSMAKLECHSALLDS 1044
            KY  + ++ +   SE+ L + +     + VK   K       ES   + NE+ IL  + +H +++   D +      +L +  + GG L D IV   N              Y     SA  ++  I     Y+H  L I H D+KP N+L     +  +   +D  ++K+E   + +D+
Sbjct:   16 KYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEES---VENEIAILKKV-RHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGN--------------YTEQDASA--LVQQILEAADYLHS-LGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDT 174          
BLAST of Wee1-like protein kinase vs. Ensembl Nematostella
Match: EDO45162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX6])

HSP 1 Score: 47.3654 bits (111), Expect = 9.363e-6
Identity = 76/358 (21.23%), Postives = 140/358 (39.11%), Query Frame = 1
Query:  538 ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDF----GRSGATSNV----IKMDEGDGRYL-PTLNDN-SSNYHLFASSRDIYALGLTIFDCFGG---------------------IINQESASAIRKGNWE----KWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNV----KCFIQPEALSYFKFEEISSDIMEIN*IVIELC 1494
            +   K   ++ C +   +  Y VK   KS +       R I+NE+++L     H ++++  + + + ERF+L    + GG L+  I                EKR   +   A +++  I S L ++H+   I H D+KP N+L                        S+ N     K+CDF    G  G T+ V    ++   G   Y+ P + D   +    +    D+++LG+ ++    G                        +     I++G +E    +W + +SE  + LI  +  +D   RYTA  +L    +    K  +   + + +  +E + + M +N IV E C
Sbjct:   11 LGQGKKGVVHGCINTITNLEYAVKIIQKSPT----VERRRILNEIELLYRCRGHRNILECIEYFEDRERFYLIFEKMRGGPLLKHI----------------EKRKFFTEKEASLVVNDICSALDFLHK-QGIAHRDLKPENILC-----------------------SHENKVSPVKICDFDLASGIGGLTTPVTTPELQTPVGSAEYMAPEVVDAFKTQASTYDKKCDLWSLGVILYIMLSGYPPFYGKCGSKCGWERGETCRTCQEMLLHRIQEGIYEFPEKEWSQ-VSEEAKDLISHLLVRDASQRYTAEMVLTHPWIGMVHKSVLFRGSSTPYNLQEFAVEAMAMNRIVSEAC 323          
BLAST of Wee1-like protein kinase vs. Ensembl Medaka
Match: wee1 (WEE1 G2 checkpoint kinase [Source:NCBI gene;Acc:101160159])

HSP 1 Score: 106.301 bits (264), Expect = 6.808e-24
Identity = 86/309 (27.83%), Postives = 143/309 (46.28%), Query Frame = 1
Query:  490 LFETNVMYSKYINKIL----ISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHS--ALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLP--TLNDNSSNYHLFASSRDIYALGLTIFDCFGG---IINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREIL 1383
            + E+N+M S+Y ++ L    I   +   ++ C  R +   Y +K   K  +  + E  +  + EV    ++G+H HVV +Y AW ED+   +Q  + +GG+L D I  N  R     ++   +            +L  +   L Y+H   ++ H DIKPSN+ +      S D      EC     L  S     + +K+ D G    T+N  +++EGD RYL    L ++ SN     +  DI+AL LT+    G      N E    IRKG     P+ +S ++  L+K M H D++ R +A +++
Sbjct:  263 MMESNMM-SRYTSEFLELEKIGCGEFGAVFKCVKRLDGCIYAIKRSKKPLAGSVDE--QNALREVYAHAVLGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENYRRLSYFTELELKD------------LLLQVGRGLKYIHST-SLVHMDIKPSNIFISRKPVASFD------ECDEVDGLATS-----VIYKIGDLGHV-TTANNPQVEEGDSRYLANEVLQEDYSNL----TKADIFALALTVVGASGADPLPSNGEKWHEIRKGKLPSIPQVLSPDFLSLLKLMIHPDQVRRPSASDLI 539          
BLAST of Wee1-like protein kinase vs. Ensembl Medaka
Match: wee2 (wee1-like protein kinase 2 [Source:NCBI gene;Acc:101156733])

HSP 1 Score: 85.1149 bits (209), Expect = 3.735e-17
Identity = 74/294 (25.17%), Postives = 134/294 (45.58%), Query Frame = 1
Query:  514 SKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSRE--IINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGII---NQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREI 1380
            S+++    I   +   +Y C  R +   Y +K   +     L+ S+ E   + EV    ++G H HVV +Y AW ED+   +Q  +  GGSL + I              K  +  R++      +L  +S  L Y+H  L + H DIKPSN+ +  +  + N+ S  + +       +       +K+ D G   +T N  +++EGD R+L     +    HL  +  DI+ALGLT+    G      N +    +R+G+     + +S +++ L++ +   D + R +A+E+
Sbjct:  216 SEFLELECIGEGEFGAVYKCVKRLDGCLYAIKRSRRP----LAGSANEQLALKEVYAHAVLGHHPHVVRYYSAWAEDDHMVIQNEYCDGGSLSNAIA------------RKEAQGERLTEAELKDLLLQVSMGLKYIHS-LGLVHLDIKPSNIFI-CLPPSINEASEEEEDDEGNSAGAT------YKIGDLGHVTST-NSPQVEEGDSRFLAREVLHEDYRHLPKA--DIFALGLTVLLAAGAPPLPQNGDQWHRLREGHIPAVSQELSPSFRSLLQSLLDPDPVKRPSAKEL 482          
BLAST of Wee1-like protein kinase vs. Ensembl Medaka
Match: rps6kal (highly divergent homeobox [Source:NCBI gene;Acc:101174679])

HSP 1 Score: 62.003 bits (149), Expect = 1.111e-9
Identity = 66/300 (22.00%), Postives = 122/300 (40.67%), Query Frame = 1
Query:  571 CQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYL-PTLNDNSSNYHL-----FASSRDIYALGLTIFDCFGGIINQESAS----------------AIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKC 1404
            C H+ ++  Y VK         + +S R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A  +L  I+  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG +       ++  G+G  L P    N     +     + ++ DI++LG+ ++    G     +                  ++  GNW+    T+S++ + L+  M H D   RYTA ++L+   + C
Sbjct:  481 CVHQVSAMEYAVK--------IIDKSKRDPSEEIEILMRYGQHPNIITLKDVYDEGRYVYLVTELMKGGELLDRI---------------LRQKF-FSEREASAVLYTITKTVDYLH-CQGVVHRDLKPSNILY---------------------MDDSGNPD-SIRICDFGFAK------QLRGGNGLLLTPCYTANFVAPEVLMRQGYDAACDIWSLGVLLYTMLAGYTPFANGPNDTPEEILLRIGSGKFSLTGGNWD----TVSDSSKDLLSHMLHVDPHQRYTAEQVLKHSWITC 723          
BLAST of Wee1-like protein kinase vs. Ensembl Medaka
Match: rps6kal (highly divergent homeobox [Source:NCBI gene;Acc:101174679])

HSP 1 Score: 61.6178 bits (148), Expect = 1.430e-9
Identity = 66/300 (22.00%), Postives = 122/300 (40.67%), Query Frame = 1
Query:  571 CQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYL-PTLNDNSSNYHL-----FASSRDIYALGLTIFDCFGGIINQESAS----------------AIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKC 1404
            C H+ ++  Y VK         + +S R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A  +L  I+  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG +       ++  G+G  L P    N     +     + ++ DI++LG+ ++    G     +                  ++  GNW+    T+S++ + L+  M H D   RYTA ++L+   + C
Sbjct:  425 CVHQVSAMEYAVK--------IIDKSKRDPSEEIEILMRYGQHPNIITLKDVYDEGRYVYLVTELMKGGELLDRI---------------LRQKF-FSEREASAVLYTITKTVDYLH-CQGVVHRDLKPSNILY---------------------MDDSGNPD-SIRICDFGFAK------QLRGGNGLLLTPCYTANFVAPEVLMRQGYDAACDIWSLGVLLYTMLAGYTPFANGPNDTPEEILLRIGSGKFSLTGGNWD----TVSDSSKDLLSHMLHVDPHQRYTAEQVLKHSWITC 667          
BLAST of Wee1-like protein kinase vs. Ensembl Medaka
Match: rps6kal (highly divergent homeobox [Source:NCBI gene;Acc:101174679])

HSP 1 Score: 61.2326 bits (147), Expect = 1.664e-9
Identity = 66/300 (22.00%), Postives = 122/300 (40.67%), Query Frame = 1
Query:  571 CQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYL-PTLNDNSSNYHL-----FASSRDIYALGLTIFDCFGGIINQESAS----------------AIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKC 1404
            C H+ ++  Y VK         + +S R+   E++IL   G+H +++   D + E    +L    + GG L+D I               L +++  S   A  +L  I+  + Y+H    + H D+KPSN+L                      +D + NP    ++CDFG +       ++  G+G  L P    N     +     + ++ DI++LG+ ++    G     +                  ++  GNW+    T+S++ + L+  M H D   RYTA ++L+   + C
Sbjct:  425 CVHQVSAMEYAVK--------IIDKSKRDPSEEIEILMRYGQHPNIITLKDVYDEGRYVYLVTELMKGGELLDRI---------------LRQKF-FSEREASAVLYTITKTVDYLH-CQGVVHRDLKPSNIL---------------------YMDDSGNPD-SIRICDFGFAK------QLRGGNGLLLTPCYTANFVAPEVLMRQGYDAACDIWSLGVLLYTMLAGYTPFANGPNDTPEEILLRIGSGKFSLTGGNWD----TVSDSSKDLLSHMLHVDPHQRYTAEQVLKHSWITC 667          
BLAST of Wee1-like protein kinase vs. Planmine SMEST
Match: SMESG000073764.1 (SMESG000073764.1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 487/487 (100.00%), Postives = 487/487 (100.00%), Query Frame = 1
Query:   13 MTENTNQVIVTPKRSRNTYXXXXXXXXXXXXXISRDKRFNDRLSLSNLENKKSRISYADDSYFIGSSPNPNMVTSTPVNRNRHSTSNCMKRYNINSETGDLLLDATSYIQDXXXXXXXXXXXXXXXXXXXXFQNSCICINHLDPDSSSPVEKYIKDYPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKCFIQPEALSYFKFEEISSDIMEIN 1473
            MTENTNQVIVTPKRSRNTYPNLPNLPNDSSNDISRDKRFNDRLSLSNLENKKSRISYADDSYFIGSSPNPNMVTSTPVNRNRHSTSNCMKRYNINSETGDLLLDATSYIQDLNNNISKKIEILENINNIVNFQNSCICINHLDPDSSSPVEKYIKDYPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKCFIQPEALSYFKFEEISSDIMEIN
Sbjct:    1 MTENTNQVIVTPKRSRNTYPNLPNLPNDSSNDISRDKRFNDRLSLSNLENKKSRISYADDSYFIGSSPNPNMVTSTPVNRNRHSTSNCMKRYNINSETGDLLLDATSYIQDLNNNISKKIEILENINNIVNFQNSCICINHLDPDSSSPVEKYIKDYPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVKCFIQPEALSYFKFEEISSDIMEIN 487          
BLAST of Wee1-like protein kinase vs. Planmine SMEST
Match: SMESG000063617.1 (SMESG000063617.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.632e-13
Identity = 81/331 (24.47%), Postives = 132/331 (39.88%), Query Frame = 1
Query:  481 YPKLFETNVMYSKYINKILISSTKL--------------SEIYLCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSGATSNVIKMDEGDGRYL---------PTLNDNSSNYHLFASSRDIYALGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSH------KDEMTRYTAREILE 1386
            Y K+ E+  + +K  N   I  TK                 +Y C ++ NSQ   +K  +K+ +  + ++ +  + E+   + +  HS ++++YD + E   F++++ ++ GGSL   I    N  C          ++ I   S  I+       LVY+H      HGDIKP N+                      LLD+N N     KL DFG +    ++    + D R L         P L D  SNY  F    DI+ALG+T  +   G +         + N  K  + I EN   ++            D   R+TA ++LE
Sbjct:  461 YDKILESGTLLAKDSNIAFIKVTKFDNLHDLERIGDGAYGTVYKCINKLNSQIRALKE-FKNQNEEIVKNLQSAMPEIIANSRLASHSRIIEYYDYYQEKNSFYIEMEYMKGGSLRKHI--EENNCCT---------KFEIQFFSRQILEG-----LVYLHATKFFCHGDIKPENI----------------------LLDANKN----IKLADFGFAQYFKDITDNSKSDFRSLACGTDTYAAPELKD-GSNYGPFV---DIWALGITEMEMVMGKL----TGVDNEKNLLKTKKKIQENMTEIMPLCEFIECCLISDPYKRWTASQLLE 740          
BLAST of Wee1-like protein kinase vs. Planmine SMEST
Match: SMESG000025288.1 (SMESG000025288.1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.396e-12
Identity = 68/258 (26.36%), Postives = 121/258 (46.90%), Query Frame = 1
Query:  523 INKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNS----HCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRY-----RISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHS-------ALLDSNPNPRLRFKLCDFGRS---GATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG 1239
            I++I  S+ ++  IY  + R + Q+Y +K+G   +       LS+S+ E++ EV+IL+ +  H ++V+++  WIE +   LQL ++ G SL  F+   ++    +   + L K +     ++S  +   ++  I   L Y+H  + I H DI+P N+   M+  + N+L   K    S        +L    +  + FKL  F +S   G T    K       Y+P+ +DN         SRD Y L ++I     G
Sbjct:  164 ISEIFRSTNRI--IYRSKCRHDHQWYCIKTGINYSEVNKFQNLSQSNFEVLREVRILSTLN-HRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATGKQIIKQICRALNYLHSDIGIIHNDIQPLNI---MITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHK-----SIYMPSFDDNK-------KSRDFYGLAMSIIHSICG 403          
BLAST of Wee1-like protein kinase vs. Planmine SMEST
Match: SMESG000052154.1 (SMESG000052154.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.775e-8
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 1
Query:  565 YLCQHRFNSQYYVVK-SGYKSNS-HCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSL---IDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLV 972
            +  +HRF+S +Y +K S Y ++    LS+SSR + NE+ +L+ +  H +++ ++ +WIE +  + QL +   GSL   ++F + +           K+E R      S  ++L  I S L +MH      H D+  SNVL+
Sbjct:  276 FRAKHRFDSHWYCIKISSYNNDEIQTLSKSSRLLQNEIMMLSSLS-HENIIKYFSSWIEYQTLYEQLEYNKFGSLEEALNFTIND-----------KIETRVLTLKSSKELVL-QIGSALDFMHIDWTFVHDDVNFSNVLL 403          
BLAST of Wee1-like protein kinase vs. Planmine SMEST
Match: SMESG000053627.1 (SMESG000053627.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.915e-7
Identity = 75/307 (24.43%), Postives = 128/307 (41.69%), Query Frame = 1
Query:  535 LISSTKLSEIY---LCQHRFNSQYYVVKSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNPRLRFKLCDFGRSG----ATSNVIK----MDEGDGRYL-PTLNDNSSNYHLFASSRDIYALGLTIF------DCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEMTRYTAREILELDNVK 1401
            LI     +E+Y   L  +    +  V+K     ++  L E + E++ E+   + I  H  ++ F D +IED +F++++ F+  GSL  F                LE   R++        + I   L Y+H   +I H DIK +NVL+D                     D+N       KL DFG +     AT ++I+       G  +++ P +   + NY    S  DI++ G+T+       D F  I  +E  + I+K   +   + +S+N   L+ K    D   R   +++LE D  K
Sbjct:  473 LIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVN-EVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSF----------------LEHNGRLNETQIKHFSSQILEGLEYLHSK-SICHRDIKAANVLLDD--------------------DNNA------KLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEV--FTGNY---GSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 730          
The following BLAST results are available for this feature:
BLAST of Wee1-like protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WEE12.183e-2026.80WEE1 G2 checkpoint kinase [Source:HGNC Symbol;Acc:... [more]
WEE23.503e-2030.72WEE2 oocyte meiosis inhibiting kinase [Source:HGNC... [more]
WEE23.503e-2030.72WEE2 oocyte meiosis inhibiting kinase [Source:HGNC... [more]
WEE18.445e-2026.69WEE1 G2 checkpoint kinase [Source:HGNC Symbol;Acc:... [more]
WEE21.968e-1029.29WEE2 oocyte meiosis inhibiting kinase [Source:HGNC... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sad-11.794e-821.56Serine/threonine kinase SAD-1 [Source:UniProtKB/S... [more]
sad-11.865e-821.50Serine/threonine kinase SAD-1 [Source:UniProtKB/S... [more]
T08D2.71.259e-725.10pep chromosome:WBcel235:X:182691:191193:1 gene:WBG... [more]
wee-1.31.366e-723.37Membrane-associated tyrosine- and threonine-specif... [more]
nekl-41.160e-626.45Serine/threonine-protein kinase D1044.8 [Source:U... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wee15.248e-1626.35gene:FBgn0011737 transcript:FBtr0332329[more]
Wee15.248e-1626.35gene:FBgn0011737 transcript:FBtr0079371[more]
CG175281.512e-824.70gene:FBgn0261387 transcript:FBtr0111274[more]
CG175281.512e-824.70gene:FBgn0261387 transcript:FBtr0111277[more]
S6kII1.960e-727.81gene:FBgn0262866 transcript:FBtr0333715[more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wee14.554e-2226.38WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GEN... [more]
wee18.112e-2226.38WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GEN... [more]
wee18.112e-2226.38WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GEN... [more]
wee18.112e-2226.38WEE1 G2 checkpoint kinase [Source:ZFIN;Acc:ZDB-GEN... [more]
wee22.082e-1425.83WEE1 homolog 2 (S. pombe) [Source:NCBI gene;Acc:32... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020125.19.016e-1230.65WEE1 homolog 2 [Source:NCBI gene;Acc:100125126][more]
rps6ka17.233e-921.23ribosomal protein S6 kinase A1 [Source:NCBI gene;A... [more]
rps6ka18.296e-921.23ribosomal protein S6 kinase A1 [Source:NCBI gene;A... [more]
rps6ka19.054e-921.23ribosomal protein S6 kinase A1 [Source:NCBI gene;A... [more]
rps6ka19.379e-921.66ribosomal protein S6 kinase A1 [Source:NCBI gene;A... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wee17.112e-2027.04WEE 1 homolog 1 (S. pombe) [Source:MGI Symbol;Acc:... [more]
Wee21.761e-1829.93WEE1 homolog 2 (S. pombe) [Source:MGI Symbol;Acc:M... [more]
Rps6ka12.414e-922.53ribosomal protein S6 kinase polypeptide 1 [Source:... [more]
Rps6ka12.473e-922.53ribosomal protein S6 kinase polypeptide 1 [Source:... [more]
Rps6ka12.568e-922.84ribosomal protein S6 kinase polypeptide 1 [Source:... [more]
back to top
BLAST of Wee1-like protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4QNA8|WEE2_XENTR2.243e-2129.05Wee1-like protein kinase 2 OS=Xenopus tropicalis O... [more]
sp|O57473|WEE2B_XENLA1.490e-1928.08Wee1-like protein kinase 2-B OS=Xenopus laevis OX=... [more]
sp|P0C1S8|WEE2_HUMAN1.682e-1930.72Wee1-like protein kinase 2 OS=Homo sapiens OX=9606... [more]
sp|Q6DFE0|WEE2C_XENLA1.881e-1928.08Wee1-like protein kinase 2-C OS=Xenopus laevis OX=... [more]
sp|P30291|WEE1_HUMAN4.055e-1926.69Wee1-like protein kinase OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Wee1-like protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FSD82.749e-3129.65Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5J4NC566.691e-3029.78Wee1-like protein kinase OS=Paragonimus westermani... [more]
A0A3P6HUQ31.751e-2930.46Protein kinase domain-containing protein OS=Mesoce... [more]
H2KVT29.920e-2928.95Wee1-like protein kinase OS=Clonorchis sinensis OX... [more]
A0A095CET51.932e-2831.01Wee1-like protein kinase OS=Schistosoma haematobiu... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wee18.841e-2227.04WEE1 G2 checkpoint kinase [Source:NCBI gene;Acc:10... [more]
WEE12.375e-2026.83WEE1 G2 checkpoint kinase [Source:HGNC Symbol;Acc:... [more]
wee27.480e-1525.08WEE2 oocyte meiosis inhibiting kinase [Source:NCBI... [more]
si:ch211-255p10.46.582e-824.81serine/threonine-protein kinase BRSK2-like [Source... [more]
rps6ka19.045e-820.94ribosomal protein S6 kinase a, polypeptide 1 [Sour... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPS6KA31.099e-1022.79ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
ENSPMAT00000000175.13.954e-723.14pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
phkg1b5.160e-623.51phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
ENSPMAT00000000985.15.849e-627.74pep scaffold:Pmarinus_7.0:GL478231:26303:40782:-1 ... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HSL11.256e-725.97Nim1p-related protein kinase; septin-binding kinas... [more]
KCC46.688e-725.68Protein kinase of the bud neck involved in the sep... [more]
PBS21.746e-627.23MAP kinase kinase of the HOG signaling pathway; ac... [more]
CHK11.810e-623.19Serine/threonine kinase and DNA damage checkpoint ... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437251.480e-2227.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444882.359e-824.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391631.173e-719.29Ribosomal protein S6 kinase [Source:UniProtKB/TrE... [more]
EDO362536.020e-623.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451629.363e-621.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Wee1-like protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wee16.808e-2427.83WEE1 G2 checkpoint kinase [Source:NCBI gene;Acc:10... [more]
wee23.735e-1725.17wee1-like protein kinase 2 [Source:NCBI gene;Acc:1... [more]
rps6kal1.111e-922.00highly divergent homeobox [Source:NCBI gene;Acc:10... [more]
rps6kal1.430e-922.00highly divergent homeobox [Source:NCBI gene;Acc:10... [more]
rps6kal1.664e-922.00highly divergent homeobox [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Wee1-like protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073764.10.000e+0100.00SMESG000073764.1[more]
SMESG000063617.14.632e-1324.47SMESG000063617.1[more]
SMESG000025288.15.396e-1226.36SMESG000025288.1[more]
SMESG000052154.13.775e-829.79SMESG000052154.1[more]
SMESG000053627.11.915e-724.43SMESG000053627.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024908 ID=SMED30024908|Name=Wee1-like protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1576bp
AATTGAATGAATATGACAGAAAATACTAATCAAGTTATTGTCACACCTAA
AAGAAGTCGTAACACTTATCCAAATCTTCCAAATCTTCCAAATGATTCCT
CAAATGATATAAGCAGGGATAAAAGATTTAACGATCGGTTATCATTGTCT
AACCTTGAAAATAAAAAATCCAGAATTTCTTATGCAGATGATAGTTATTT
TATTGGCAGTTCACCAAACCCTAATATGGTTACATCTACTCCCGTTAATC
GAAATAGGCATTCTACTAGTAATTGTATGAAGCGATATAATATTAATAGT
GAAACTGGTGACTTGTTGTTAGATGCAACGTCTTATATTCAAGATCTTAA
TAATAATATATCCAAAAAAATTGAGATTTTGGAAAATATTAATAATATTG
TAAATTTTCAAAATTCCTGTATATGCATAAACCACTTAGATCCTGATAGT
TCTTCACCAGTGGAAAAATATATAAAAGACTATCCAAAACTATTTGAAAC
TAATGTAATGTATTCAAAATACATTAATAAAATCCTCATTTCATCAACAA
AATTATCCGAAATTTATTTATGTCAGCATCGTTTTAATTCTCAGTACTAT
GTTGTTAAATCGGGGTACAAATCTAATAGTCATTGTTTGTCAGAGTCTAG
TAGAGAAATAATTAATGAAGTTAAAATTCTCACATTGATTGGTAAACATT
CACATGTAGTTGACTTTTATGATGCATGGATTGAAGATGAGAGGTTTCAC
CTACAGTTAGGCTTTATTAGCGGTGGATCACTCATTGATTTCATAGTTGG
AAATTCTAATAGGTTTTGTGCAATTTGCGATATTTCTAAACTGGAAAAAA
GATATAGAATCTCTAGTTGTTCGGCATATATTATGCTTGCTCATATTTCA
TCAGTGTTAGTCTATATGCATGAAGTTTTAAATATTTTTCATGGTGATAT
AAAACCTTCAAATGTTCTTGTTGATATGGTAAGGTATACGTCTAATGATT
TATCAATGGCTAAATTAGAGTGCCATAGTGCTTTATTGGACTCGAATCCA
AACCCAAGATTAAGATTCAAATTATGTGATTTTGGTCGATCTGGTGCAAC
AAGTAATGTTATAAAAATGGATGAAGGTGATGGGAGATATCTGCCTACTC
TCAATGATAACAGTTCTAATTATCATCTATTTGCTTCGTCGCGTGATATT
TATGCGCTTGGTTTAACTATCTTTGATTGCTTTGGTGGAATTATTAATCA
AGAATCAGCGAGCGCAATTCGCAAAGGTAATTGGGAAAAGTGGCCACGCA
CTATCTCAGAAAATTGGCAACGTTTAATTAAAAAAATGTCGCACAAAGAC
GAAATGACGCGGTATACAGCTCGTGAAATCCTAGAATTGGACAACGTTAA
ATGCTTCATTCAACCAGAAGCGCTGTCATATTTTAAATTTGAAGAAATAT
CATCGGATATAATGGAAATAAATTAGATTGTTATTGAACTCTGTATCAGC
TTTGTAACGATATTATTATGTATTTTCAGATTCTTAAAGGTTGTTGACTT
TATTTTTGTAATAACTAAATTATAAT
back to top

protein sequence of SMED30024908-orf-1

>SMED30024908-orf-1 ID=SMED30024908-orf-1|Name=SMED30024908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MNMTENTNQVIVTPKRSRNTYPNLPNLPNDSSNDISRDKRFNDRLSLSNL
ENKKSRISYADDSYFIGSSPNPNMVTSTPVNRNRHSTSNCMKRYNINSET
GDLLLDATSYIQDLNNNISKKIEILENINNIVNFQNSCICINHLDPDSSS
PVEKYIKDYPKLFETNVMYSKYINKILISSTKLSEIYLCQHRFNSQYYVV
KSGYKSNSHCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQ
LGFISGGSLIDFIVGNSNRFCAICDISKLEKRYRISSCSAYIMLAHISSV
LVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHSALLDSNPNP
RLRFKLCDFGRSGATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYA
LGLTIFDCFGGIINQESASAIRKGNWEKWPRTISENWQRLIKKMSHKDEM
TRYTAREILELDNVKCFIQPEALSYFKFEEISSDIMEIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 110..130
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 148..250
e-value: 6.8E-10
score: 41.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 251..464
e-value: 1.2E-22
score: 82.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..37
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..31
NoneNo IPR availablePANTHERPTHR11042:SF144WEE1-LIKE PROTEIN KINASEcoord: 76..459
NoneNo IPR availablePANTHERPTHR11042EUKARYOTIC TRANSLATION INITIATION FACTOR 2-ALPHA KINASE EIF2-ALPHA KINASE -RELATEDcoord: 76..459
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 171..466
e-value: 4.7E-10
score: 9.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 182..459
e-value: 3.9E-25
score: 88.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 171..467
score: 23.227
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 309..321
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 165..460