C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30024902
Length (bp)1835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30024902) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30024902) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30024902) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30024902) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024902h1SMcG0019580 SmedASXL_005598SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024902h1SMcG0019580 SmedASXL_005598SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30024902h1SMcG0019580 dd_Smed_v4_11893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024902h1SMcG0019580 dd_Smed_v4_11893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024902h1SMcG0019580 dd_Smed_v4_11893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024902h1SMcG0019580 dd_Smed_v4_11893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024902h1SMcG0019580 dd_Smed_v6_11893_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30024902h1SMcG0019580 dd_Smed_v4_11893_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: IKZF1 (IKAROS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:13176])

HSP 1 Score: 63.5438 bits (153), Expect = 1.385e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  190 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 238          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: IKZF1 (IKAROS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:13176])

HSP 1 Score: 63.5438 bits (153), Expect = 1.843e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  209 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 257          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: IKZF1 (IKAROS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:13176])

HSP 1 Score: 63.929 bits (154), Expect = 1.863e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  235 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 283          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: IKZF1 (IKAROS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:13176])

HSP 1 Score: 63.5438 bits (153), Expect = 3.444e-10
Identity = 39/120 (32.50%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 1313 TISNNTEDEILERKCRSAPLYNTNLDEKSVSSLNNDSEDKHQKSQSDVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            T SNN E        RS  +Y TN    +  + N  S  +  ++   + A  E S + L+    +  Q   K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  217 TESNNEEQ-------RSGLIYLTN--HIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQM--KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 325          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: IKZF1 (IKAROS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:13176])

HSP 1 Score: 63.5438 bits (153), Expect = 4.275e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  317 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 365          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: ehn-3 (Enhancer of HAND mutation hnd-1 [Source:UniProtKB/TrEMBL;Acc:Q9N4M6])

HSP 1 Score: 50.8322 bits (120), Expect = 6.787e-7
Identity = 19/48 (39.58%), Postives = 32/48 (66.67%), Query Frame = 2
Query: 1538 CNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLH 1681
            C++CKI F+D   + LH GLH+ + P++C++CG  C   +DF  H ++
Sbjct:  166 CDYCKIRFDDKVMWYLHSGLHSDDIPFKCSLCGSLCDGKYDFAAHLVY 213          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: ehn-3 (Enhancer of HAND mutation hnd-1 [Source:UniProtKB/TrEMBL;Acc:Q9N4M6])

HSP 1 Score: 49.6766 bits (117), Expect = 9.603e-7
Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 2
Query: 1538 CNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            C++CKI F+D   + LH GLH+ + P++C++CG  C   +DF  H
Sbjct:  123 CDYCKIRFDDKVMWYLHSGLHSDDIPFKCSLCGSLCDGKYDFAAH 167          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: ehn-3 (Enhancer of HAND mutation hnd-1 [Source:UniProtKB/TrEMBL;Acc:Q9N4M6])

HSP 1 Score: 50.447 bits (119), Expect = 1.377e-6
Identity = 19/48 (39.58%), Postives = 32/48 (66.67%), Query Frame = 2
Query: 1538 CNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLH 1681
            C++CKI F+D   + LH GLH+ + P++C++CG  C   +DF  H ++
Sbjct:  210 CDYCKIRFDDKVMWYLHSGLHSDDIPFKCSLCGSLCDGKYDFAAHLVY 257          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: ztf-16 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:H2L008])

HSP 1 Score: 51.2174 bits (121), Expect = 1.472e-6
Identity = 19/48 (39.58%), Postives = 31/48 (64.58%), Query Frame = 2
Query: 1535 KCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSL 1678
            +C HC ++F D T Y LH  LH+  +P++C +CG +C + + FT H +
Sbjct:  421 ECCHCGMMFYDNTMYLLHKSLHSDGDPFKCALCGTQCGEKYMFTTHVI 468          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: hb (gene:FBgn0001180 transcript:FBtr0081951)

HSP 1 Score: 56.225 bits (134), Expect = 7.561e-8
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +++C +C I F+DA  Y +HMG H+ ++ ++CNMCG+KC       VH
Sbjct:  704 IYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFVH 751          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: hb (gene:FBgn0001180 transcript:FBtr0081950)

HSP 1 Score: 56.225 bits (134), Expect = 7.561e-8
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +++C +C I F+DA  Y +HMG H+ ++ ++CNMCG+KC       VH
Sbjct:  704 IYECKYCDIFFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFVH 751          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG12769 (gene:FBgn0033252 transcript:FBtr0088827)

HSP 1 Score: 53.9138 bits (128), Expect = 3.789e-7
Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 1502 DNDIQFLSKL-HKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSL 1678
            D D+    KL   C+ C I F D T Y LH G H  +NPW+CN+CG++ +++++F  H L
Sbjct:  638 DGDLLINRKLILTCHFCGIEFPDETLYFLHKGCHCESNPWRCNICGEQLNNVYEFNSHLL 697          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG12769 (gene:FBgn0033252 transcript:FBtr0088828)

HSP 1 Score: 53.9138 bits (128), Expect = 3.931e-7
Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 1502 DNDIQFLSKL-HKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSL 1678
            D D+    KL   C+ C I F D T Y LH G H  +NPW+CN+CG++ +++++F  H L
Sbjct:  642 DGDLLINRKLILTCHFCGIEFPDETLYFLHKGCHCESNPWRCNICGEQLNNVYEFNSHLL 701          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG12769 (gene:FBgn0033252 transcript:FBtr0339281)

HSP 1 Score: 53.9138 bits (128), Expect = 3.980e-7
Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 1502 DNDIQFLSKL-HKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSL 1678
            D D+    KL   C+ C I F D T Y LH G H  +NPW+CN+CG++ +++++F  H L
Sbjct:  649 DGDLLINRKLILTCHFCGIEFPDETLYFLHKGCHCESNPWRCNICGEQLNNVYEFNSHLL 708          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:402893])

HSP 1 Score: 64.3142 bits (155), Expect = 1.668e-10
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC I F D   Y +HMG H   NP+QCN+CG +C + +DF  H
Sbjct:  359 VQDPQMLHHCPHCHIYFPDNILYTIHMGCHGYENPFQCNICGHRCRNSYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:402893])

HSP 1 Score: 64.3142 bits (155), Expect = 1.668e-10
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC I F D   Y +HMG H   NP+QCN+CG +C + +DF  H
Sbjct:  359 VQDPQMLHHCPHCHIYFPDNILYTIHMGCHGYENPFQCNICGHRCRNSYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:402893])

HSP 1 Score: 64.3142 bits (155), Expect = 1.668e-10
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC I F D   Y +HMG H   NP+QCN+CG +C + +DF  H
Sbjct:  359 VQDPQMLHHCPHCHIYFPDNILYTIHMGCHGYENPFQCNICGHRCRNSYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:402893])

HSP 1 Score: 64.3142 bits (155), Expect = 1.668e-10
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC I F D   Y +HMG H   NP+QCN+CG +C + +DF  H
Sbjct:  359 VQDPQMLHHCPHCHIYFPDNILYTIHMGCHGYENPFQCNICGHRCRNSYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:402893])

HSP 1 Score: 64.3142 bits (155), Expect = 1.668e-10
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC I F D   Y +HMG H   NP+QCN+CG +C + +DF  H
Sbjct:  359 VQDPQMLHHCPHCHIYFPDNILYTIHMGCHGYENPFQCNICGHRCRNSYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: six3 (SIX homeobox 3 [Source:Xenbase;Acc:XB-GENE-478761])

HSP 1 Score: 64.3142 bits (155), Expect = 2.672e-10
Identity = 22/49 (44.90%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K+HKC HC+++F D   Y +HMG H   +P++CNMCG +  D ++F+ H
Sbjct:  395 KVHKCEHCRVIFLDHVMYTIHMGCHGFRDPFECNMCGYQSQDRYEFSSH 443          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: six3 (SIX homeobox 3 [Source:Xenbase;Acc:XB-GENE-478761])

HSP 1 Score: 64.3142 bits (155), Expect = 3.848e-10
Identity = 22/49 (44.90%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K+HKC HC+++F D   Y +HMG H   +P++CNMCG +  D ++F+ H
Sbjct:  477 KVHKCEHCRVIFLDHVMYTIHMGCHGFRDPFECNMCGYQSQDRYEFSSH 525          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:550109])

HSP 1 Score: 62.7734 bits (151), Expect = 8.214e-10
Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            LH C HC + F D   Y +HMG H   NP+QCN+CG KC + +DF  H
Sbjct:  382 LHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCKCKNKYDFACH 429          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ikzf5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:550109])

HSP 1 Score: 62.7734 bits (151), Expect = 8.333e-10
Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            LH C HC + F D   Y +HMG H   NP+QCN+CG KC + +DF  H
Sbjct:  382 LHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCKCKNKYDFACH 429          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: TRPS1 (transcriptional repressor GATA binding 1 [Source:NCBI gene;Acc:100493561])

HSP 1 Score: 60.4622 bits (145), Expect = 7.509e-9
Identity = 35/81 (43.21%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1436 QKSQSDVMANGEGSPNLLK-ECVDNDIQ-FLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +KS+S + A  +G  N+ K E  D   Q  LS   KC HC I+F D   Y LHM  H  N P+QC++C   C+D +DFT H
Sbjct:  917 EKSKSPLSAKDDGPLNVTKIEKSDKSTQDELST--KCVHCGIVFLDEVMYALHMSCHGENGPFQCSICQHLCTDKYDFTTH 995          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ikzf5 (IKAROS family zinc finger 5 [Source:MGI Symbol;Acc:MGI:1914393])

HSP 1 Score: 65.0846 bits (157), Expect = 3.785e-11
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC + F D   Y +HMG H  ++P+QCN+CG KC D +DF  H
Sbjct:  204 VQDPQLLHHCQHCDVYFADNVLYTVHMGCHGYDSPFQCNVCGCKCKDKYDFACH 257          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ikzf5 (IKAROS family zinc finger 5 [Source:MGI Symbol;Acc:MGI:1914393])

HSP 1 Score: 64.6994 bits (156), Expect = 1.509e-10
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC + F D   Y +HMG H  ++P+QCN+CG KC D +DF  H
Sbjct:  357 VQDPQLLHHCQHCDVYFADNVLYTVHMGCHGYDSPFQCNVCGCKCKDKYDFACH 410          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ikzf1 (IKAROS family zinc finger 1 [Source:MGI Symbol;Acc:MGI:1342540])

HSP 1 Score: 62.7734 bits (151), Expect = 5.986e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  369 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 417          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ikzf1 (IKAROS family zinc finger 1 [Source:MGI Symbol;Acc:MGI:1342540])

HSP 1 Score: 62.7734 bits (151), Expect = 7.910e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  476 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 524          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ikzf1 (IKAROS family zinc finger 1 [Source:MGI Symbol;Acc:MGI:1342540])

HSP 1 Score: 62.7734 bits (151), Expect = 8.349e-10
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  456 KVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 504          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BU00|IKZF5_MOUSE (Zinc finger protein Pegasus OS=Mus musculus OX=10090 GN=Ikzf5 PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.056e-9
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC + F D   Y +HMG H  ++P+QCN+CG KC D +DF  H
Sbjct:  357 VQDPQLLHHCQHCDVYFADNVLYTVHMGCHGYDSPFQCNVCGCKCKDKYDFACH 410          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DBW0|IKZF5_DANRE (Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.259e-9
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC I F D   Y +HMG H   NP+QCN+CG +C + +DF  H
Sbjct:  359 VQDPQMLHHCPHCHIYFPDNILYTIHMGCHGYENPFQCNICGHRCRNSYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZLR2|IKZF5_CHICK (Zinc finger protein Pegasus OS=Gallus gallus OX=9031 GN=IKZF5 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.096e-9
Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            LH C HC + F D   Y +HMG H   NP+QCN+CG KC + +DF  H
Sbjct:  365 LHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCKCKNKYDFACH 412          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O42410|IKZF1_CHICK (DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.119e-9
Identity = 30/82 (36.59%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 1430 KHQKSQSDVMANG-EGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            K +  Q DV+  G + S +  K    N  Q   +++KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  428 KEESRQFDVLRAGTDNSQDAFKVISSNGEQV--RVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 507          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NRM0|IKZF5_XENLA (Zinc finger protein Pegasus OS=Xenopus laevis OX=8355 GN=ikzf5 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.632e-9
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 2
Query: 1511 IQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +Q    LH C HC + F D   Y +HMG H   NP+QCN+CG KC + +DF  H
Sbjct:  376 VQDPQLLHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCKCKNKYDFACH 429          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1S3KDL6 (zinc finger protein 423 OS=Lingula unguis OX=7574 GN=LOC106181024 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.609e-15
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 2
Query:  914 SANGT--NTFSDISRERIQAPCFICKICGETFINLDSLAMHMFIHVQQETNPNKEVPGHQKSTHPXXXXXXPIL-STNSVMPLPESIWSNHLNSSLYFKSLLTTSLIDPNKLQLELSRASDLFTT------GKIQSLTKFNSTISNNTEDEILE----RKCRSAPLYNTNLDEKSV---SSLNNDSEDKHQKSQSDVM----ANGEGSPNLLKE---CVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF 1684
            +A GT     +D+ R  +Q    +C  CG  F +LD+LAMHM  H   +    ++    +   H     ++P+      +     SI  + L   +      + S+++   +   L + S             +QS   F+  ++       L        +SA  Y  +    SV   ++ +  S+     S++  M     +GE SP+   E    VD  ++    L  C HCKI+F + T Y LHMGLHN+NN WQCN+CG+ C D  +F+ H +HF
Sbjct:  455 AAPGTVSQQRADMHRGNMQ----VCGQCGMIFTSLDALAMHMMTHAHHDMEDVEKERRQRGEGHSLWNSKEPMQPQVKRLRAASASIAGDALPLHIKRTRPASASMVEDMSVGASLRKVSSPHKAVPPKCPASLQSHPAFSEPVNFAHHSRALSLVPSASNKSAHTYEKSHTPSSVHVPATRSARSDCSTPLSETAQMNPDTTHGEASPSTSGETSSIVDFVLENRESLKMCRHCKIVFAEKTLYYLHMGLHNLNNAWQCNLCGRICRDAREFSAHVIHF 730          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A0L8I0P1 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22039808mg PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.689e-13
Identity = 31/49 (63.27%), Postives = 40/49 (81.63%), Query Frame = 2
Query: 1538 CNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF 1684
            C HC ++F +   Y LHMGLHNVNNPWQCN+CGK C+D+H+FT H++HF
Sbjct:  587 CKHCDVIFLNRILYHLHMGLHNVNNPWQCNICGKVCNDVHNFTTHAIHF 635          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: K1QP68 (C2H2-type domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10020807 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.916e-13
Identity = 30/51 (58.82%), Postives = 40/51 (78.43%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLH 1681
            ++ C  C+I+F + TT+ LH GLHNVNNPWQCNMCG+  SD+HDF+ H +H
Sbjct:  129 VYFCRFCEIIFLNRTTFYLHKGLHNVNNPWQCNMCGQTFSDVHDFSAHVIH 179          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: V4AEJ5 (C2H2-type domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_121808 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.685e-12
Identity = 35/72 (48.61%), Postives = 47/72 (65.28%), Query Frame = 2
Query: 1469 EGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF 1684
            E +PN+ KE + +     S    C +C+I++ D T Y LHMGLHNVNNPWQCN CGK C +  +F+ H LH+
Sbjct:   17 ESNPNIPKELLASR----SISCYCQYCEIIYLDRTIYQLHMGLHNVNNPWQCNACGKVCENRLEFSSHVLHY 84          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: T1G783 (C2H2-type domain-containing protein OS=Helobdella robusta OX=6412 GN=20216930 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.685e-12
Identity = 28/49 (57.14%), Postives = 39/49 (79.59%), Query Frame = 2
Query: 1538 CNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF 1684
            C HC+++F + T+Y LHMGLHN+N+PWQCN+CG KCSD   F+ H +H+
Sbjct:    2 CVHCELIFSEKTSYYLHMGLHNINDPWQCNLCGLKCSDSQSFSSHVMHY 50          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: ikzf1 (IKAROS family zinc finger 1 (Ikaros) [Source:ZFIN;Acc:ZDB-GENE-980526-304])

HSP 1 Score: 60.077 bits (144), Expect = 2.647e-9
Identity = 19/49 (38.78%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            + ++C HC++LF D   Y +HMG H   +P++CN+CG +  D ++F+ H
Sbjct:  298 RAYRCVHCRVLFLDHVMYTIHMGCHGFRDPFECNLCGYRSQDRYEFSSH 346          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: ikzf1 (IKAROS family zinc finger 1 (Ikaros) [Source:ZFIN;Acc:ZDB-GENE-980526-304])

HSP 1 Score: 59.6918 bits (143), Expect = 2.849e-9
Identity = 19/49 (38.78%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            + ++C HC++LF D   Y +HMG H   +P++CN+CG +  D ++F+ H
Sbjct:  280 RAYRCVHCRVLFLDHVMYTIHMGCHGFRDPFECNLCGYRSQDRYEFSSH 328          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: IKZF5 (zinc finger protein Pegasus-like [Source:NCBI gene;Acc:103042963])

HSP 1 Score: 60.077 bits (144), Expect = 2.998e-9
Identity = 22/48 (45.83%), Postives = 30/48 (62.50%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            L  C+HC++ F D   Y +HMG H    P+QCN+CG +C D +DF  H
Sbjct:  352 LFSCSHCQVYFADNILYTIHMGCHGYEKPFQCNVCGCQCRDRYDFACH 399          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: ikzf5 (zinc finger protein Pegasus [Source:NCBI gene;Acc:103043326])

HSP 1 Score: 58.9214 bits (141), Expect = 7.006e-9
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            L  C HC I F D   Y +HMG H   NP++CN+CG +C + +DF  H
Sbjct:  362 LQHCPHCHIYFPDNILYTIHMGCHGYENPFKCNICGYRCRNKYDFACH 409          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: ikzf1 (IKAROS family zinc finger 1 (Ikaros) [Source:ZFIN;Acc:ZDB-GENE-980526-304])

HSP 1 Score: 59.3066 bits (142), Expect = 7.384e-9
Identity = 19/49 (38.78%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            + ++C HC++LF D   Y +HMG H   +P++CN+CG +  D ++F+ H
Sbjct:  461 RAYRCVHCRVLFLDHVMYTIHMGCHGFRDPFECNLCGYRSQDRYEFSSH 509          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000869.1 (pep scaffold:Pmarinus_7.0:GL476362:938611:940054:-1 gene:ENSPMAG00000000793.1 transcript:ENSPMAT00000000869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 5.759e-11
Identity = 21/49 (42.86%), Postives = 32/49 (65.31%), Query Frame = 2
Query: 1526 KLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            + +KC HC++LF D   Y +HMG H   +P++CNMCG    D ++F+ H
Sbjct:  244 RAYKCQHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSH 292          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000367.1 (pep scaffold:Pmarinus_7.0:GL480594:46543:47925:-1 gene:ENSPMAG00000000331.1 transcript:ENSPMAT00000000367.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 5.811e-11
Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query: 1523 SKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            ++ H+C HC I F D   Y +HMG H   NP+QCN+CG  C D +DF+ H
Sbjct:  266 TEAHQCPHCDIYFPDNILYTIHMGCHGYENPFQCNVCGYCCHDRYDFSCH 315          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005061.1 (pep scaffold:Pmarinus_7.0:GL476392:809231:810583:1 gene:ENSPMAG00000004600.1 transcript:ENSPMAT00000005061.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.130e-9
Identity = 22/47 (46.81%), Postives = 30/47 (63.83%), Query Frame = 2
Query: 1532 HKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            H C HC I F D   + +HMG H  +NP+ CN+CG++C D +DF  H
Sbjct:  269 HTCPHCGIWFPDNVLFTIHMGCHGHDNPFWCNLCGRRCHDRYDFNCH 315          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ikzf4 (IKAROS family zinc finger 4 [Source:ZFIN;Acc:ZDB-GENE-180319-1])

HSP 1 Score: 58.9214 bits (141), Expect = 2.124e-9
Identity = 27/97 (27.84%), Postives = 47/97 (48.45%), Query Frame = 2
Query: 1403 SSLNNDSEDKHQKSQSDVMANGEGSP-------NLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            SS   D+     +     +  G G P        L    +  D +++ + + C HC+++F D   Y LHMG H   +P++CN+CG +  D ++F+ H
Sbjct:  401 SSATQDAASTPAREDVPQLQEGGGQPRPPASEGGLAYRVMGPDGEYM-RAYNCLHCQVIFLDHVMYTLHMGCHGFRDPFECNVCGHRSRDRYEFSSH 496          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ikzf4 (IKAROS family zinc finger 4 [Source:ZFIN;Acc:ZDB-GENE-180319-1])

HSP 1 Score: 58.9214 bits (141), Expect = 2.167e-9
Identity = 27/97 (27.84%), Postives = 47/97 (48.45%), Query Frame = 2
Query: 1403 SSLNNDSEDKHQKSQSDVMANGEGSP-------NLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            SS   D+     +     +  G G P        L    +  D +++ + + C HC+++F D   Y LHMG H   +P++CN+CG +  D ++F+ H
Sbjct:  483 SSATQDAASTPAREDVPQLQEGGGQPRPPASEGGLAYRVMGPDGEYM-RAYNCLHCQVIFLDHVMYTLHMGCHGFRDPFECNVCGHRSRDRYEFSSH 578          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: ikzf5 (zinc finger protein Pegasus [Source:NCBI gene;Acc:101167144])

HSP 1 Score: 64.3142 bits (155), Expect = 1.438e-10
Identity = 25/48 (52.08%), Postives = 29/48 (60.42%), Query Frame = 2
Query: 1529 LHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            LH C HC I F D   Y +HMG H   NP+QCN+CG KC   +DF  H
Sbjct:  364 LHHCQHCDIYFPDNILYTIHMGCHGYENPFQCNICGHKCKSKYDFACH 411          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: IKZF5 (IKAROS family zinc finger 5 [Source:NCBI gene;Acc:101163616])

HSP 1 Score: 60.4622 bits (145), Expect = 2.179e-9
Identity = 22/47 (46.81%), Postives = 31/47 (65.96%), Query Frame = 2
Query: 1532 HKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +KC HC++ F D   Y +HMG H  ++P+QCN CG  C+D +DF  H
Sbjct:  357 YKCQHCEVYFSDNILYTIHMGCHGYDHPFQCNNCGHMCTDKYDFACH 403          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: ikzf1 (IKAROS family zinc finger 1 [Source:NCBI gene;Acc:100125523])

HSP 1 Score: 60.4622 bits (145), Expect = 2.912e-9
Identity = 27/80 (33.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query: 1436 QKSQSDVM-ANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            Q+ Q D + AN E +    K    +  Q   + ++C HC++LF D   Y +HMG H   +P +CN+CG +  D ++F+ H
Sbjct:  453 QQRQYDALRANMEMASEGFKVVTSDGEQV--RAYRCEHCRVLFLDHVMYTIHMGCHGFRDPLECNLCGHRSQDRYEFSSH 530          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: ikzf1 (IKAROS family zinc finger 1 [Source:NCBI gene;Acc:100125523])

HSP 1 Score: 60.4622 bits (145), Expect = 4.015e-9
Identity = 25/83 (30.12%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 1424 EDKHQKSQSDVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +++ Q+    + AN E +    K    +  Q   + ++C HC++LF D   Y +HMG H   +P +CN+CG +  D ++F+ H
Sbjct:  540 KEEQQRQYDALRANMEMASEGFKVVTSDGEQV--RAYRCEHCRVLFLDHVMYTIHMGCHGFRDPLECNLCGHRSQDRYEFSSH 620          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: ikzf1 (IKAROS family zinc finger 1 [Source:NCBI gene;Acc:100125523])

HSP 1 Score: 60.077 bits (144), Expect = 4.799e-9
Identity = 25/83 (30.12%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 1424 EDKHQKSQSDVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVH 1672
            +++ Q+    + AN E +    K    +  Q   + ++C HC++LF D   Y +HMG H   +P +CN+CG +  D ++F+ H
Sbjct:  495 KEEQQRQYDALRANMEMASEGFKVVTSDGEQV--RAYRCEHCRVLFLDHVMYTIHMGCHGFRDPLECNLCGHRSQDRYEFSSH 575          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000014973.1 (SMESG000014973.1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 428/428 (100.00%), Postives = 428/428 (100.00%), Query Frame = 2
Query:  401 MDINSDENQDSTQIGEINPVNLVTRIKHEAEEPSTNLKNFTEISDFVNCFXXXXXXXXXYVPYSLSSDQSRIPFNPSNNGVDNNKKIDCFYPSSSTNFKHFSCPNCKLQFANRDSLAMHMMESVRLDGCQTHKTSKNKPSPTLPMLEPTNVNRSQFSTDYDNNCRDKIVSSSANGTNTFSDISRERIQAPCFICKICGETFINLDSLAMHMFIHVQQETNPNKEVPGHQKSTHPXXXXXXPILSTNSVMPLPESIWSNHLNSSLYFKSLLTTSLIDPNKLQLELSRASDLFTTGKIQSLTKFNSTISNNTEDEILERKCRSAPLYNTNLDEKSVSSLNNDSEDKHQKSQSDVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF 1684
            MDINSDENQDSTQIGEINPVNLVTRIKHEAEEPSTNLKNFTEISDFVNCFRRRRRGRSRYVPYSLSSDQSRIPFNPSNNGVDNNKKIDCFYPSSSTNFKHFSCPNCKLQFANRDSLAMHMMESVRLDGCQTHKTSKNKPSPTLPMLEPTNVNRSQFSTDYDNNCRDKIVSSSANGTNTFSDISRERIQAPCFICKICGETFINLDSLAMHMFIHVQQETNPNKEVPGHQKSTHPQQQQQQPILSTNSVMPLPESIWSNHLNSSLYFKSLLTTSLIDPNKLQLELSRASDLFTTGKIQSLTKFNSTISNNTEDEILERKCRSAPLYNTNLDEKSVSSLNNDSEDKHQKSQSDVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF
Sbjct:    1 MDINSDENQDSTQIGEINPVNLVTRIKHEAEEPSTNLKNFTEISDFVNCFRRRRRGRSRYVPYSLSSDQSRIPFNPSNNGVDNNKKIDCFYPSSSTNFKHFSCPNCKLQFANRDSLAMHMMESVRLDGCQTHKTSKNKPSPTLPMLEPTNVNRSQFSTDYDNNCRDKIVSSSANGTNTFSDISRERIQAPCFICKICGETFINLDSLAMHMFIHVQQETNPNKEVPGHQKSTHPQQQQQQPILSTNSVMPLPESIWSNHLNSSLYFKSLLTTSLIDPNKLQLELSRASDLFTTGKIQSLTKFNSTISNNTEDEILERKCRSAPLYNTNLDEKSVSSLNNDSEDKHQKSQSDVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLHNVNNPWQCNMCGKKCSDLHDFTVHSLHF 428          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IKZF11.385e-1044.90IKAROS family zinc finger 1 [Source:HGNC Symbol;Ac... [more]
IKZF11.843e-1044.90IKAROS family zinc finger 1 [Source:HGNC Symbol;Ac... [more]
IKZF11.863e-1044.90IKAROS family zinc finger 1 [Source:HGNC Symbol;Ac... [more]
IKZF13.444e-1032.50IKAROS family zinc finger 1 [Source:HGNC Symbol;Ac... [more]
IKZF14.275e-1044.90IKAROS family zinc finger 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ehn-36.787e-739.58Enhancer of HAND mutation hnd-1 [Source:UniProtKB... [more]
ehn-39.603e-742.22Enhancer of HAND mutation hnd-1 [Source:UniProtKB... [more]
ehn-31.377e-639.58Enhancer of HAND mutation hnd-1 [Source:UniProtKB... [more]
ztf-161.472e-639.58Zinc finger putative Transcription Factor family ... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hb7.561e-841.67gene:FBgn0001180 transcript:FBtr0081951[more]
hb7.561e-841.67gene:FBgn0001180 transcript:FBtr0081950[more]
CG127693.789e-741.67gene:FBgn0033252 transcript:FBtr0088827[more]
CG127693.931e-741.67gene:FBgn0033252 transcript:FBtr0088828[more]
CG127693.980e-741.67gene:FBgn0033252 transcript:FBtr0339281[more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ikzf51.668e-1046.30IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
ikzf51.668e-1046.30IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
ikzf51.668e-1046.30IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
ikzf51.668e-1046.30IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
ikzf51.668e-1046.30IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six32.672e-1044.90SIX homeobox 3 [Source:Xenbase;Acc:XB-GENE-478761][more]
six33.848e-1044.90SIX homeobox 3 [Source:Xenbase;Acc:XB-GENE-478761][more]
ikzf58.214e-1050.00IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
ikzf58.333e-1050.00IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
TRPS17.509e-943.21transcriptional repressor GATA binding 1 [Source:N... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ikzf53.785e-1146.30IKAROS family zinc finger 5 [Source:MGI Symbol;Acc... [more]
Ikzf51.509e-1046.30IKAROS family zinc finger 5 [Source:MGI Symbol;Acc... [more]
Ikzf15.986e-1044.90IKAROS family zinc finger 1 [Source:MGI Symbol;Acc... [more]
Ikzf17.910e-1044.90IKAROS family zinc finger 1 [Source:MGI Symbol;Acc... [more]
Ikzf18.349e-1044.90IKAROS family zinc finger 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BU00|IKZF5_MOUSE1.056e-946.30Zinc finger protein Pegasus OS=Mus musculus OX=100... [more]
sp|Q6DBW0|IKZF5_DANRE1.259e-946.30Zinc finger protein Pegasus OS=Danio rerio OX=7955... [more]
sp|Q5ZLR2|IKZF5_CHICK2.096e-950.00Zinc finger protein Pegasus OS=Gallus gallus OX=90... [more]
sp|O42410|IKZF1_CHICK2.119e-936.59DNA-binding protein Ikaros OS=Gallus gallus OX=903... [more]
sp|Q6NRM0|IKZF5_XENLA2.632e-946.30Zinc finger protein Pegasus OS=Xenopus laevis OX=8... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KDL64.609e-1526.79zinc finger protein 423 OS=Lingula unguis OX=7574 ... [more]
A0A0L8I0P12.689e-1363.27Uncharacterized protein OS=Octopus bimaculoides OX... [more]
K1QP683.916e-1358.82C2H2-type domain-containing protein OS=Crassostrea... [more]
V4AEJ51.685e-1248.61C2H2-type domain-containing protein OS=Lottia giga... [more]
T1G7831.685e-1257.14C2H2-type domain-containing protein OS=Helobdella ... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ikzf12.647e-938.78IKAROS family zinc finger 1 (Ikaros) [Source:ZFIN;... [more]
ikzf12.849e-938.78IKAROS family zinc finger 1 (Ikaros) [Source:ZFIN;... [more]
IKZF52.998e-945.83zinc finger protein Pegasus-like [Source:NCBI gene... [more]
ikzf57.006e-945.83zinc finger protein Pegasus [Source:NCBI gene;Acc:... [more]
ikzf17.384e-938.78IKAROS family zinc finger 1 (Ikaros) [Source:ZFIN;... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000869.15.759e-1142.86pep scaffold:Pmarinus_7.0:GL476362:938611:940054:-... [more]
ENSPMAT00000000367.15.811e-1148.00pep scaffold:Pmarinus_7.0:GL480594:46543:47925:-1 ... [more]
ENSPMAT00000005061.11.130e-946.81pep scaffold:Pmarinus_7.0:GL476392:809231:810583:1... [more]
ikzf42.124e-927.84IKAROS family zinc finger 4 [Source:ZFIN;Acc:ZDB-G... [more]
ikzf42.167e-927.84IKAROS family zinc finger 4 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ikzf51.438e-1052.08zinc finger protein Pegasus [Source:NCBI gene;Acc:... [more]
IKZF52.179e-946.81IKAROS family zinc finger 5 [Source:NCBI gene;Acc:... [more]
ikzf12.912e-933.75IKAROS family zinc finger 1 [Source:NCBI gene;Acc:... [more]
ikzf14.015e-930.12IKAROS family zinc finger 1 [Source:NCBI gene;Acc:... [more]
ikzf14.799e-930.12IKAROS family zinc finger 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000014973.10.000e+0100.00SMESG000014973.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024902 ID=SMED30024902|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1835bp
GGGGTGTGTGCTGTCTTTGAGTAGGGCCCCTACACCAGCCAGTGTTTGGA
ATTCGTGAATAATTTATTCATTCGTGTTTGAAGGATAGTTTGAAAGCAAG
CAGACATAGCCGATGTCAGTTTCATGTTGACGCATACATTTTAGATGAAG
AAAGAAATAATAGGACGATTACGATTGGCTGTTGGATGATACACACATTT
TATCGAGTAAAAATTGTGTGTGTGTGCGAACTTATTTACAACTCGATGCA
TTGAGTATAATTAGAGTAACTGCTTACATTAGATATATGCTTGGTCGATA
ATTCGTTAATTTTTTTCAAAACTGTTTTCTGGATATTCGGCGAACAACGG
ATTAAACGAAACAAAACAAAACGATTAATCAACAAATATTAATTAAATTT
ATGGATATTAATTCTGATGAAAATCAAGATTCAACGCAGATAGGAGAGAT
CAATCCCGTAAACCTTGTCACCAGAATCAAGCATGAAGCCGAAGAACCTT
CGACAAATCTTAAAAATTTCACTGAAATTTCAGATTTCGTCAATTGTTTT
CGAAGGCGACGTCGAGGTCGAAGTCGCTATGTTCCATATAGTCTGTCAAG
TGACCAATCTCGAATCCCATTCAATCCATCCAACAATGGCGTTGATAATA
ATAAAAAAATCGACTGTTTTTATCCGAGTTCCTCTACAAATTTTAAACAT
TTTTCCTGTCCGAATTGTAAATTACAATTCGCAAATCGCGACTCGCTAGC
AATGCACATGATGGAGAGTGTCAGGCTCGACGGATGTCAAACTCACAAAA
CCTCTAAAAACAAACCAAGTCCCACTTTGCCAATGCTTGAGCCAACTAAC
GTAAACAGATCTCAATTTTCCACAGATTACGACAATAACTGTCGGGATAA
AATTGTTTCGTCGTCAGCAAATGGAACGAATACGTTCTCAGATATCAGCC
GGGAAAGAATTCAAGCTCCATGCTTCATTTGTAAAATATGTGGCGAGACC
TTCATCAATTTAGATTCACTGGCCATGCACATGTTTATTCATGTTCAACA
AGAAACAAACCCAAACAAAGAGGTTCCTGGCCATCAAAAATCAACTCACC
CCCAACAACAACAACAACAGCCAATTTTATCAACCAACTCGGTAATGCCC
TTACCAGAGTCCATATGGAGCAATCACCTCAACTCGTCTCTCTATTTCAA
AAGTCTATTAACCACATCCTTAATCGACCCTAACAAACTCCAACTCGAGT
TATCTAGAGCATCAGATCTTTTTACGACTGGTAAAATCCAGTCATTGACC
AAATTCAACTCTACCATATCTAACAATACAGAAGATGAAATTTTGGAAAG
AAAATGCCGTTCAGCTCCTCTTTACAACACAAACCTAGATGAAAAATCCG
TGTCAAGTTTAAACAACGACTCAGAAGACAAGCACCAAAAGTCACAGAGT
GACGTAATGGCAAATGGTGAAGGGAGCCCAAATTTGTTGAAAGAGTGCGT
AGATAATGACATCCAATTCCTGTCGAAACTTCACAAATGCAATCATTGCA
AAATCCTTTTTGAAGATGCCACGACCTACTGCCTTCACATGGGGCTGCAT
AACGTCAACAATCCTTGGCAGTGCAACATGTGCGGCAAGAAGTGTTCCGA
CCTTCACGATTTCACGGTCCACTCTCTCCATTTCTGAGTCCCCAATCGGT
GTTACGCACCAGACCAACTTAGAGGATTATGAAGACTTGCAAATATCTAT
TTCTCCTAATGACATTTTTAAATGAATCATGAAAATTTTGAAAATTTCTG
TAATAATACATATTTCGTTTTGCACTTTCTAGCCC
back to top

protein sequence of SMED30024902-orf-1

>SMED30024902-orf-1 ID=SMED30024902-orf-1|Name=SMED30024902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=429bp
MDINSDENQDSTQIGEINPVNLVTRIKHEAEEPSTNLKNFTEISDFVNCF
RRRRRGRSRYVPYSLSSDQSRIPFNPSNNGVDNNKKIDCFYPSSSTNFKH
FSCPNCKLQFANRDSLAMHMMESVRLDGCQTHKTSKNKPSPTLPMLEPTN
VNRSQFSTDYDNNCRDKIVSSSANGTNTFSDISRERIQAPCFICKICGET
FINLDSLAMHMFIHVQQETNPNKEVPGHQKSTHPQQQQQQPILSTNSVMP
LPESIWSNHLNSSLYFKSLLTTSLIDPNKLQLELSRASDLFTTGKIQSLT
KFNSTISNNTEDEILERKCRSAPLYNTNLDEKSVSSLNNDSEDKHQKSQS
DVMANGEGSPNLLKECVDNDIQFLSKLHKCNHCKILFEDATTYCLHMGLH
NVNNPWQCNMCGKKCSDLHDFTVHSLHF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 378..400
e-value: 4.8
score: 16.1
coord: 192..214
e-value: 0.0012
score: 28.1
coord: 406..427
e-value: 13.0
score: 12.3
coord: 101..121
e-value: 13.0
score: 12.2
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 192..214
e-value: 0.0011
score: 19.2
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 194..214
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 380..400
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 378..405
score: 8.538
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 192..219
score: 11.011
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 336..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 330..354
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..241
NoneNo IPR availablePANTHERPTHR24404ZINC FINGER PROTEINcoord: 38..424
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 376..425
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 191..218