Protocadherin

Overview
NameProtocadherin
Smed IDSMED30024873
Length (bp)2961
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30024873) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30024873) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30024873) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30024873) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024873

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024873SMESG000044242.1 SmedASXL_011865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024873SMESG000044242.1 dd_Smed_v4_21837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024873SMESG000044242.1 dd_Smed_v4_21837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024873SMESG000044242.1 dd_Smed_v4_21837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30024873SMESG000044242.1 SMED30024873smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 251.136 bits (640), Expect = 9.774e-69
Identity = 200/679 (29.46%), Postives = 319/679 (46.98%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY--FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN-NNLNEPIVD------VSVHDLDQGINGQFNCFLIGHKGFDLL-FKQNLSD-LIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA-----LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P++  P I L+I EN  IG+LF IP A D D                +   F L  +  D E + P+L +  ++DRE  D  +L I + D GSPP     ++ + +LD NDN P F    Y   L EN  +   + I V A D D G   ++ Y    +  + V+R   ++   G I +   +D +  + L +S  V+A D G    S+   V++ + D+ND  P I + + +  +T  +   N++E + +      V V D D+G N    C + G   F L    +  SD    Y L      D EK       I   D G P L+S+  + V +VDVNDN P F+   T  +  E++  G V+ ++ A D D G N++L+Y +        +F   +    G + V   LDR    E + + VV +D G P+L     + +N++D N+  P F  S ++F+V E+       +P    +G + V D DKG NAQ+ L+++ +   F I +  G + S    DRE++  Y   L A+DG   V  R    G V I + D NDN+P        P+  S+K       +      +  ED DSG NA +  SI  G     F I     ++ L ++++  H G+H+L+V   DRG+PP+  +  + + ++++
Sbjct:  160 DINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQ-VAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSV-IQVKANDSDQGANAEIEYTFHQA-PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFS--VLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLF--TISPETGEIQVKTSLDREQR-ESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMEN-------MPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG--GVPPRSAYVG-VTINVLDENDNAPYIT----APSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 815          

HSP 2 Score: 145.976 bits (367), Expect = 6.530e-35
Identity = 162/637 (25.43%), Postives = 270/637 (42.39%), Query Frame = 2
Query:  629 IELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVS--NTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF--------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISD---------PRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN-IGYIAVSDCDKGVNAQLTLAIKDNINK---FQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL------FVEDKDSGANAVVDLSIKP-----------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI---DDSQPL--SPKNMVH 2389
            +E  + +TD   +GSP L  EG I +Q  D+NDN P F++    +++ EN  + SL PI + A D D+G  G  SY+        +      A +    + +LI   + D     SY   +   D G P  +SS  + + ++D ND  P     +   +  + EN+ +   ++ V  +D DQG N +       H+  +++ +    D     +  +   DRE  +    ++   D G    ++   + V + D+NDN PT  +             +I E     T V  V+  D+DEG N+ +   ++            T +     + +++   L   +  D       +++ +V  D G P LS+   + + ++D+N+  PVF QS      PE+         KP   I  I  SD D G NA+L  +++        F IS   G +Q    LDRE++E Y+L ++A D G+P +Q     T +V++ + D NDN P F  +        Y   V   + AL       V D D G NA V LS++            G I    S DR++QS              +   +   D G PP+S+ + + I +   +D+ P   +P N  H
Sbjct:  134 LEFEVSITDLVQNGSPRLL-EGQIEVQ--DINDNTPNFASPVITLAIPENTNIGSLFPIPL-ASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP--KFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-------YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPEN--------NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQ----GTATVLVNVLDCNDNDPKFMLS-------GYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQST-------------YTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSH 723          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH7 (protocadherin 7 [Source:HGNC Symbol;Acc:HGNC:8659])

HSP 1 Score: 250.366 bits (638), Expect = 1.824e-68
Identity = 211/693 (30.45%), Postives = 325/693 (46.90%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITID---------DSQPLS----PKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ T+G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L    +     +   Y L      D E        I   D G PSL+S+  + V + D NDN P F          E++  G  V  V A D D G N+++ Y +      + +   F I+ + G++LVN  LDR    + +   V   D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++N N F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P       LP  +SY        VR  +  +   D D G NA ++ SI  G     F ID     V L  KL  +H G+H+L+V   D G+P +S++  + + ++         DSQ       P       +   +I+K+ + I I V+  ++ +   I IV++   CR K K
Sbjct:  241 SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPI-LQLRAADLDVGVNGQIEYVFGAA-TESVRRLLRLDETSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLD-----SSVMGIFAIDPDSGDILVNTVLDR-EQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTVT----LPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNK 909          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH7 (protocadherin 7 [Source:HGNC Symbol;Acc:HGNC:8659])

HSP 1 Score: 250.366 bits (638), Expect = 1.884e-68
Identity = 211/693 (30.45%), Postives = 325/693 (46.90%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITID---------DSQPLS----PKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ T+G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L    +     +   Y L      D E        I   D G PSL+S+  + V + D NDN P F          E++  G  V  V A D D G N+++ Y +      + +   F I+ + G++LVN  LDR    + +   V   D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++N N F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P       LP  +SY        VR  +  +   D D G NA ++ SI  G     F ID     V L  KL  +H G+H+L+V   D G+P +S++  + + ++         DSQ       P       +   +I+K+ + I I V+  ++ +   I IV++   CR K K
Sbjct:  241 SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPI-LQLRAADLDVGVNGQIEYVFGAA-TESVRRLLRLDETSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLD-----SSVMGIFAIDPDSGDILVNTVLDR-EQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTVT----LPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNK 909          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 251.136 bits (640), Expect = 2.086e-68
Identity = 200/679 (29.46%), Postives = 318/679 (46.83%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY--FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN-NNLNEPIVD------VSVHDLDQGINGQFNCFLIGHKGFDLL-FKQNLSD-LIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA-----LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P++  P I L+I EN  IG+LF IP A D D                +   F L     D E + P+L +  ++DRE  D  +L I + D GSPP     ++ + +LD NDN P F    Y   L EN  +   + I V A D D G   ++ Y    +  + V+R   ++   G I +   +D +  + L +S  V+A D G    S+   V++ + D+ND  P I + + +  +T  +   N++E + +      V V D D+G N    C + G   F L    +  SD    Y L      D EK       I   D G P L+S+  + V +VDVNDN P F+   T  +  E++  G V+ ++ A D D G N++L+Y +        +F   +    G + V   LDR    E + + VV +D G P+L     + +N++D N+  P F  S ++F+V E+       +P    +G + V D DKG NAQ+ L+++ +   F I +  G + S    DRE++  Y   L A+DG   V  R    G V I + D NDN+P        P+  S+K       +      +  ED DSG NA +  SI  G     F I     ++ L ++++  H G+H+L+V   DRG+PP+  +  + + ++++
Sbjct:  160 DINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVA-EDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSV-IQVKANDSDQGANAEIEYTFHQA-PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFS--VLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLF--TISPETGEIQVKTSLDREQR-ESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMEN-------MPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG--GVPPRSAYVG-VTINVLDENDNAPYIT----APSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 815          

HSP 2 Score: 146.362 bits (368), Expect = 7.092e-35
Identity = 162/637 (25.43%), Postives = 270/637 (42.39%), Query Frame = 2
Query:  629 IELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSY--KHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF--------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISD---------PRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN-IGYIAVSDCDKGVNAQLTLAIKDNINK---FQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL------FVEDKDSGANAVVDLSIKP-----------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI---DDSQPL--SPKNMVH 2389
            +E  + +TD   +GSP L  EG I +Q  D+NDN P F++    +++ EN  + SL PI + A D D+G  G  SY  +      +      A +    + +LI   + D     SY   +   D G P  +SS  + + ++D ND  P     +   +  + EN+ +   ++ V  +D DQG N +       H+  +++ +    D     +  +   DRE  +    ++   D G    ++   + V + D+NDN PT  +             +I E     T V  V+  D+DEG N+ +   ++            T +     + +++   L   +  D       +++ +V  D G P LS+   + + ++D+N+  PVF QS      PE+         KP   I  I  SD D G NA+L  +++        F IS   G +Q    LDRE++E Y+L ++A D G+P +Q     T +V++ + D NDN P F  +        Y   V   + AL       V D D G NA V LS++            G I    S DR++QS              +   +   D G PP+S+ + + I +   +D+ P   +P N  H
Sbjct:  134 LEFEVSITDLVQNGSPRLL-EGQIEVQ--DINDNTPNFASPVITLAIPENTNIGSLFPIPL-ASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP--KFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-------YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPEN--------NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQ----GTATVLVNVLDCNDNDPKFMLS-------GYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQST-------------YTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSH 723          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 241.506 bits (615), Expect = 1.074e-65
Identity = 204/658 (31.00%), Postives = 320/658 (48.63%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDI--TIF--ENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPF-LIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYK----EYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRP 2314
            D NDNAP +P P I +SI EN  I + F IP A D D T  N    Y++    S F L  + T +  ++P+L ++ ++DRE  D   + I + D G+P  +   I+ + + DVNDN P F   +  + + EN  + + + I + A D D G+  ++ Y        + KR FA+N+T G I + +SLD +   E +   V V    G  +  +  TV IN+ DVND  P I L   +  I  T++  E + +N  I  ++V D D  +NG+  CF+     F L  K    +  + +  +   ++  KE F++  I   D G PSL  + L+ V + D NDN P F+ P    S+ E++  G  +T + A D+D G N+ ++Y +      N  F  F L    G L  ++  DR  + E F   V   D+G P L +Q  + + ++D N+  P F  + F F V E+       +PK   +G I V+D D G N  +TL+I  DN N     ++G+++S    DRE++  Y   + A DG    Q   + T  V I + D+NDNSP+       P+  S+K      +   ++A +F  D D+G NA +  +I  G     F ID    ++ L  K      G+H+L+V   D G P
Sbjct:  134 DTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSV-IQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDRE---ETAIHKVTVLASDGS-STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHL--KAVYDNQYLLETSSLLDYEGTKE-FSF-KIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASF--FDLDRKTGVLTASRVFDR-EEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSEN-------LPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG---QPPRSSTAKVTINVMDVNDNSPVV---ISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 162.925 bits (411), Expect = 3.259e-40
Identity = 171/587 (29.13%), Postives = 264/587 (44.97%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK---GFDLLFK-QNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSM-----PATSFSIL-EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHL---DRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI----KPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I I + D NDN P F +    IS+ EN  +NS  PI  SA D D+G  G   Y+  + N  SV     + +  GE   +LI   + D   + +Y   +   D G P  SS+  + + + DVND  P+    +   ++ I EN  +   ++ +   D D G N +   ++ G +       LF   N + LI  Q       DRE+ A    T+   D    S  +   +T+ + DVNDN P   +     P      L E  P+ T +  +   DKD  +N ++I  I       +   PF +++   +  NQ+L     LLD E    FS  +V SD G+P+L+    + + L D N+ PP+FNQ     +V E+    L L         I+ +D D G NA +   +  N + F +    G+L +  V DREE+E +  T+ A D GTP +Q +     +V++ + D NDNSP F H +F      +  +Y    +I   V D D+G N  V LSI       ++ PY  +      +K N     E Q  +   V   D G+PP+SS+ ++ I + D    SP
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPI-PSATDPDTGFNGVQHYE--LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPV--FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIR-YIFGAQVAPATKRLFALNNTTGLITVQ----RSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI-------EREVPFHLKA---VYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLT-------TISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQ----AAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVIT--VTDADAGENKAVTLSILNDNDNFVLDPYSGV------IKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          

HSP 3 Score: 134.806 bits (338), Expect = 1.760e-31
Identity = 157/551 (28.49%), Postives = 243/551 (44.10%), Query Frame = 2
Query:  794 INVSAVDCDSGNFGKLSYKHSVSNTDS--VKRHFAINSTNGEI----------RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING-QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQL--IYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGR-PALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLV-PKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN---KFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE--LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            +N+S ++  +G    L Y+      D+  VK    ++S+ GEI          +L     Y   NE  +   VV   +    L     + I + D ND  P+      + +I+I EN  +N      S  D D G NG Q    L G   F L   +        QL+ +   DRE++      I   D G P  +S+ ++ V + DVNDN P F        I E++P+GT V ++ A D D G N+++  I+       T ++F   L  + G + V + LDR  +  I  V V+ SD    PA   +  +TIN+ D+N+ PP  N    +   P + + +L    P    I  I VSD D  VN ++   I+  +    K    +  +L++ ++LD E  +E+   ++A D G P +      T  V + L D NDN PIF  N P+  ++S  E  R    L  +   D+DSG NA  D+  + G  A +F +DR    +  +R    E Q      V  +D G PP  S   + +T+ D    SPK
Sbjct:   47 LNISHINAATGTSASLVYRLVSKAGDAPLVK----VSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFA--LNNTTGLITVQRSLDR-EETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPP--NIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLN----QTALVRVKLEDENDNPPIF--NQPV-IELSVSENNRRGLYLTTISATDEDSGKNA--DIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK 571          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 197.593 bits (501), Expect = 3.685e-51
Identity = 172/612 (28.10%), Postives = 294/612 (48.04%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGY----IAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL------IALFVEDKDSGANAVVDLSIKPGIIAP---YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            ++  + +DRET   I L ++ +D G+P      ++ I ++DVNDN P F++  Y +++ EN  + +++   V A D D G  GK+ Y  + S   S      I+ + GE+ L + +D         + V+ A D  QPALSS+  + IN++D+ND  P  +L  + K IT+ EN  + E +  V   D D G NG     + G +  D +  ++   +   +L+     DRE  A     +T  D G PSL +S  I V++ D+NDN PTF     + +I E  P G+ +  ++A+D DE  + ++ Y I +     ++F    I   G +L V+  L R    +   V V +S   +  L  +  + + + D+N+  P FN   F   +PE    H P       IGY    +   D D+G NA++  +I D+   F+I   +G +   + LDRE++  + + + A D  +P +      +  + + L+D+NDNSP F       T  SY   +  ++      + +   D D G N +VD  +     +P    F +DR   +++++ KL  E   +  L +  +DRG P  S++ EI +T+ D    +P
Sbjct:  327 IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIA-TVKATDEDFGTNGKVHYSMASS---SGIGGLTIDYSTGEVTLRERID---AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP--TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE--DFIIDEDSGLIKTTKLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEE--ADREVFSILDIGDQGAILSVSGELKR----QDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPE----HSP-------IGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN----TSTQIEVILDDINDNSPQF-------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 890          

HSP 2 Score: 179.489 bits (454), Expect = 2.066e-45
Identity = 156/603 (25.87%), Postives = 282/603 (46.77%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAV--SDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            +++L  S+DRE  D+  L +   +   P ++    + + +LDV DN P F    Y   +RE+  + + + ++V A D DSG  G++ Y     N    K   AIN+ +G I+    LD ++ + +     V+A D G P   S+  V I +VDVND  P+ + +    ++TI EN  +   I  V   D D G NG+ +  +    G   L      D    ++  + + D  K +     I   D   P+L+S+  +T+ ++D+ND+ PT        ++ E+  IG  V +V A+D+D G N  + Y +            F+I+ +  L+      +LLD E    +S+ V   D G P+L+    I + L DIN+  P F++  ++ T+ E+       +P+   I  +    +D D+ +  ++  A ++  +   I   G + SV+   + +  + ++ + A D    +Q R  V     +F++D+N ++P F+ + P   K+     + + +I L  ED D G NA +  SI     + +F ID     + ++  L  E +    +IV   D   PP ++S +I++ +DD    SP+
Sbjct:  221 EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTV-LSVFARDLDSGENGEIEYSLGEGNG---KNLLAINAKSGVIQTAAPLDRETLSLIRLD--VIASDKGTPKRESTAMVEITVVDVNDNAPVFASDS--YNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL----TIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-------FIIDEDSGLI---KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEE-------MPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATD-QGGLQGRCVVN----VFIDDVN-SAPYFN-DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ 783          

HSP 3 Score: 165.236 bits (417), Expect = 4.892e-41
Identity = 185/650 (28.46%), Postives = 288/650 (44.31%), Query Frame = 2
Query:  377 DLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSV--HDLDQGINGQ--------FNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN-----INKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE------LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKL 2254
            D+NDNAP +      ++I EN  I  +     A D D               +S   +  L  D  +   ++ L+  ID + N  I  VI   D   P L+    +TI ++D+ND+ PT    + +I+L EN  +   +   V A+D DSG  G + Y    S        F I+  +G I+  K LD ++     YS  V A D G P+L++STT+ + + D+ND  P  + +K   ++TI E       I+ +    +D DQ I  +        F+   IG +G  L     L           HK   E        I+  D G   L    ++ V I DVN + P F+    S  I EHSPIG  V  ++A D D G N++++Y I     ++Q F   +  S+G++ V+  LDR  D   FSVIV  SDH  P L+   +I + L DIN+  P F  S++  T+ ED       +P   +   ++  D D G N  +   + ++     I  F++   +G L+  + LDRE+     L + A D GTP +    +    + + L+D+NDN+P F        ++SY  Y+         +  +   D D G NA +   I  G  A  F I+ D +   + R L
Sbjct:  367 DVNDNAPVFASDSYNVTILENITIPAVIATVKATDED----FGTNGKVHYSMASSSGIGGLTID--YSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG-RVYAIDEDSGPNGIIKYSMEGS------EDFIIDEDSGLIKTTKLLDRET--TARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP--TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK-------RQDHKVRVE--------ISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID----SSQFFR--IDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED-------IPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL----SAASEITLTLSDVNDNAPTFE-------QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRIL 955          

HSP 4 Score: 154.836 bits (390), Expect = 7.823e-38
Identity = 129/527 (24.48%), Postives = 243/527 (46.11%), Query Frame = 2
Query:  731 FSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRN---------FPLPTKVSYKEYV---RHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQG 2272
            F   KY+  L E+  + ++    +++V     +   L Y          +  F +++ +GEIRL KS+D +  ++  +   V A++   P +S+STTV+++++DV D  PI   +    +I   E+  +   ++ V   DLD G NG+    L    G +LL     S +I          DRE  +     +   D G P   S+ ++ + +VDVNDN P F+  + + +ILE+  I  V+  V+A D+D G N ++ Y ++       +   +   S G + + + +D        + ++   D  +PALS+ + +TIN+IDIN+  P    +    T+ E+       V     +G +   D D G N  +  +++ + +      +G++++  +LDRE    Y L + A D GTP +    T    + + L D+NDN+P F +           P  +++   + V     + I   +E+ D    +++D+  +  I++   S +  RQ  K+  ++ +  QG
Sbjct:  165 FQQEKYVKELPEDTPIETI----IASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDK--HILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIR--EDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVI----QTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY---STGEVTLRERID--AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN-------VAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT----IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILS--VSGELKRQDHKVRVEISATDQG 661          

HSP 5 Score: 116.316 bits (290), Expect = 7.177e-26
Identity = 139/504 (27.58%), Postives = 225/504 (44.64%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFD--LLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNG--NLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN 1873
            D+NDNAP +  K   ++ISE    G+      AVD D  +K      +  ++       F   D   Q   L +   + R+ + ++ + I  TD G   L G  ++ + I DVN + P F+ H + + + E+  +   + I + A D D G+  ++ Y     + DS  + F I+ ++G+I +  S D D  +  ++S +V A DH  P L++ST + + + D+ND  P      S    TI E+  +    + VS  D D G NG  + FL          LF+    D     L    K DRE+ A     I   D G PSL+++  IT+ + DVNDN PTF   +    I E+SP+G+ V  + A D DEG N+ + + I               E NG   +L     D       F   +  S      LS+ + + I++ D+N+  P        F +  +  D++ +    R IG+I   D D+  NA L   +++N
Sbjct:  573 DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADRE------VFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPV-ITLKAEDHDRGDNARIVY-----SIDS-SQFFRIDPSSGDISV--SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRL---DRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKD----FVILMNRFDNVQMA---RQIGFIPAFDPDQ--NATLEYFLEEN 1040          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 180.644 bits (457), Expect = 7.578e-46
Identity = 163/573 (28.45%), Postives = 277/573 (48.34%), Query Frame = 2
Query:  686 IITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGY----IAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAP---YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            ++ I ++DVNDN P F++  Y +++ EN  + +++   V A D D G  GK+ Y  + S   S      I+ + GE+ L + +D  +      + V+ A D  QPALSS+  + IN++D+ND  P  +L  + K IT+ EN  + E +  V   D D G NG     + G +  D +  ++   +   +L+     DRE  A     +T  D G PSL +S  I V++ D+NDN PTF     + +I E  P G+ +  ++A+D DE  + ++ Y I +     ++F    I   G +L V+  L R    +   V V +S   +  L  +  + + + D+N+  P FN   F   +PE    H P       IGY    +   D D+G NA++  +I D+   F+I   +G +   + LDRE++  + + + A D  +P +      +  + + L+D+NDNSP F  +    T +S    V    + +   D D G N +VD  +     +P    F +DR   +++++ KL  E   +  L +  +DRG P  S++ EI +T+ D    +P
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIA-TVKATDEDFGTNGKVHYSMASS---SGIGGLTIDYSTGEVTLRERIDAKNS---PITAVIRAKDGAQPALSSTVPLTINVIDINDHAP--TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE--DFIIDEDSGLIKTTKLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEE--ADREVFSILDIGDQGAILSVSGELKR----QDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPE----HSP-------IGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN----TSTQIEVILDDINDNSPQFTSSSYAAT-ISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 531          

HSP 2 Score: 164.851 bits (416), Expect = 5.714e-41
Identity = 185/650 (28.46%), Postives = 288/650 (44.31%), Query Frame = 2
Query:  377 DLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSV--HDLDQGINGQ--------FNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKD-----NINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE------LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKL 2254
            D+NDNAP +      ++I EN  I  +     A D D               +S   +  L  D  +   ++ L+  ID + N  I  VI   D   P L+    +TI ++D+ND+ PT    + +I+L EN  +   +   V A+D DSG  G + Y    S        F I+  +G I+  K LD ++     YS  V A D G P+L++STT+ + + D+ND  P  + +K   ++TI E       I+ +    +D DQ I  +        F+   IG +G  L     L           HK   E        I+  D G   L    ++ V I DVN + P F+    S  I EHSPIG  V  ++A D D G N++++Y I     ++Q F   +  S+G++ V+  LDR  D   FSVIV  SDH  P L+   +I + L DIN+  P F  S++  T+ ED       +P   +   ++  D D G N  +   + +     +I  F++   +G L+  + LDRE+     L + A D GTP +    +    + + L+D+NDN+P F        ++SY  Y+         +  +   D D G NA +   I  G  A  F I+ D +   + R L
Sbjct:    8 DVNDNAPVFASDSYNVTILENITIPAVIATVKATDED----FGTNGKVHYSMASSSGIGGLTID--YSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG-RVYAIDEDSGPNGIIKYSMEGS------EDFIIDEDSGLIKTTKLLDRET--TARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP--TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK-------RQDHKVRVE--------ISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID----SSQFFR--IDPSSGDISVSSDLDR-EDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED-------IPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL----SAASEITLTLSDVNDNAPTFE-------QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRIL 596          

HSP 3 Score: 140.584 bits (353), Expect = 2.265e-33
Identity = 145/507 (28.60%), Postives = 230/507 (45.36%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTD-----SVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVV---VSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK--FQI----SHNGMLQ--SVAVLDREEKE-EYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSP 2056
            +K    +DRET  R  L +   D G+P L     I + + D+NDN PTF   +Y +++ E     S + I + AVD D     K++Y+   ++ +      +    AI S +GE   +K  D+    E+S      A D G   L     V + I DVN   P    N     + I E++ +  P++ +   D D+G N +    +   + F +       D     +      DRE  A     +T  D+  P L +S  I VI+ D+NDN P F+  + + +I E  P+GT   +V A+D D G N  + Y +++  ++  +    L  ++G L V+  LDR    E F+VIV+     D G P+LS   EIT+ L D+N+  P F Q ++   + E+        P    +G I   D D+G NA ++  I    +   F I      NG+++  + A  D E K  ++   L A  G    Q+  TV   V I ++D+NDN P
Sbjct:  174 IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQI-ITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGE---LKRQDHKVRVEIS------ATDQG--GLQGRCVVNVFIDDVN-SAPY--FNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRI-------DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDR----EQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENS-------PVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG----QLSSTV--PVRIHVSDVNDNKP 639          

HSP 4 Score: 124.02 bits (310), Expect = 2.492e-28
Identity = 115/457 (25.16%), Postives = 211/457 (46.17%), Query Frame = 2
Query: 1022 VIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAV--SDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            V I +VDVND  P+ + +    ++TI EN  +   I  V   D D G NG+ +  +    G   L      D    ++  + + D  K +     I   D   P+L+S+  +T+ ++D+ND+ PT        ++ E+  IG  V +V A+D+D G N  + Y +            F+I+ +  L+      +LLD E    +S+ V   D G P+L+    I + L DIN+  P F++  ++ T+ E+       +P+   I  +    +D D+ +  ++  A ++  +   I   G + SV+   + +  + ++ + A D    +Q R  V     +F++D+N ++P F+ + P   K+     + + +I L  ED D G NA +  SI     + +F ID     + ++  L  E +    +IV   D   PP ++S +I++ +DD    SP+
Sbjct:    2 VEITVVDVNDNAPVFASDS--YNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL----TIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-------FIIDEDSGLI---KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEE-------MPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATD-QGGLQGRCVVN----VFIDDVN-SAPYFN-DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ 424          

HSP 5 Score: 115.546 bits (288), Expect = 1.038e-25
Identity = 139/504 (27.58%), Postives = 225/504 (44.64%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFD--LLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNG--NLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN 1873
            D+NDNAP +  K   ++ISE    G+      AVD D  +K      +  ++       F   D   Q   L +   + R+ + ++ + I  TD G   L G  ++ + I DVN + P F+ H + + + E+  +   + I + A D D G+  ++ Y     + DS  + F I+ ++G+I +  S D D  +  ++S +V A DH  P L++ST + + + D+ND  P      S    TI E+  +    + VS  D D G NG  + FL          LF+    D     L    K DRE+ A     I   D G PSL+++  IT+ + DVNDN PTF   +    I E+SP+G+ V  + A D DEG N+ + + I               E NG   +L     D       F   +  S      LS+ + + I++ D+N+  P        F +  +  D++ +    R IG+I   D D+  NA L   +++N
Sbjct:  214 DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADRE------VFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPV-ITLKAEDHDRGDNARIVY-----SIDS-SQFFRIDPSSGDISV--SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRL---DRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKD----FVILMNRFDNVQMA---RQIGFIPAFDPDQ--NATLEYFLEEN 681          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 159.458 bits (402), Expect = 2.933e-39
Identity = 197/707 (27.86%), Postives = 305/707 (43.14%), Query Frame = 2
Query:  377 DLNDNAPHWP-KPIELSISENAFIGTLFNIPPAVDLDR-XXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELP---IISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAV---LDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE--LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLAL 2467
            D NDNAP +  + ++L ISE A +GT F +P   D D       +        ++ F LA    +++ Q   L +   +DRE  D+ EL+I   D G P   G+   +I+I+D NDN P FS  +Y  S+  N  + S L I V A D D G   ++SY    ++  S   +FAI S +G I    SL   S    ++  +VVA DHG P+LSSS  V I ++      P   II L +S     + EN+ L   +  VS+         Q+    +   G   L  Q      +Y L+     DRE  +  +        G   +   QL+T  I D+NDN P +       S+         +T   A D D G N  + Y + D    +      + +  G + V   +D  +  EI    V   D G PALS  +++  +L+D  + PP F ++ +   +PED      LV    N      S C      + +L  +D      ++ + M  +V +    D E+++ Y+ T+IA +   +     T T  + I L D+NDN PIF   +P    ++ +E  + E  L+ +   D DSG    V   I     +  FSI+     V   + L    +G   L+V  KD G     +S  I IT+ D    +P+    F+ SK +I     ++    I SV A+
Sbjct:  114 DENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQ-ADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHL-ITVQATDADIGENSRISYDIKKTSAPS-NSNFAI-SQSGVITTTASLLPAS----THDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVES-NSAHLMENSTLGSIVARVSIAQ-------QYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLT--IGDINDNAPQWHSSQIHISLNRTQGGSRTLT---AKDPDLGQNGWIRYSVLDTELVS------IDKETGRIFVPNTIDCNIGSEI-KFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVAN-----NSQCGNSKRIRYSLQNQDE----HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSE-----TSTSLISIRLKDVNDNWPIF---YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE--SSSFSINPVTGEVFAQKPLA---RGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQ----FSRSKYEIRTTEDILPGIAIGSVGAM 766          

HSP 2 Score: 124.405 bits (311), Expect = 2.119e-28
Identity = 160/671 (23.85%), Postives = 285/671 (42.47%), Query Frame = 2
Query:  377 DLNDNAPHWPKPIELSISENAFIG---TLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN-------INKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D+NDNAP W    ++ IS N   G   TL    P  DL +    +          S  D   +  D E    ++ + ++ID      I+  +   D GSP L+ +  +   +LD     P F    + + + E+  + + L + V A +   GN  ++ Y  S+ N D    H  +++ +G + + K+ D++   + SY   V+A +    + +S++ + I + DVND  PI   N+    +T+ E     EP++ VS  D+D G  G+ +  ++              ++   + +A+ +F        +  ++  D G  S  +S  I + ++D +   P FS         E    G  +  V A+       S++ Y I    + +Q     + E  G + V ++LD  +   +   I      G    SNQ ++ I + D N+ PP F+ S    ++ ED   H P          +  SD DK  N ++  +I  +       I++F     G L + ++LD E    YKL + A D G P      T+     I + D+NDN+P F +++    +V      +  +  +   DKDS  N  +   I  G  + YF ID    +V   R +  E      + ++ +D+G PP+SS+   +I++ D
Sbjct:  433 DINDNAPQWHSS-QIHISLNRTQGGSRTLTAKDP--DLGQNGWIRY---------SVLDTELVSIDKETG--RIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCL-VKVVANNSQCGNSKRIRY--SLQNQD---EHLTVDTMSGTVCIQKTFDFE--KQKSYQTTVIATNAN--SETSTSLISIRLKDVNDNWPIFYPNE--YHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESS-SFSINPVTGEVFAQKPLARGRF--------HLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-------SKVKYSI---YSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE---SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFY-------VVQASDKDKKKNGEVRYSIISSHPGSSIEIDQF----TGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTL----FIHVLDVNDNAPEFEKSW-YTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG--SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLD 1037          

HSP 3 Score: 120.553 bits (301), Expect = 3.277e-27
Identity = 127/456 (27.85%), Postives = 202/456 (44.30%), Query Frame = 2
Query:  626 RIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLP-INVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG-HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTP 1984
            R  LV+   D G         I I ++D +   P FS  KY I   E+     +LP I + +V    G   K+ Y     + D    +F+I+   G+I + + LD D  + +  + +      G+   S+ T V+I I D ND  P  S   SL +I+I E+  L+EP   V   D D+  NG+    +I  H G  +   Q        QL      D E        +   D GIP  +S+  + + ++DVNDN P F     +  +LE+SP  T+V KV A DKD   N Q++Y I++    ++ F   + E  GN+   + +DR +   +  + +V  D G P  S+     I+++D+N+ PP    S    T    P+      P    IG I   D DKG+N  +    +   + F +  NG +     L+  ++   +L++I  D G P
Sbjct:  706 RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTED-----ILPGIAIGSV----GAMSKVKYSIYSGDQD---HNFSIDEDTGKIYVTRYLDADVHDTVLLN-IQATLPSGE---SNQTQVVIFIEDHNDNPPQFS--SSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQ-----FTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN---GSEYFG--IDEKLGNVYTKRSIDREVISHV-DISIVAEDKGVPPRSSTASARISVLDVNDNPP----SCLSITPIVVPAGS----PLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 4 Score: 75.0998 bits (183), Expect = 2.713e-13
Identity = 181/798 (22.68%), Postives = 312/798 (39.10%), Query Frame = 2
Query:  110 SVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTLE-YCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPK----------LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSST--TVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQ---GINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDRE--KEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLD---GEIFSVIVVVSDHGRPALS--NQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRN---FPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQS----------VKLNRKLKSEHQ-GIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVH 2389
            +++E  P   F+  L+  LA    S    N   + S F + S G+I    +LD +         LE Y +  +       I   +++ +N+LNDN P +P      + EN  +G+      A D+D     +                FL +D   Q P           + L + +D E      L I  TD      T    +TI + D+NDN PTFS   Y  ++             + A D D+   G L+Y      + S+   F +   +G +  +K L   +G    Y   V A D+G P+ S+S   +VII   +  D+       K+     + EN+ +   I ++S  +  +    I       +     F  LF   ++  I  +  A H+F  E   E      + C  +            VI++D NDNLP F+  A   S+ +    G  + ++ A D+D G N ++ Y I    + N +    L    G++ +N+  D  LD      + ++V   DHG PA +   ++++++ +   +   P F    +   V ED S    ++ K R    + +       N  L  ++K++  K  I    G L     LD E +    + L   DG      R  V   + I +  +++ +P+F ++     +P      E V  ++ A+   D+D G + VV  SI             DRQS          ++L + L S     I ++ V+          +++ ++I   D QP  PK ++H
Sbjct: 1840 TIDEGLPRGQFIAKLQPELAGLTYSIVEGN---IDSAFSVDSEGVIRTNLELDRE--------ILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRY---------------FLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLG-QGSSSI---FRVAPESGAL-FMKVLP-PAGER--YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKP---GFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLF---VAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCH------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI---LSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGT-VLQKIRASNRLGMR------NDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG----RSAVV-PLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESV-GQMQAI---DEDGGVHGVVKYSIS------------DRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKLLLH 2549          

HSP 5 Score: 72.7886 bits (177), Expect = 1.497e-12
Identity = 84/300 (28.00%), Postives = 137/300 (45.67%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTD--DEHQFP-KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING--------QFNCFLIGHKGFDLLFKQ-NLSD 1237
            D NDN P +    +E+SI E+  +   F +  A D D+ K  +           Y  ++  P    +  QF  +L   S +D E     +L +  TD G PP +    + I +LDVNDN P F    Y + + EN    +++   V A D DS   G++ Y+  ++N      +F I+   G +   +S+D +  + +  S  +VA D G P  SS+ +  I+++DVND  P      S+  I +   + L+  I  +   D D+G+NG        Q + F++   G   L +Q N SD
Sbjct:  829 DHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVR---------YSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVG-KVVARDKDSLENGQIVYR--ITNG---SEYFGIDEKLGNVYTKRSIDREVISHVDIS--IVAEDKGVPPRSSTASARISVLDVNDNPPSC---LSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASD 1108          

HSP 6 Score: 72.7886 bits (177), Expect = 1.497e-12
Identity = 171/771 (22.18%), Postives = 315/771 (40.86%), Query Frame = 2
Query:  134 NYFVTDLKNILAIPLNSSTRFNMLHVHSYFRL-SSSGIISVARQLDCDNDSNLCDKTLEYCMTKLFXXXXXXXXX-XXXXXXXDLNDNAPHW--PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENF--QLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG--------HKGFDLLFKQ-NLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMP--ATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLL--DGEIFSVIVVVSDHGRPALSNQIEITINLIDINNC-PPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKD-NINK-FQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY----KEYVRH--ELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNR----KLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI 2350
            N  + D K ILA  +   +RF        F + S++G ISV   L  D ++     + E+ +  +     +      + + + D NDN P      P EL I+E++ +G + +   A D+D  +  K     ++  S   DL  +P   +    +L    S       +I+L ++  D G P     G+   + L++++  P       +  L++ +   ++  LP               L+Y     N DS    F+++S  G IR   +L+ D      YS  V+    GQ      T V + + ++ND +P   ++K  +   + EN  +   +  V   D+D         FL+         H   D      +L+  + ++++ +H            TI   D    + T+   +T+ + D+NDN PTFS P   T+ S    SP G    K+ A D D      L Y +    ++     P     +G L +     ++L   GE + V V  +D+G P+ S  + +++ + +      P F ++ F F V E+    L        IG ++  +     + +    I+D   +K F I   G L     +DRE++  ++   + ID   ++     V     + + D NDN P+F       T V+Y    K+ + H  ++  +   D+DSG N  V   I  G      +++ D  S++LN     +L        +++V  +D G P +++  ++Q+++
Sbjct: 1644 NVGIEDFKRILATGMTEESRFRFQGNAPKFSINSTTGSISV---LPLDREA-----SQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDL--VPETGDLVLRRLSSLQSW------KIKLRVV--DHGVP-----GLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP-ELAGLTYSIVEGNIDSA---FSVDS-EGVIR--TNLELDREILERYSLKVIGTGSGQQI---GTRVDVRVNNLNDNVPSFPMSKPRR---VPENLRVGSYVATVGAKDVDN--LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTL----------TIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSP-GQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAP----ESGALFM-----KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGL-------QIGNLSGEE-----SREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQ-VEIDN--EMMTSQKVQCKCHVIVLDENDNLPVF-------TSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSL 2329          

HSP 7 Score: 66.2402 bits (160), Expect = 1.413e-10
Identity = 118/517 (22.82%), Postives = 219/517 (42.36%), Query Frame = 2
Query:  887 FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF-------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIG-----------YIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPL-PTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGI-----IAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQP 2365
            F+INST G I ++  LD ++  E  +  +++  D G  + + S TV + + D ND  P +  + +  ++ I E++ + + +      D+D G NG+F+  L+      L       DL++ +L +   +           +   D+G+P L   + + +     N N  T +     F       +I E  P G  + K++   +  GL   ++           +   F ++S G +  N  LDR +  E +S+ V+ +  G+  +  ++++ +N ++ +N P      +F  + P    ++L +      +G           Y  VSD               NI++F     G +   A LD E   E+ LT+ A DG+ D     T T ++ IF++D+NDN+P F +  PL  T VS   +   +  A  +E  D  A   +  S+  G      +AP        +S  L  K+       + + V   D G P  S+S+ + + I +++P
Sbjct: 1673 FSINSTTGSISVLP-LDREASQE--HLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDAS-TPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLSSLQSWK--------IKLRVVDHGVPGLYVEKNLEI----SNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP--ELAGLTYSIV--------EGNIDSAFSVDSEGVIRTNLELDREIL-ERYSLKVIGTGSGQ-QIGTRVDVRVNNLN-DNVP------SFPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHF------NIDQF----TGTIHLTAPLDFEVLPEHTLTIKATDGSFD-----TFT-NLTIFVSDINDNAPTFSK--PLYQTTVSPATFSPGQPFAK-IEAHDLDARGALTYSLGQGSSSIFRVAP--------ESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEP 2125          

HSP 8 Score: 55.8398 bits (133), Expect = 2.070e-7
Identity = 51/207 (24.64%), Postives = 92/207 (44.44%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKD------------EGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI----NKFQISHNGMLQSVAVL 1927
            I V + D NDN P+F+       I E + +GT        D D            +G N   ++ ++  +   Q+          +L+VN  LDR    + + +++   D G+PA   Q+  +I +ID N+  PVF++S +  +V  + S    L+        +  +D D G N++++  IK       + F IS +G++ + A L
Sbjct:  108 ILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQG-NVNNVFKLASRKVNEQL--------QADLVVNGQLDREFRDK-YELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLI-------TVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASL 297          

HSP 9 Score: 55.4546 bits (132), Expect = 2.252e-7
Identity = 87/340 (25.59%), Postives = 136/340 (40.00%), Query Frame = 2
Query: 1388 LPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLI--ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDK-GVNAQLTLAIKDNINK-FQISH---NGMLQSVAV----LDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
             PTF    T F++ E + IGT +  +    ++E    +      D +T+      FL   E +G +    HLD     +   V V V + G       I+I + + D N+  P F        + E             +     V+D D    +    + ++ N+N  F+++    N  LQ+  V    LDRE +++Y+L + A DG    +I        +I   D NDN+P+F R+      VS    +   LI +   D D G N+ +   IK    AP  S     QS  +           H +IV+  D G P  SSS  + IT+  S   SP
Sbjct:   19 FPTFCQCLTKFTVPESAQIGTRIGWISG-KREESAAPKYFVVFPDEQTSK-----FLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE-----TIDILVEVDDENDNAPSFADQVVKLEISE-------FAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEII---DANDNAPVFSRSR-YTASVSANISIGSHLITVQATDADIGENSRISYDIKK-TSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSP 335          

HSP 10 Score: 55.4546 bits (132), Expect = 2.471e-7
Identity = 93/452 (20.58%), Postives = 180/452 (39.82%), Query Frame = 2
Query:  449 TLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSS-------IDRETNDRIELVILLTDSGSPPLTGEGI-ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIR--LIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKG---FDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLP----TFSMPATSFSILEHSPIGTVV-----------TKVRALDKDEGLNSQ---------LIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITIN 1693
            T F +P +  +           +      YF     P +   +F K+  +S        +D E   + ++V +  +      +GE I I +++ D NDN P+F+     + + E  QL +   +  +  D D   F    +     N ++V +  A    N +++  L+ +   D      Y  ++ A D G+PA        I I+D ND  P+ S  +S    ++  N ++   ++ V   D D G N + +  +         +    Q+        L+     D          +   D+G PSL+SS ++T+ ++    + P     + + + S  ++E+S +G++V           TK+R +        Q         L+  I D  T ++    FL+E +G +++ +H   L  G+I       +D+     S+QI I++N
Sbjct:   27 TKFTVPESAQIGTRIGWISGKREESAAPKYF--VVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEE-----SGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALP-TVTDGDGPKFDVHRFVILQGNVNNVFK-LASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFS--RSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD--------VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIII-EHPQLLTIGDI-------NDNAPQWHSSQIHISLN 451          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 126.716 bits (317), Expect = 4.150e-29
Identity = 150/534 (28.09%), Postives = 228/534 (42.70%), Query Frame = 2
Query:  593 LKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIIS-LRENFQLNSLLPINVSAVDCDSG-NFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNEL-SYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPI-------VDVSVHDLD----QGINGQF----NCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDRE--KEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKD-EGLNSQLIYHISDPR-----TTNQMFPPFLIESNGNLLVNQHLDR--LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSP---------IFHRNFPL 2080
            +K  +D E +D+  LV++ +D      T    + I I DVNDN P F   KY  + + E+  +  +L  NV A D D      ++ Y+      D V   F I   +G I L+K+LD D    + S++FVV A D     L     V +N+ D+ND  PI       +     E N   EPI       +DV   D D    +  N ++    N  + G   F +   QN       ++ A    DRE   E      +   D G+PS      +T+ + D+NDN P F       S+ E +PIG  V    A D D E  ++   Y +S+       TT++        S G L V Q LD   +   + F + + VSD    A   +  + + L+D N+  P  + +T H  V ED       VP+  +IG    +D D G  A+  +  + D   +F I  +G L+    LDRE+   Y L + A D + ++  +      V ++L D+NDN P         IF  N P+
Sbjct: 1393 VKEPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVL-FNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE----RLFGYIEENR--EPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRI--DQNTG-----KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQ---SSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDA---EAAVHVALVDRNDHAPHIHGATEH-RVRED-------VPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM-----VAVYLQDVNDNGPEPYTVPRPCIFRENTPV 1887          

HSP 2 Score: 107.457 bits (267), Expect = 3.185e-23
Identity = 147/600 (24.50%), Postives = 244/600 (40.67%), Query Frame = 2
Query:  608 DRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRH------FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQP-ALSSSTTVIINIVDVNDELPIISLNKSLK-DITIFENNNLNEPIV-------------DVSVHDLDQGING--------QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILE--------HSPIGTVVTKVRALDKD-EGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPAL-------SNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL--AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKD--------------SGANAVVDLSIKPGIIAPYFSIDRD 2224
            DRET  R ++ +  TD G  PL G    +++++D+NDN P F    Y  S+   F+      I V A D D+ +  +++Y   +  T   +          +N  +GEI LIK +   +     + F V+A D+G P AL SS  V +N++D   + P    +   K  IT+ EN  LN+ I+             DV       G  G        QFN F  G++  +++  + L     Y+ +  +            T+T  D     + S++   V + DVND +P F++   + +I E            G  +  V+A+D D +G  +++ Y I       +     + E  G +  N+  DR    +++ + V  SD    AL        + +++ I + D+N+  P F +  +   V E   +   ++        I   D DK  N +  L  A    I     + +G +     LD E  ++Y L LIA DG      RH  T +V I + D+NDN+P F +     T +     +   L  +   D D               GA+ V  +    G I    ++DRD
Sbjct:  938 DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-SRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLD----YEQVNNYTL----------TLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDR-EKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVIT-------IKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG------RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRD 1504          

HSP 3 Score: 100.523 bits (249), Expect = 4.741e-21
Identity = 112/380 (29.47%), Postives = 172/380 (45.26%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNE--LSYSFVVVAHDHGQP-ALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAK--HKFDREKEAFAYTTI----------TCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGT------VVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE-SNGNLLVNQHLDRLLDGEIF---SVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTV 1753
            +TI+I DVNDN PTF+   Y   +RE+  LN  + + V+AVD D+G+  +++Y  SV N      +F+INS NGEI     LD D  NE    Y F V A DHG+P +LSSS  + I   + NDE  +  L  S     + E+     P++ +   D D+    +     +   G     K NL  +  +  + K  H       A A   I          +CC Y   + TS   + + I DVN+N P F   A  +S +     GT       + KV A D D   N  ++Y +    T ++    F+I+   G L  + H+  + D E      V V  +D G   L    + ++ ++DIN+  P F + ++  +V
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTI-LKVTAVDKDTGDNSRITY--SVDN-----HNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF-LPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQ-KMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCA-KYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY--YTQSESRKAFVIDRQTGVLTPSPHV--VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV 988          

HSP 4 Score: 94.3597 bits (233), Expect = 3.169e-19
Identity = 172/740 (23.24%), Postives = 300/740 (40.54%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELV-------------ILLTDSGSP-PLTGEGIITIQILDVNDNYPTFSTH---KYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNG--------EIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNE--------PIVDVSVHDLDQ-GINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQ-------LITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQ---LTLAIKDNINKFQIS-HNGMLQSVAVLDREEKE---EYKLTLIAID-------GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKV-SYKEYVRHELIA-----LFVEDKDSGANAVVDLSIKPGII-------APYFSIDRDRQSV----KLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            D+NDN+P + +P  E S+S    +GT      A D D     +            + L    T  E     L     ++R + + I L+             ++  D+G P  L     +T+ +LD     P + T    K  I++ EN +LN ++ +   AV         + YK + S     K        N         E+ +++ LDY+  N  +Y+  + A D     ++S+ T ++ + DVND +P  +++  L   TI E    NE        PIV V   D D  G   + +  ++G    +   K    D +  ++    KFDREK      T+   D  + +L  +         + ++I DVNDN P+F        + E    G  V  ++A D D+  +S L YH+           PF + ++ G + V + LD     + + ++++ SD    A +N   + I++ D+N+  P F Q  +  TV E+  D       P+ +  +  +D D+   +      L  +     F+I  ++G ++ V  LDR+       +   + AID       G  DVQ+           + D+NDNSPIF      P ++  Y E  R  + +     + V+ +D       + +I+ GI+          F ID++   +     L+R++ SE + I  + V   DRG P +     + I + D    +P
Sbjct:  971 DINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEIT----------YSLEIDTTAGEEHQNDLDFFELVNRRSGE-ITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVI-LRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVN--NYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVD--LFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEET-KHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLI---GAGGGRIPFGVRTDSGTIFVKEPLD-FEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIEEDVD------IPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVN----------VRDINDNSPIF------PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFI--IEVRANDRGVPSREGFANVTIKVTDMNDNAP 1659          

HSP 5 Score: 77.7962 bits (190), Expect = 3.936e-14
Identity = 139/626 (22.20%), Postives = 249/626 (39.78%), Query Frame = 2
Query:  614 ETNDRIELVILLTDSGS----PPLTGEGIIT--IQILDVNDNYPTF---STHKYIISLREN-FQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFD--------REKEAFAYTTITCCDYGIP-SLTSSQLITVIIVDVNDNLPTFSMP---ATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDP----RTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPED--PSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDGT----PDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT-IDDSQP 2365
            E  + I L +++ D GS    P  T     T  I I DVN+N P F   + +  I  + E  ++ +    + V A D DS   G + Y    + ++S ++ F I+   G +     + +D          V A D G   L       + +VD+ND  P          ++ FE   +   ++ V   D D   N +    L   +      +++ +DL  ++L+ +   +         + + F +  I   D GIP +L SS  +T+ ++D     P +          ++ E+  +  V+ + RA+   +  NS +IY ++            F  F    NGN  V   +   LD E    +++ +  +D      S +    + + D+N+  P F    F  T+ E+  P++HL        +   A+     G   ++   I    N  +  H       G +      DRE+ + Y LT+ A D +    P     +     V I +ND+NDN+P F     +  +V   E   H++I +   D D  +N    L    G   P F +  D  ++ +   L  E    + L++I  D GR   ++++ I I  ++D+ P
Sbjct:  820 EAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES-RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE--AVGTSVITVFAFDNDAAHNAEITYSL---EIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI-ADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKT-FVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYI-GRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIP-FGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVNDNAP 1434          

HSP 6 Score: 70.8626 bits (172), Expect = 5.772e-12
Identity = 76/256 (29.69%), Postives = 116/256 (45.31%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGE---IFSVIVVVSDHGRP-ALSNQIEITINLIDINNCPPVF-NQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKD-------NINKFQI-SHNGMLQ---SVAVLDREEKEE-YKLTLIAI-DGTPDV--QIRHTVTGSVVIFLNDLNDNSPIF 2062
            +T+ I DVNDN+PTF+ P  +  + E  P+   + KV A+DKD G NS++ Y + +          F I SNG +     LD     E   ++   V   DHG P +LS+   I I   + N+   VF   S +   V ED     P++        I   D D+    ++T +  D        +N F I  H G+++    V+  D  E E    LT+I   DG+  V     HT   +++I + D+N+N P F
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN--------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVI-------QIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF 865          

HSP 7 Score: 58.5362 bits (140), Expect = 2.857e-8
Identity = 123/558 (22.04%), Postives = 213/558 (38.17%), Query Frame = 2
Query:  377 DLNDNAPHWPKPIELSISENA----FIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILL--TDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKL---------SYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYD-----SGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPT-FSMPATSFSILEHSPIGTVVT-KVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE---------------------SNGNLLVN--QHLDRL--LDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGML 1909
            D+NDN+P +P+ +   I EN       G  F    A D D              ++   +   +   D++      ++ S+DRE +   E +I +   D G P   G   +TI++ D+NDN P F   +Y  S+ E   + + + ++ SA D D      +          Y +  ++ DS +      S+ G +R+ + LDY+      G  L        HD       +   V + +VD ND  P I       +  + E+      I   +  D D G   +F               Q+ +      L   H  DRE  A     I    Y   +    Q++ V + DVNDN P  +++P       E++P+  + T ++RA D+D                T +  PPF +E                      NG++ +   Q  DR   + G+I  + ++++D  R    N+  + + + D+N+      + T H       + +L  + K   IG + V D D       T + KD+   F++S  G +
Sbjct: 1538 DINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMR-SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAV-MSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQ------SSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD-------AEAAVHVALVDRNDHAPHI---HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGT------LRVAHTLDREDIAVYNLIIEA--YDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCI-FRENTPVNQLGTCEIRATDRD----------------TAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILAD--RAGRRNEASVHVIIGDLNDNTMHDGRMTIHV------NSYLGRL-KETVIGRVYVDDADDWDLGDKTFSWKDSRPGFELSDKGSI 2043          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 126.716 bits (317), Expect = 4.150e-29
Identity = 150/534 (28.09%), Postives = 228/534 (42.70%), Query Frame = 2
Query:  593 LKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIIS-LRENFQLNSLLPINVSAVDCDSG-NFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNEL-SYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPI-------VDVSVHDLD----QGINGQF----NCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDRE--KEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKD-EGLNSQLIYHISDPR-----TTNQMFPPFLIESNGNLLVNQHLDR--LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSP---------IFHRNFPL 2080
            +K  +D E +D+  LV++ +D      T    + I I DVNDN P F   KY  + + E+  +  +L  NV A D D      ++ Y+      D V   F I   +G I L+K+LD D    + S++FVV A D     L     V +N+ D+ND  PI       +     E N   EPI       +DV   D D    +  N ++    N  + G   F +   QN       ++ A    DRE   E      +   D G+PS      +T+ + D+NDN P F       S+ E +PIG  V    A D D E  ++   Y +S+       TT++        S G L V Q LD   +   + F + + VSD    A   +  + + L+D N+  P  + +T H  V ED       VP+  +IG    +D D G  A+  +  + D   +F I  +G L+    LDRE+   Y L + A D + ++  +      V ++L D+NDN P         IF  N P+
Sbjct: 1393 VKEPLDFEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVL-FNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE----RLFGYIEENR--EPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRI--DQNTG-----KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQ---SSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDA---EAAVHVALVDRNDHAPHIHGATEH-RVRED-------VPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM-----VAVYLQDVNDNGPEPYTVPRPCIFRENTPV 1887          

HSP 2 Score: 107.457 bits (267), Expect = 3.185e-23
Identity = 147/600 (24.50%), Postives = 244/600 (40.67%), Query Frame = 2
Query:  608 DRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRH------FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQP-ALSSSTTVIINIVDVNDELPIISLNKSLK-DITIFENNNLNEPIV-------------DVSVHDLDQGING--------QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILE--------HSPIGTVVTKVRALDKD-EGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPAL-------SNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL--AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKD--------------SGANAVVDLSIKPGIIAPYFSIDRD 2224
            DRET  R ++ +  TD G  PL G    +++++D+NDN P F    Y  S+   F+      I V A D D+ +  +++Y   +  T   +          +N  +GEI LIK +   +     + F V+A D+G P AL SS  V +N++D   + P    +   K  IT+ EN  LN+ I+             DV       G  G        QFN F  G++  +++  + L     Y+ +  +            T+T  D     + S++   V + DVND +P F++   + +I E            G  +  V+A+D D +G  +++ Y I       +     + E  G +  N+  DR    +++ + V  SD    AL        + +++ I + D+N+  P F +  +   V E   +   ++        I   D DK  N +  L  A    I     + +G +     LD E  ++Y L LIA DG      RH  T +V I + D+NDN+P F +     T +     +   L  +   D D               GA+ V  +    G I    ++DRD
Sbjct:  938 DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-SRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLD----YEQVNNYTL----------TLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDR-EKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVIT-------IKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG------RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRD 1504          

HSP 3 Score: 100.523 bits (249), Expect = 4.741e-21
Identity = 112/380 (29.47%), Postives = 172/380 (45.26%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNE--LSYSFVVVAHDHGQP-ALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAK--HKFDREKEAFAYTTI----------TCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGT------VVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE-SNGNLLVNQHLDRLLDGEIF---SVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTV 1753
            +TI+I DVNDN PTF+   Y   +RE+  LN  + + V+AVD D+G+  +++Y  SV N      +F+INS NGEI     LD D  NE    Y F V A DHG+P +LSSS  + I   + NDE  +  L  S     + E+     P++ +   D D+    +     +   G     K NL  +  +  + K  H       A A   I          +CC Y   + TS   + + I DVN+N P F   A  +S +     GT       + KV A D D   N  ++Y +    T ++    F+I+   G L  + H+  + D E      V V  +D G   L    + ++ ++DIN+  P F + ++  +V
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTI-LKVTAVDKDTGDNSRITY--SVDN-----HNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF-LPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQ-KMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCA-KYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY--YTQSESRKAFVIDRQTGVLTPSPHV--VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV 988          

HSP 4 Score: 94.3597 bits (233), Expect = 3.169e-19
Identity = 172/740 (23.24%), Postives = 300/740 (40.54%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELV-------------ILLTDSGSP-PLTGEGIITIQILDVNDNYPTFSTH---KYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNG--------EIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNE--------PIVDVSVHDLDQ-GINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQ-------LITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQ---LTLAIKDNINKFQIS-HNGMLQSVAVLDREEKE---EYKLTLIAID-------GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKV-SYKEYVRHELIA-----LFVEDKDSGANAVVDLSIKPGII-------APYFSIDRDRQSV----KLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            D+NDN+P + +P  E S+S    +GT      A D D     +            + L    T  E     L     ++R + + I L+             ++  D+G P  L     +T+ +LD     P + T    K  I++ EN +LN ++ +   AV         + YK + S     K        N         E+ +++ LDY+  N  +Y+  + A D     ++S+ T ++ + DVND +P  +++  L   TI E    NE        PIV V   D D  G   + +  ++G    +   K    D +  ++    KFDREK      T+   D  + +L  +         + ++I DVNDN P+F        + E    G  V  ++A D D+  +S L YH+           PF + ++ G + V + LD     + + ++++ SD    A +N   + I++ D+N+  P F Q  +  TV E+  D       P+ +  +  +D D+   +      L  +     F+I  ++G ++ V  LDR+       +   + AID       G  DVQ+           + D+NDNSPIF      P ++  Y E  R  + +     + V+ +D       + +I+ GI+          F ID++   +     L+R++ SE + I  + V   DRG P +     + I + D    +P
Sbjct:  971 DINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEIT----------YSLEIDTTAGEEHQNDLDFFELVNRRSGE-ITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVI-LRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVN--NYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVD--LFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEET-KHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLI---GAGGGRIPFGVRTDSGTIFVKEPLD-FEASDQYHLVLIASDGRHNATTN---VYIHIEDVNDNAPQFEQQKYATTVIEEDVD------IPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVN----------VRDINDNSPIF------PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFI--IEVRANDRGVPSREGFANVTIKVTDMNDNAP 1659          

HSP 5 Score: 77.7962 bits (190), Expect = 3.936e-14
Identity = 139/626 (22.20%), Postives = 249/626 (39.78%), Query Frame = 2
Query:  614 ETNDRIELVILLTDSGS----PPLTGEGIIT--IQILDVNDNYPTF---STHKYIISLREN-FQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFD--------REKEAFAYTTITCCDYGIP-SLTSSQLITVIIVDVNDNLPTFSMP---ATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDP----RTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPED--PSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDGT----PDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT-IDDSQP 2365
            E  + I L +++ D GS    P  T     T  I I DVN+N P F   + +  I  + E  ++ +    + V A D DS   G + Y    + ++S ++ F I+   G +     + +D          V A D G   L       + +VD+ND  P          ++ FE   +   ++ V   D D   N +    L   +      +++ +DL  ++L+ +   +         + + F +  I   D GIP +L SS  +T+ ++D     P +          ++ E+  +  V+ + RA+   +  NS +IY ++            F  F    NGN  V   +   LD E    +++ +  +D      S +    + + D+N+  P F    F  T+ E+  P++HL        +   A+     G   ++   I    N  +  H       G +      DRE+ + Y LT+ A D +    P     +     V I +ND+NDN+P F     +  +V   E   H++I +   D D  +N    L    G   P F +  D  ++ +   L  E    + L++I  D GR   ++++ I I  ++D+ P
Sbjct:  820 EAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES-RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE--AVGTSVITVFAFDNDAAHNAEITYSL---EIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI-ADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKT-FVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYI-GRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIP-FGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVNDNAP 1434          

HSP 6 Score: 70.8626 bits (172), Expect = 5.772e-12
Identity = 76/256 (29.69%), Postives = 116/256 (45.31%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGE---IFSVIVVVSDHGRP-ALSNQIEITINLIDINNCPPVF-NQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKD-------NINKFQI-SHNGMLQ---SVAVLDREEKEE-YKLTLIAI-DGTPDV--QIRHTVTGSVVIFLNDLNDNSPIF 2062
            +T+ I DVNDN+PTF+ P  +  + E  P+   + KV A+DKD G NS++ Y + +          F I SNG +     LD     E   ++   V   DHG P +LS+   I I   + N+   VF   S +   V ED     P++        I   D D+    ++T +  D        +N F I  H G+++    V+  D  E E    LT+I   DG+  V     HT   +++I + D+N+N P F
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN--------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVI-------QIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF 865          

HSP 7 Score: 58.5362 bits (140), Expect = 2.857e-8
Identity = 123/558 (22.04%), Postives = 213/558 (38.17%), Query Frame = 2
Query:  377 DLNDNAPHWPKPIELSISENA----FIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILL--TDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKL---------SYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYD-----SGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPT-FSMPATSFSILEHSPIGTVVT-KVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE---------------------SNGNLLVN--QHLDRL--LDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGML 1909
            D+NDN+P +P+ +   I EN       G  F    A D D              ++   +   +   D++      ++ S+DRE +   E +I +   D G P   G   +TI++ D+NDN P F   +Y  S+ E   + + + ++ SA D D      +          Y +  ++ DS +      S+ G +R+ + LDY+      G  L        HD       +   V + +VD ND  P I       +  + E+      I   +  D D G   +F               Q+ +      L   H  DRE  A     I    Y   +    Q++ V + DVNDN P  +++P       E++P+  + T ++RA D+D                T +  PPF +E                      NG++ +   Q  DR   + G+I  + ++++D  R    N+  + + + D+N+      + T H       + +L  + K   IG + V D D       T + KD+   F++S  G +
Sbjct: 1538 DINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMR-SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAV-MSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQ------SSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD-------AEAAVHVALVDRNDHAPHI---HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGT------LRVAHTLDREDIAVYNLIIEA--YDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCI-FRENTPVNQLGTCEIRATDRD----------------TAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILAD--RAGRRNEASVHVIIGDLNDNTMHDGRMTIHV------NSYLGRL-KETVIGRVYVDDADDWDLGDKTFSWKDSRPGFELSDKGSI 2043          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 216.083 bits (549), Expect = 7.677e-57
Identity = 202/693 (29.15%), Postives = 317/693 (45.74%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKL-------KLKSSIDRETNDRIELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSL--LPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK--GFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVN--QHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINK------FQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPL-PTKVSYKEYVRHELIALFVEDKDSGANAVV-----DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D ND++P +  +  E SI E A +G+      A D D      +         +  D A L  D E    ++         +SS+DRET+D   L++   D   + S   T    + +++LD NDNYP FS   Y + + E+    +      ++ A D D GN   + Y     NT S    F+I+S +G++ L+K LDY+S    SY  V+ A D G P+ S++T +++N++D ND  P    ++  +  ++ EN  +   I+ V  +D D+G N +   + I  +   F L       D     +      DRE++      +   D G+P  ++S  + + + DVNDN P F+      ++ E  P GT VT V A D DE  +S+L Y I    TT      F I S NG  L+   Q LD   +      +      GR   S+   + IN+ D NN  P+F  + +  +V ED        P    +  ++ +D D GVNAQ+T ++ +++IN       F I+   G + + A LDRE    Y LT+ A DG  P +    + T  V I + D+NDN+P F    PL    +     V   +I +   D D G N  +     D  I+ G     F ID    +++ N+ L  E   +  L  I  D+G PP SS++E+QI ++D
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD----IGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVR--SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDNFPLAV-----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSASVFED-------APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL----SDTTDVEIGVTDVNDNAPAFKS--PLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDG----SFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 179.104 bits (453), Expect = 3.491e-45
Identity = 173/580 (29.83%), Postives = 259/580 (44.66%), Query Frame = 2
Query:  377 DLNDNAPH-WPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGE--IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFL----IGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-----SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF 2074
            D NDNAP  +    + S+ EN  +G       A D D     +      ++  + F LA  P     Q  K      +DRE   R    ++  D G PP +    + I + DVNDN P F+   Y  ++ E+ Q        V+A D D  +  +L Y+ +  NT   +  FAI S NG   I + +SLDY    E  +   V A D G    S + TV INI D N+  PI     +    ++FE+  +   ++ VS  D D G+N Q    L    I   G    F  N     I   +     DRE  +    T+T  D G PSL+ +  + + + DVNDN P F  P    SILE + +GT V +V A D D GLN ++ Y +SD    +  F   +  ++G +  N+ LDR     +F +  +  D G P LS+ +E+ I L D+N+ PP F        VPE+        P    +G I   D D+GVNA +  +I   D+ N F +     S    L ++  LD E   + +  L+    +P ++        + I + D+NDN+P+  R+F
Sbjct:  681 DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIK-----PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPDEDS--RLHYEITTGNT---RGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPI--FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI---VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDR-ESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-------SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLR----NDAHIEILVTDVNDNAPVL-RDF 1223          

HSP 3 Score: 171.014 bits (432), Expect = 1.330e-42
Identity = 158/550 (28.73%), Postives = 253/550 (46.00%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP-PFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI---NKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSI 2215
            + L   +D E+     LVI   D GSP  +    + + ++D NDN P F T ++  S+ EN  +   + I V A D D G   +++Y  S+S  D      A++   G ++ IK LD +   +  ++F VVA D G P  S+S++V+I + DVND  P  + N    +  + E+     P+  V+  D D+     +       +G   +  QN   LI          D ++E     T+   D G  S T++  + + I D N+  P F     S S+ E +P+GT V  V A D D G+N+Q+ Y +++        P PF I    G ++ N  LDR      + + V   D G P+LS+  ++ I + D+N+  P F    +  ++ ED      LV    ++  +A SD D G+N ++   + D       F I   +G +++   LDRE    + LT IA+D G+P +    + T  V I L D+ND+ P F  +  +   V     V   +  +   D D G NAVV  SI  G  +  FS+
Sbjct:  641 VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITY--SISERDD-NFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITI----AQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA-----LVGT--SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 4 Score: 164.081 bits (414), Expect = 1.824e-40
Identity = 160/609 (26.27%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRH-----FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPA---LSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN---NNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLS-DLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN---GMLQSVAVLDREEKEEYKLTLIAID--GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP----GIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +S+DRE  D     ++ TD   PP +G   + + +LD ND+ PTF   ++  S+RE   + S + I + A D D G   ++ Y   +V++   + +      F I+S +G I    SLD ++ +  SY  +V A D         +++ +V + ++D ND  P  S  +    + + E+      +  +  +   D DQG N      +IG          ++S D+ + + +     D E        I   D G PS +++  + V ++D NDN P F       S+LE+ P+G  + +V+A D DEG N+++ Y IS+ R  N  FP  +    G +   + LDR   G  F+  VV  D G P  S    + I + D+N+  P FN   +   V ED     P+         +  +D D+       +   +   +F I+     G++     LD ++++ + LT+ A D  G  D       T +V I + D N+ +PIF  N P    V     V   ++ +   D D G NA +  S+      G+ +P  FSI+    ++  N  L  E    + L V  KD G P  S + +++I + D
Sbjct:  420 ASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDN--FPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTT-------VTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD-------TATVHINITDANNFAPIFE-NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD 999          

HSP 5 Score: 93.9745 bits (232), Expect = 6.656e-19
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1373 DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-----------DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMV-HFNES 2401
            ++ +  P F       S+LE  P G  VT VRA D ++      +  + D R+ +     F ++S  G +  +  LDR L+D   F V  V +D   P  S    + +N++D N+  P F    F  ++ E  +    ++        +  +D D G NA++   I+             +  F+I S +G++ + + LDRE  + Y L + A D       R T T SV + + D NDN P F  R + +              +A +   D D G NA +  +I  G     FSID     V L + L  E    ++L++  +D G P +S++ ++ + + D+   +P+     F ES
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSL----FKVDSRTGVVTTSASLDRELMDVHYFRV--VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES 697          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 215.698 bits (548), Expect = 8.907e-57
Identity = 202/693 (29.15%), Postives = 317/693 (45.74%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKL-------KLKSSIDRETNDRIELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSL--LPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK--GFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVN--QHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINK------FQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPL-PTKVSYKEYVRHELIALFVEDKDSGANAVV-----DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D ND++P +  +  E SI E A +G+      A D D      +         +  D A L  D E    ++         +SS+DRET+D   L++   D   + S   T    + +++LD NDNYP FS   Y + + E+    +      ++ A D D GN   + Y     NT S    F+I+S +G++ L+K LDY+S    SY  V+ A D G P+ S++T +++N++D ND  P    ++  +  ++ EN  +   I+ V  +D D+G N +   + I  +   F L       D     +      DRE++      +   D G+P  ++S  + + + DVNDN P F+      ++ E  P GT VT V A D DE  +S+L Y I    TT      F I S NG  L+   Q LD   +      +      GR   S+   + IN+ D NN  P+F  + +  +V ED        P    +  ++ +D D GVNAQ+T ++ +++IN       F I+   G + + A LDRE    Y LT+ A DG  P +    + T  V I + D+NDN+P F    PL    +     V   +I +   D D G N  +     D  I+ G     F ID    +++ N+ L  E   +  L  I  D+G PP SS++E+QI ++D
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD----IGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVR--SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDNFPLAV-----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSASVFED-------APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL----SDTTDVEIGVTDVNDNAPAFKS--PLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDG----SFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 178.718 bits (452), Expect = 4.639e-45
Identity = 173/580 (29.83%), Postives = 259/580 (44.66%), Query Frame = 2
Query:  377 DLNDNAPH-WPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGE--IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFL----IGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-----SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF 2074
            D NDNAP  +    + S+ EN  +G       A D D     +      ++  + F LA  P     Q  K      +DRE   R    ++  D G PP +    + I + DVNDN P F+   Y  ++ E+ Q        V+A D D  +  +L Y+ +  NT   +  FAI S NG   I + +SLDY    E  +   V A D G    S + TV INI D N+  PI     +    ++FE+  +   ++ VS  D D G+N Q    L    I   G    F  N     I   +     DRE  +    T+T  D G PSL+ +  + + + DVNDN P F  P    SILE + +GT V +V A D D GLN ++ Y +SD    +  F   +  ++G +  N+ LDR     +F +  +  D G P LS+ +E+ I L D+N+ PP F        VPE+        P    +G I   D D+GVNA +  +I   D+ N F +     S    L ++  LD E   + +  L+    +P ++        + I + D+NDN+P+  R+F
Sbjct:  681 DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIK-----PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPDEDS--RLHYEITTGNT---RGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPI--FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI---VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDR-ESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-------SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLR----NDAHIEILVTDVNDNAPVL-RDF 1223          

HSP 3 Score: 170.629 bits (431), Expect = 1.720e-42
Identity = 158/550 (28.73%), Postives = 253/550 (46.00%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP-PFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI---NKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSI 2215
            + L   +D E+     LVI   D GSP  +    + + ++D NDN P F T ++  S+ EN  +   + I V A D D G   +++Y  S+S  D      A++   G ++ IK LD +   +  ++F VVA D G P  S+S++V+I + DVND  P  + N    +  + E+     P+  V+  D D+     +       +G   +  QN   LI          D ++E     T+   D G  S T++  + + I D N+  P F     S S+ E +P+GT V  V A D D G+N+Q+ Y +++        P PF I    G ++ N  LDR      + + V   D G P+LS+  ++ I + D+N+  P F    +  ++ ED      LV    ++  +A SD D G+N ++   + D       F I   +G +++   LDRE    + LT IA+D G+P +    + T  V I L D+ND+ P F  +  +   V     V   +  +   D D G NAVV  SI  G  +  FS+
Sbjct:  641 VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITY--SISERDD-NFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITI----AQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA-----LVGT--SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 4 Score: 163.696 bits (413), Expect = 2.440e-40
Identity = 160/609 (26.27%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRH-----FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPA---LSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN---NNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLS-DLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN---GMLQSVAVLDREEKEEYKLTLIAID--GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP----GIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +S+DRE  D     ++ TD   PP +G   + + +LD ND+ PTF   ++  S+RE   + S + I + A D D G   ++ Y   +V++   + +      F I+S +G I    SLD ++ +  SY  +V A D         +++ +V + ++D ND  P  S  +    + + E+      +  +  +   D DQG N      +IG          ++S D+ + + +     D E        I   D G PS +++  + V ++D NDN P F       S+LE+ P+G  + +V+A D DEG N+++ Y IS+ R  N  FP  +    G +   + LDR   G  F+  VV  D G P  S    + I + D+N+  P FN   +   V ED     P+         +  +D D+       +   +   +F I+     G++     LD ++++ + LT+ A D  G  D       T +V I + D N+ +PIF  N P    V     V   ++ +   D D G NA +  S+      G+ +P  FSI+    ++  N  L  E    + L V  KD G P  S + +++I + D
Sbjct:  420 ASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDN--FPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-------TVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD-------TATVHINITDANNFAPIFE-NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD 999          

HSP 5 Score: 93.5893 bits (231), Expect = 7.877e-19
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1373 DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-----------DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMV-HFNES 2401
            ++ +  P F       S+LE  P G  VT VRA D ++      +  + D R+ +     F ++S  G +  +  LDR L+D   F V  V +D   P  S    + +N++D N+  P F    F  ++ E  +    ++        +  +D D G NA++   I+             +  F+I S +G++ + + LDRE  + Y L + A D       R T T SV + + D NDN P F  R + +              +A +   D D G NA +  +I  G     FSID     V L + L  E    ++L++  +D G P +S++ ++ + + D+   +P+     F ES
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSL----FKVDSRTGVVTTSASLDRELMDVHYFRV--VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES 697          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 215.698 bits (548), Expect = 8.907e-57
Identity = 202/693 (29.15%), Postives = 317/693 (45.74%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKL-------KLKSSIDRETNDRIELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSL--LPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK--GFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVN--QHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINK------FQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPL-PTKVSYKEYVRHELIALFVEDKDSGANAVV-----DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D ND++P +  +  E SI E A +G+      A D D      +         +  D A L  D E    ++         +SS+DRET+D   L++   D   + S   T    + +++LD NDNYP FS   Y + + E+    +      ++ A D D GN   + Y     NT S    F+I+S +G++ L+K LDY+S    SY  V+ A D G P+ S++T +++N++D ND  P    ++  +  ++ EN  +   I+ V  +D D+G N +   + I  +   F L       D     +      DRE++      +   D G+P  ++S  + + + DVNDN P F+      ++ E  P GT VT V A D DE  +S+L Y I    TT      F I S NG  L+   Q LD   +      +      GR   S+   + IN+ D NN  P+F  + +  +V ED        P    +  ++ +D D GVNAQ+T ++ +++IN       F I+   G + + A LDRE    Y LT+ A DG  P +    + T  V I + D+NDN+P F    PL    +     V   +I +   D D G N  +     D  I+ G     F ID    +++ N+ L  E   +  L  I  D+G PP SS++E+QI ++D
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD----IGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVR--SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDNFPLAV-----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSASVFED-------APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL----SDTTDVEIGVTDVNDNAPAFKS--PLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDG----SFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 178.718 bits (452), Expect = 4.639e-45
Identity = 173/580 (29.83%), Postives = 259/580 (44.66%), Query Frame = 2
Query:  377 DLNDNAPH-WPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGE--IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFL----IGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-----SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF 2074
            D NDNAP  +    + S+ EN  +G       A D D     +      ++  + F LA  P     Q  K      +DRE   R    ++  D G PP +    + I + DVNDN P F+   Y  ++ E+ Q        V+A D D  +  +L Y+ +  NT   +  FAI S NG   I + +SLDY    E  +   V A D G    S + TV INI D N+  PI     +    ++FE+  +   ++ VS  D D G+N Q    L    I   G    F  N     I   +     DRE  +    T+T  D G PSL+ +  + + + DVNDN P F  P    SILE + +GT V +V A D D GLN ++ Y +SD    +  F   +  ++G +  N+ LDR     +F +  +  D G P LS+ +E+ I L D+N+ PP F        VPE+        P    +G I   D D+GVNA +  +I   D+ N F +     S    L ++  LD E   + +  L+    +P ++        + I + D+NDN+P+  R+F
Sbjct:  681 DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIK-----PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPDEDS--RLHYEITTGNT---RGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPI--FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI---VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDR-ESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-------SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLR----NDAHIEILVTDVNDNAPVL-RDF 1223          

HSP 3 Score: 170.629 bits (431), Expect = 1.720e-42
Identity = 158/550 (28.73%), Postives = 253/550 (46.00%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP-PFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI---NKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSI 2215
            + L   +D E+     LVI   D GSP  +    + + ++D NDN P F T ++  S+ EN  +   + I V A D D G   +++Y  S+S  D      A++   G ++ IK LD +   +  ++F VVA D G P  S+S++V+I + DVND  P  + N    +  + E+     P+  V+  D D+     +       +G   +  QN   LI          D ++E     T+   D G  S T++  + + I D N+  P F     S S+ E +P+GT V  V A D D G+N+Q+ Y +++        P PF I    G ++ N  LDR      + + V   D G P+LS+  ++ I + D+N+  P F    +  ++ ED      LV    ++  +A SD D G+N ++   + D       F I   +G +++   LDRE    + LT IA+D G+P +    + T  V I L D+ND+ P F  +  +   V     V   +  +   D D G NAVV  SI  G  +  FS+
Sbjct:  641 VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITY--SISERDD-NFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITI----AQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA-----LVGT--SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 4 Score: 163.696 bits (413), Expect = 2.440e-40
Identity = 160/609 (26.27%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRH-----FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPA---LSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN---NNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLS-DLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN---GMLQSVAVLDREEKEEYKLTLIAID--GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP----GIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +S+DRE  D     ++ TD   PP +G   + + +LD ND+ PTF   ++  S+RE   + S + I + A D D G   ++ Y   +V++   + +      F I+S +G I    SLD ++ +  SY  +V A D         +++ +V + ++D ND  P  S  +    + + E+      +  +  +   D DQG N      +IG          ++S D+ + + +     D E        I   D G PS +++  + V ++D NDN P F       S+LE+ P+G  + +V+A D DEG N+++ Y IS+ R  N  FP  +    G +   + LDR   G  F+  VV  D G P  S    + I + D+N+  P FN   +   V ED     P+         +  +D D+       +   +   +F I+     G++     LD ++++ + LT+ A D  G  D       T +V I + D N+ +PIF  N P    V     V   ++ +   D D G NA +  S+      G+ +P  FSI+    ++  N  L  E    + L V  KD G P  S + +++I + D
Sbjct:  420 ASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDN--FPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-------TVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD-------TATVHINITDANNFAPIFE-NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD 999          

HSP 5 Score: 93.5893 bits (231), Expect = 7.877e-19
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1373 DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-----------DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMV-HFNES 2401
            ++ +  P F       S+LE  P G  VT VRA D ++      +  + D R+ +     F ++S  G +  +  LDR L+D   F V  V +D   P  S    + +N++D N+  P F    F  ++ E  +    ++        +  +D D G NA++   I+             +  F+I S +G++ + + LDRE  + Y L + A D       R T T SV + + D NDN P F  R + +              +A +   D D G NA +  +I  G     FSID     V L + L  E    ++L++  +D G P +S++ ++ + + D+   +P+     F ES
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSL----FKVDSRTGVVTTSASLDRELMDVHYFRV--VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES 697          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 215.698 bits (548), Expect = 9.143e-57
Identity = 202/693 (29.15%), Postives = 317/693 (45.74%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKL-------KLKSSIDRETNDRIELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSL--LPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK--GFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVN--QHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINK------FQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPL-PTKVSYKEYVRHELIALFVEDKDSGANAVV-----DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D ND++P +  +  E SI E A +G+      A D D      +         +  D A L  D E    ++         +SS+DRET+D   L++   D   + S   T    + +++LD NDNYP FS   Y + + E+    +      ++ A D D GN   + Y     NT S    F+I+S +G++ L+K LDY+S    SY  V+ A D G P+ S++T +++N++D ND  P    ++  +  ++ EN  +   I+ V  +D D+G N +   + I  +   F L       D     +      DRE++      +   D G+P  ++S  + + + DVNDN P F+      ++ E  P GT VT V A D DE  +S+L Y I    TT      F I S NG  L+   Q LD   +      +      GR   S+   + IN+ D NN  P+F  + +  +V ED        P    +  ++ +D D GVNAQ+T ++ +++IN       F I+   G + + A LDRE    Y LT+ A DG  P +    + T  V I + D+NDN+P F    PL    +     V   +I +   D D G N  +     D  I+ G     F ID    +++ N+ L  E   +  L  I  D+G PP SS++E+QI ++D
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD----IGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVR--SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDNFPLAV-----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSASVFED-------APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL----SDTTDVEIGVTDVNDNAPAFKS--PLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDG----SFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 178.718 bits (452), Expect = 5.014e-45
Identity = 173/580 (29.83%), Postives = 259/580 (44.66%), Query Frame = 2
Query:  377 DLNDNAPH-WPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGE--IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFL----IGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-----SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF 2074
            D NDNAP  +    + S+ EN  +G       A D D     +      ++  + F LA  P     Q  K      +DRE   R    ++  D G PP +    + I + DVNDN P F+   Y  ++ E+ Q        V+A D D  +  +L Y+ +  NT   +  FAI S NG   I + +SLDY    E  +   V A D G    S + TV INI D N+  PI     +    ++FE+  +   ++ VS  D D G+N Q    L    I   G    F  N     I   +     DRE  +    T+T  D G PSL+ +  + + + DVNDN P F  P    SILE + +GT V +V A D D GLN ++ Y +SD    +  F   +  ++G +  N+ LDR     +F +  +  D G P LS+ +E+ I L D+N+ PP F        VPE+        P    +G I   D D+GVNA +  +I   D+ N F +     S    L ++  LD E   + +  L+    +P ++        + I + D+NDN+P+  R+F
Sbjct:  681 DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIK-----PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPDEDS--RLHYEITTGNT---RGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPI--FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI---VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDR-ESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-------SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLR----NDAHIEILVTDVNDNAPVL-RDF 1223          

HSP 3 Score: 170.629 bits (431), Expect = 1.720e-42
Identity = 158/550 (28.73%), Postives = 253/550 (46.00%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP-PFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI---NKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSI 2215
            + L   +D E+     LVI   D GSP  +    + + ++D NDN P F T ++  S+ EN  +   + I V A D D G   +++Y  S+S  D      A++   G ++ IK LD +   +  ++F VVA D G P  S+S++V+I + DVND  P  + N    +  + E+     P+  V+  D D+     +       +G   +  QN   LI          D ++E     T+   D G  S T++  + + I D N+  P F     S S+ E +P+GT V  V A D D G+N+Q+ Y +++        P PF I    G ++ N  LDR      + + V   D G P+LS+  ++ I + D+N+  P F    +  ++ ED      LV    ++  +A SD D G+N ++   + D       F I   +G +++   LDRE    + LT IA+D G+P +    + T  V I L D+ND+ P F  +  +   V     V   +  +   D D G NAVV  SI  G  +  FS+
Sbjct:  641 VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITY--SISERDD-NFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITI----AQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA-----LVGT--SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 4 Score: 163.31 bits (412), Expect = 2.658e-40
Identity = 160/609 (26.27%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRH-----FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPA---LSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN---NNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLS-DLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN---GMLQSVAVLDREEKEEYKLTLIAID--GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP----GIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +S+DRE  D     ++ TD   PP +G   + + +LD ND+ PTF   ++  S+RE   + S + I + A D D G   ++ Y   +V++   + +      F I+S +G I    SLD ++ +  SY  +V A D         +++ +V + ++D ND  P  S  +    + + E+      +  +  +   D DQG N      +IG          ++S D+ + + +     D E        I   D G PS +++  + V ++D NDN P F       S+LE+ P+G  + +V+A D DEG N+++ Y IS+ R  N  FP  +    G +   + LDR   G  F+  VV  D G P  S    + I + D+N+  P FN   +   V ED     P+         +  +D D+       +   +   +F I+     G++     LD ++++ + LT+ A D  G  D       T +V I + D N+ +PIF  N P    V     V   ++ +   D D G NA +  S+      G+ +P  FSI+    ++  N  L  E    + L V  KD G P  S + +++I + D
Sbjct:  420 ASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDN--FPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-------TVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD-------TATVHINITDANNFAPIFE-NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD 999          

HSP 5 Score: 93.5893 bits (231), Expect = 8.644e-19
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1373 DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-----------DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMV-HFNES 2401
            ++ +  P F       S+LE  P G  VT VRA D ++      +  + D R+ +     F ++S  G +  +  LDR L+D   F V  V +D   P  S    + +N++D N+  P F    F  ++ E  +    ++        +  +D D G NA++   I+             +  F+I S +G++ + + LDRE  + Y L + A D       R T T SV + + D NDN P F  R + +              +A +   D D G NA +  +I  G     FSID     V L + L  E    ++L++  +D G P +S++ ++ + + D+   +P+     F ES
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSL----FKVDSRTGVVTTSASLDRELMDVHYFRV--VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES 697          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 215.698 bits (548), Expect = 9.143e-57
Identity = 202/693 (29.15%), Postives = 317/693 (45.74%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKL-------KLKSSIDRETNDRIELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSL--LPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK--GFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVN--QHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINK------FQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPL-PTKVSYKEYVRHELIALFVEDKDSGANAVV-----DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D ND++P +  +  E SI E A +G+      A D D      +         +  D A L  D E    ++         +SS+DRET+D   L++   D   + S   T    + +++LD NDNYP FS   Y + + E+    +      ++ A D D GN   + Y     NT S    F+I+S +G++ L+K LDY+S    SY  V+ A D G P+ S++T +++N++D ND  P    ++  +  ++ EN  +   I+ V  +D D+G N +   + I  +   F L       D     +      DRE++      +   D G+P  ++S  + + + DVNDN P F+      ++ E  P GT VT V A D DE  +S+L Y I    TT      F I S NG  L+   Q LD   +      +      GR   S+   + IN+ D NN  P+F  + +  +V ED        P    +  ++ +D D GVNAQ+T ++ +++IN       F I+   G + + A LDRE    Y LT+ A DG  P +    + T  V I + D+NDN+P F    PL    +     V   +I +   D D G N  +     D  I+ G     F ID    +++ N+ L  E   +  L  I  D+G PP SS++E+QI ++D
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD----IGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS---QFSIDSMSGDVSLVKPLDYESVR--SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDNFPLAV-----DPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSASVFED-------APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSL----SDTTDVEIGVTDVNDNAPAFKS--PLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDG----SFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 2 Score: 178.718 bits (452), Expect = 5.014e-45
Identity = 173/580 (29.83%), Postives = 259/580 (44.66%), Query Frame = 2
Query:  377 DLNDNAPH-WPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGE--IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFL----IGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-----SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF 2074
            D NDNAP  +    + S+ EN  +G       A D D     +      ++  + F LA  P     Q  K      +DRE   R    ++  D G PP +    + I + DVNDN P F+   Y  ++ E+ Q        V+A D D  +  +L Y+ +  NT   +  FAI S NG   I + +SLDY    E  +   V A D G    S + TV INI D N+  PI     +    ++FE+  +   ++ VS  D D G+N Q    L    I   G    F  N     I   +     DRE  +    T+T  D G PSL+ +  + + + DVNDN P F  P    SILE + +GT V +V A D D GLN ++ Y +SD    +  F   +  ++G +  N+ LDR     +F +  +  D G P LS+ +E+ I L D+N+ PP F        VPE+        P    +G I   D D+GVNA +  +I   D+ N F +     S    L ++  LD E   + +  L+    +P ++        + I + D+NDN+P+  R+F
Sbjct:  681 DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIK-----PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED-QPPGTPVTTVTATDPDEDS--RLHYEITTGNT---RGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPI--FENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI---VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSF--VIDPTSGTIRTNKGLDR-ESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-------SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRAASPPLR----NDAHIEILVTDVNDNAPVL-RDF 1223          

HSP 3 Score: 170.629 bits (431), Expect = 1.720e-42
Identity = 158/550 (28.73%), Postives = 253/550 (46.00%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP-PFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI---NKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSI 2215
            + L   +D E+     LVI   D GSP  +    + + ++D NDN P F T ++  S+ EN  +   + I V A D D G   +++Y  S+S  D      A++   G ++ IK LD +   +  ++F VVA D G P  S+S++V+I + DVND  P  + N    +  + E+     P+  V+  D D+     +       +G   +  QN   LI          D ++E     T+   D G  S T++  + + I D N+  P F     S S+ E +P+GT V  V A D D G+N+Q+ Y +++        P PF I    G ++ N  LDR      + + V   D G P+LS+  ++ I + D+N+  P F    +  ++ ED      LV    ++  +A SD D G+N ++   + D       F I   +G +++   LDRE    + LT IA+D G+P +    + T  V I L D+ND+ P F  +  +   V     V   +  +   D D G NAVV  SI  G  +  FS+
Sbjct:  641 VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITY--SISERDD-NFPLAVDPRTGWVQTIKPLDRE--EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP--AFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITI----AQSLDYKQEKRFLLTVAATDSGGRSDTAT--VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA-----LVGT--SVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL----SSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 4 Score: 163.31 bits (412), Expect = 2.658e-40
Identity = 160/609 (26.27%), Postives = 270/609 (44.33%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRH-----FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPA---LSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN---NNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLS-DLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN---GMLQSVAVLDREEKEEYKLTLIAID--GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP----GIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +S+DRE  D     ++ TD   PP +G   + + +LD ND+ PTF   ++  S+RE   + S + I + A D D G   ++ Y   +V++   + +      F I+S +G I    SLD ++ +  SY  +V A D         +++ +V + ++D ND  P  S  +    + + E+      +  +  +   D DQG N      +IG          ++S D+ + + +     D E        I   D G PS +++  + V ++D NDN P F       S+LE+ P+G  + +V+A D DEG N+++ Y IS+ R  N  FP  +    G +   + LDR   G  F+  VV  D G P  S    + I + D+N+  P FN   +   V ED     P+         +  +D D+       +   +   +F I+     G++     LD ++++ + LT+ A D  G  D       T +V I + D N+ +PIF  N P    V     V   ++ +   D D G NA +  S+      G+ +P  FSI+    ++  N  L  E    + L V  KD G P  S + +++I + D
Sbjct:  420 ASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDN--FPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVT-------TVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD-------TATVHINITDANNFAPIFE-NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD 999          

HSP 5 Score: 93.5893 bits (231), Expect = 8.644e-19
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1373 DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-----------DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMV-HFNES 2401
            ++ +  P F       S+LE  P G  VT VRA D ++      +  + D R+ +     F ++S  G +  +  LDR L+D   F V  V +D   P  S    + +N++D N+  P F    F  ++ E  +    ++        +  +D D G NA++   I+             +  F+I S +G++ + + LDRE  + Y L + A D       R T T SV + + D NDN P F  R + +              +A +   D D G NA +  +I  G     FSID     V L + L  E    ++L++  +D G P +S++ ++ + + D+   +P+     F ES
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSL----FKVDSRTGVVTTSASLDRELMDVHYFRV--VATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVIT-------LRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES 697          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 253.447 bits (646), Expect = 5.789e-70
Identity = 220/743 (29.61%), Postives = 363/743 (48.86%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS----LNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF---HRNFP---LPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPK---------------SSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLA--LGSFITIVIIKCRKKAK 2515
            D+NDNAP +    I +SI EN  I + + +P A D D      Q    +K  S  F L  + T +  ++P+L ++ S+DRET D   + I + D G+PP +   I+ + + DVNDN P F   +  +++ EN  + + +  ++ A D D G+  ++ +  S   + S KRHFAI+ST G I + + LD +      +  +V+A D    +  S  TVI+N+ D+ND +P I     +N     + + EN  LN  I  ++V D D  +NG+  C+      F L  K   +D  + +  A   ++  +E +A   I   D G P L +S ++ + I D NDN+P F  P    SI E++  GT + K+ A D D G N+ +IY +  P   +     F I+S   +L V + LDR    E +S  V+  D+G   L + + + + + D N+  P F    ++F VPE+    LPL      +G I V+D D G NA +TL+I +  + F I    G+++     DRE++  Y   + A+D      ++ T    V I + D+NDN P+F     N+    +P+  S    V      +F  D D+G NA +  SI  G +   F+ID+   ++ L  K+ +  QG+H+L+V  KD G+P                 S++  IQ  +  S     +  +  N+   + N  +IV+ IA+I   +   L  F+T  +++CR+  +
Sbjct:  131 DINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSE-FGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSV-THLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNP--VHKLIVLASDGS--STPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRL--KPVFNDQFLLETAAPLDYETTRE-YAI-RIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLG-PDAPDG----FNIDSRSGILSVVKRLDR-EKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPEN----LPLY---GTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAG---LMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTR----VFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALVHLFVNDTVSNATFIQEQLRKSLETPLERNIGDNDVTPQTNGYVIVV-IAIIAGTMTVILVIFVT-ALVRCRQTPR 841          

HSP 2 Score: 135.576 bits (340), Expect = 7.125e-32
Identity = 151/540 (27.96%), Postives = 239/540 (44.26%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPT----FSMPATSFSIL--EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP----PFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPE--DPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIF---HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQS 2233
            I D+NDN P F +    IS+ EN  +NS  P+  SA D D G  G   Y+   S ++           +   +LI     D   + ++   +   D G P  SS+  + + + DVND  P+     S  ++ + EN  +   +  +   D D G N Q + F   ++      +    D     +  K   DRE        +   D    S  S   + V + D+NDN+P+    + M   + ++L  E++P+ T +  +   D+D  LN ++  + +D     ++ P     FL+E+   L      +       +++ +V SD G+P L+    + I + D N+  PVF Q     ++PE  DP   L           I+ +D D G NA +  ++  D  + F I S +G+L  V  LDRE++E+Y  T+IA D GT  +Q   TV     + + D NDNSP F     NF +P  +    Y    LI   V D D+G NAVV LSI           K G+I P  + DR++QS
Sbjct:  129 IEDINDNAPLFQSTVINISIPENTAINSRYPVP-SAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPV--FKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIH-FSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGS--STPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCY-TDHDVPFRLKPVFNDQFLLETAAPLDYETTRE-------YAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLI---------KISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVK----LIVQDQNDNSPAFTHPEYNFYVPENLPL--YGTVGLIT--VTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQS 637          

HSP 3 Score: 85.5001 bits (210), Expect = 2.445e-16
Identity = 101/404 (25.00%), Postives = 168/404 (41.58%), Query Frame = 2
Query: 1253 LMAKHKFDREKEAFAYTTITCCDYGIP-SLTSSQL-----ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDG--TPDVQIRHTVTGSVVIFLNDLNDNSP---------------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIK---PGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            L   ++ DREK          C Y I  ++   ++     I  +I D+NDN P F     + SI E++ I +      A D D G+N   I H    ++ ++     +    G+    L+V Q LDR    + F + + V D G P  S+   + + + D+N+  PVF  S     VPE+        P   ++ ++  +D D G NAQ+  +  + I+     H       G++     LDRE    +KL ++A DG  TP          +V++ + D+NDN P               +   N PL TK++           + V D+DS  N  V        P  + P F+   D+  ++    L  E    + + ++  D G+PP ++S  + I I D
Sbjct:   85 LTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGING--IQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETK-DTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPEN-------APMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPS-------RATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIAL----------ITVTDRDSDLNGKVTCYTDHDVPFRLKPVFN---DQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKD 458          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 253.832 bits (647), Expect = 8.346e-70
Identity = 220/743 (29.61%), Postives = 363/743 (48.86%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS----LNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF---HRNFP---LPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPK---------------SSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLA--LGSFITIVIIKCRKKAK 2515
            D+NDNAP +    I +SI EN  I + + +P A D D      Q    +K  S  F L  + T +  ++P+L ++ S+DRET D   + I + D G+PP +   I+ + + DVNDN P F   +  +++ EN  + + +  ++ A D D G+  ++ +  S   + S KRHFAI+ST G I + + LD +      +  +V+A D    +  S  TVI+N+ D+ND +P I     +N     + + EN  LN  I  ++V D D  +NG+  C+      F L  K   +D  + +  A   ++  +E +A   I   D G P L +S ++ + I D NDN+P F  P    SI E++  GT + K+ A D D G N+ +IY +  P   +     F I+S   +L V + LDR    E +S  V+  D+G   L + + + + + D N+  P F    ++F VPE+    LPL      +G I V+D D G NA +TL+I +  + F I    G+++     DRE++  Y   + A+D      ++ T    V I + D+NDN P+F     N+    +P+  S    V      +F  D D+G NA +  SI  G +   F+ID+   ++ L  K+ +  QG+H+L+V  KD G+P                 S++  IQ  +  S     +  +  N+   + N  +IV+ IA+I   +   L  F+T  +++CR+  +
Sbjct:  131 DINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSE-FGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSV-THLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNP--VHKLIVLASDGS--STPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRL--KPVFNDQFLLETAAPLDYETTRE-YAI-RIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLG-PDAPDG----FNIDSRSGILSVVKRLDREKQ-EKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPEN----LPLY---GTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAG---LMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTR----VFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALVHLFVNDTVSNATFIQEQLRKSLETPLERNIGDNDVTPQTNGYVIVV-IAIIAGTMTVILVIFVT-ALVRCRQTPR 841          

HSP 2 Score: 135.576 bits (340), Expect = 7.251e-32
Identity = 151/540 (27.96%), Postives = 239/540 (44.26%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPT----FSMPATSFSIL--EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP----PFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPE--DPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIF---HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQS 2233
            I D+NDN P F +    IS+ EN  +NS  P+  SA D D G  G   Y+   S ++           +   +LI     D   + ++   +   D G P  SS+  + + + DVND  P+     S  ++ + EN  +   +  +   D D G N Q + F   ++      +    D     +  K   DRE        +   D    S  S   + V + D+NDN+P+    + M   + ++L  E++P+ T +  +   D+D  LN ++  + +D     ++ P     FL+E+   L      +       +++ +V SD G+P L+    + I + D N+  PVF Q     ++PE  DP   L           I+ +D D G NA +  ++  D  + F I S +G+L  V  LDRE++E+Y  T+IA D GT  +Q   TV     + + D NDNSP F     NF +P  +    Y    LI   V D D+G NAVV LSI           K G+I P  + DR++QS
Sbjct:  129 IEDINDNAPLFQSTVINISIPENTAINSRYPVP-SAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPV--FKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIH-FSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGS--STPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCY-TDHDVPFRLKPVFNDQFLLETAAPLDYETTRE-------YAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQL---------IKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVK----LIVQDQNDNSPAFTHPEYNFYVPENLPL--YGTVGLIT--VTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQS 637          

HSP 3 Score: 85.1149 bits (209), Expect = 3.296e-16
Identity = 101/404 (25.00%), Postives = 168/404 (41.58%), Query Frame = 2
Query: 1253 LMAKHKFDREKEAFAYTTITCCDYGIP-SLTSSQL-----ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDG--TPDVQIRHTVTGSVVIFLNDLNDNSP---------------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIK---PGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            L   ++ DREK          C Y I  ++   ++     I  +I D+NDN P F     + SI E++ I +      A D D G+N   I H    ++ ++     +    G+    L+V Q LDR    + F + + V D G P  S+   + + + D+N+  PVF  S     VPE+        P   ++ ++  +D D G NAQ+  +  + I+     H       G++     LDRE    +KL ++A DG  TP          +V++ + D+NDN P               +   N PL TK++           + V D+DS  N  V        P  + P F+   D+  ++    L  E    + + ++  D G+PP ++S  + I I D
Sbjct:   85 LTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGING--IQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETK-DTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPEN-------APMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPS-------RATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIAL----------ITVTDRDSDLNGKVTCYTDHDVPFRLKPVFN---DQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKD 458          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 251.906 bits (642), Expect = 2.745e-69
Identity = 228/777 (29.34%), Postives = 355/777 (45.69%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-------------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLI---IYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFP-------LPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD------------SQPLS-PKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                                +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP  +   TVIINI D ND +P I + K     LKD    + E+  ++ PI  V V D D+G NG   C ++G   F L     +   +    Y L      D E        I   D G PSL+S+  + V + D+NDN P FS      S  E++  G  V  V ALD D G N+++ Y +    + N +F   +    G++ VN  LDR    E +   V+  D G P L     + + + D N+  P F Q  F F + E+   + P       +G I V D DKG NA ++L I++  N F I +N G + S    DRE++  Y   + A+DG        + T +V + + D+NDN P     FP       LP   + +  VR     +   D D+G NA +   I  G     F +D     + L  KL+ +H G+H+L+V   D G P +S++  + I +++            ++ LS P N     +    + K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  129 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPI-LQLKAGDTDVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREDVSQL--RFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLDS--SVNGIFS--IDADTGDIRVNTILDR-EQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSP-------VGMITVMDADKGQNADMSLYIEEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGG---DPPRSATATVSLSVMDVNDNPPTVL--FPMNNSYTLLPPSSNIRTVVR----TVSATDTDTGVNANLSYRIVGGNPFKLFDMDAWTGVISLVGKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHIYVNETLFNSTIVEAQVAKSLSTPLNADIAGDPNYDLGKQRLSIAIGVVSGIMTVILIILVVVMARYCRPKNK 880          

HSP 2 Score: 139.428 bits (350), Expect = 4.971e-33
Identity = 163/623 (26.16%), Postives = 271/623 (43.50%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFA------INSTNGEIRLIKSLDYDSGNEL--------------------------SYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVN-QHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELI------ALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N +S  R         ++S +G+ R  +     S  EL                          SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE  +    T+   D G P  T    + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E + N      H    LD E    ++V++V  D G P+LS+   + + + D+N+ PPVF++ST   + PE+ +      P  R +  +A+ D D G NA+++ ++  ++N  F I +  G ++   +LDRE+ E Y+  +IA D G P +Q     + +VV+ + D NDN P F ++        +  Y++  L        + V D D G NA + L I+       FSID +  ++  N     E +  +   V   D G PP+S++  + +++ D     P  +   N S
Sbjct:  127 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTP--RFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVG-DVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNA------PGERVVTVVAL-DADSGKNAEISYSLDSSVNGIFSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMPVLQ----GSATVVVLVADKNDNEPKFMQDV-------FTFYIQENLQPNSPVGMITVMDADKGQNADMSLYIEEE--ENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNS 720          

HSP 3 Score: 73.9442 bits (180), Expect = 8.760e-13
Identity = 79/323 (24.46%), Postives = 133/323 (41.18%), Query Frame = 2
Query: 1361 VIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI-------------------SDPRTTNQMFPPFLI---------------ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL---AIKDNINKFQI--SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSP---------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI 2182
            VII+D+NDN P+F  P  + S+ E+ PIGT+     A D+D G N    Y +                    D  +  + F                    E    L++   LDR    + + + + V D G P  S+Q  + + + D+N+  P F +S +   +PE+ S   P++        +   D D GVN Q+     A  +++ +        G L  +  +DRE+  + + T++A D G P      T   +V+I + D NDN P         IF ++      V+    V   +  + V D+D G N +V  ++
Sbjct:  125 VIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDR-EQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPIL-------QLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPP----KTDKATVIINIKDENDNVPNIDIRKIGRIFLKDG--VANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTV 433          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 252.292 bits (643), Expect = 3.128e-69
Identity = 228/777 (29.34%), Postives = 355/777 (45.69%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-------------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLI---IYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFP-------LPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD------------SQPLS-PKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                                +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP  +   TVIINI D ND +P I + K     LKD    + E+  ++ PI  V V D D+G NG   C ++G   F L     +   +    Y L      D E        I   D G PSL+S+  + V + D+NDN P FS      S  E++  G  V  V ALD D G N+++ Y +    + N +F   +    G++ VN  LDR    E +   V+  D G P L     + + + D N+  P F Q  F F + E+   + P       +G I V D DKG NA ++L I++  N F I +N G + S    DRE++  Y   + A+DG        + T +V + + D+NDN P     FP       LP   + +  VR     +   D D+G NA +   I  G     F +D     + L  KL+ +H G+H+L+V   D G P +S++  + I +++            ++ LS P N     +    + K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  129 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPI-LQLKAGDTDVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREDVSQL--RFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLDS--SVNGIFS--IDADTGDIRVNTILDR-EQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSP-------VGMITVMDADKGQNADMSLYIEEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGG---DPPRSATATVSLSVMDVNDNPPTVL--FPMNNSYTLLPPSSNIRTVVR----TVSATDTDTGVNANLSYRIVGGNPFKLFDMDAWTGVISLVGKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHIYVNETLFNSTIVEAQVAKSLSTPLNADIAGDPNYDLGKQRLSIAIGVVSGIMTVILIILVVVMARYCRPKNK 880          

HSP 2 Score: 139.428 bits (350), Expect = 4.636e-33
Identity = 163/623 (26.16%), Postives = 271/623 (43.50%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFA------INSTNGEIRLIKSLDYDSGNEL--------------------------SYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVN-QHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA------LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N +S  R         ++S +G+ R  +     S  EL                          SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE  +    T+   D G P  T    + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E + N      H    LD E    ++V++V  D G P+LS+   + + + D+N+ PPVF++ST   + PE+ +      P  R +  +A+ D D G NA+++ ++  ++N  F I +  G ++   +LDRE+ E Y+  +IA D G P +Q     + +VV+ + D NDN P F ++        +  Y++  L        + V D D G NA + L I+       FSID +  ++  N     E +  +   V   D G PP+S++  + +++ D     P  +   N S
Sbjct:  127 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTP--RFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVG-DVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNA------PGERVVTVVAL-DADSGKNAEISYSLDSSVNGIFSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMPVLQ----GSATVVVLVADKNDNEPKFMQDV-------FTFYIQENLQPNSPVGMITVMDADKGQNADMSLYIEEE--ENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNS 720          

HSP 3 Score: 73.9442 bits (180), Expect = 8.874e-13
Identity = 79/323 (24.46%), Postives = 133/323 (41.18%), Query Frame = 2
Query: 1361 VIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI-------------------SDPRTTNQMFPPFLI---------------ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL---AIKDNINKFQI--SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSP---------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI 2182
            VII+D+NDN P+F  P  + S+ E+ PIGT+     A D+D G N    Y +                    D  +  + F                    E    L++   LDR    + + + + V D G P  S+Q  + + + D+N+  P F +S +   +PE+ S   P++        +   D D GVN Q+     A  +++ +        G L  +  +DRE+  + + T++A D G P      T   +V+I + D NDN P         IF ++      V+    V   +  + V D+D G N +V  ++
Sbjct:  125 VIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDR-EQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPIL-------QLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPP----KTDKATVIINIKDENDNVPNIDIRKIGRIFLKDG--VANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTV 433          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 253.062 bits (645), Expect = 3.734e-69
Identity = 228/777 (29.34%), Postives = 355/777 (45.69%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-------------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLI---IYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFP-------LPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD------------SQPLS-PKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                                +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP  +   TVIINI D ND +P I + K     LKD    + E+  ++ PI  V V D D+G NG   C ++G   F L     +   +    Y L      D E        I   D G PSL+S+  + V + D+NDN P FS      S  E++  G  V  V ALD D G N+++ Y +    + N +F   +    G++ VN  LDR    E +   V+  D G P L     + + + D N+  P F Q  F F + E+   + P       +G I V D DKG NA ++L I++  N F I +N G + S    DRE++  Y   + A+DG        + T +V + + D+NDN P     FP       LP   + +  VR     +   D D+G NA +   I  G     F +D     + L  KL+ +H G+H+L+V   D G P +S++  + I +++            ++ LS P N     +    + K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  129 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPI-LQLKAGDTDVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREDVSQL--RFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLDS--SVNGIFS--IDADTGDIRVNTILDR-EQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSP-------VGMITVMDADKGQNADMSLYIEEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGG---DPPRSATATVSLSVMDVNDNPPTVL--FPMNNSYTLLPPSSNIRTVVR----TVSATDTDTGVNANLSYRIVGGNPFKLFDMDAWTGVISLVGKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHIYVNETLFNSTIVEAQVAKSLSTPLNADIAGDPNYDLGKQRLSIAIGVVSGIMTVILIILVVVMARYCRPKNK 880          

HSP 2 Score: 140.198 bits (352), Expect = 3.544e-33
Identity = 161/608 (26.48%), Postives = 266/608 (43.75%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFA------INSTNGEIRLIKSLDYDSGNEL--------------------------SYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVN-QHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA------LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N +S  R         ++S +G+ R  +     S  EL                          SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE  +    T+   D G P  T    + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E + N      H    LD E    ++V++V  D G P+LS+   + + + D+N+ PPVF++ST   + PE+ +      P  R +  +A+ D D G NA+++ ++  ++N  F I +  G ++   +LDRE+ E Y+  +IA D G P +Q   T    VV+ + D NDN P F ++        +  Y++  L        + V D D G NA + L I+       FSID +  ++  N     E +  +   V   D G PP+S++  + +++ D
Sbjct:  127 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTP--RFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVG-DVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNA------PGERVVTVVAL-DADSGKNAEISYSLDSSVNGIFSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMPVLQGSAT----VVVLVADKNDNEPKFMQDV-------FTFYIQENLQPNSPVGMITVMDADKGQNADMSLYIEEE--ENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMD 705          

HSP 3 Score: 74.3294 bits (181), Expect = 6.107e-13
Identity = 79/323 (24.46%), Postives = 133/323 (41.18%), Query Frame = 2
Query: 1361 VIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI-------------------SDPRTTNQMFPPFLI---------------ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL---AIKDNINKFQI--SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSP---------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI 2182
            VII+D+NDN P+F  P  + S+ E+ PIGT+     A D+D G N    Y +                    D  +  + F                    E    L++   LDR    + + + + V D G P  S+Q  + + + D+N+  P F +S +   +PE+ S   P++        +   D D GVN Q+     A  +++ +        G L  +  +DRE+  + + T++A D G P      T   +V+I + D NDN P         IF ++      V+    V   +  + V D+D G N +V  ++
Sbjct:  125 VIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDR-EQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPIL-------QLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPP----KTDKATVIINIKDENDNVPNIDIRKIGRIFLKDG--VANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTV 433          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 265.388 bits (677), Expect = 9.103e-74
Identity = 225/777 (28.96%), Postives = 366/777 (47.10%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-----------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLL------FKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTK---VSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  L++ EN  +GTL+ +P A D D                              +    +   +   +SS F+L    T D  + P+L +K  +DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++  +G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P+I + K     +KD    + E+  ++ PI  V V D DQG NG   C ++G   F L        +QN      Y L      D E        I   D G PSL+S+  + V + D NDN P FS      +  E++ +G  V  V A D D G N+++ Y + +P     M   F I  + G++ VN  LDR    + +   V+  D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I+++ + F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P    +FP+ +    +S    VR  + ++   D D+G NA ++ SI  G     F ID     V L  KL S+H G+H+L+V   D G+PP+S+   + + ++++  +S   +V +  ++                 ++K+ + I I V+  ++ +   I +V++   CR K+K
Sbjct:  131 DINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVYEADLAENSAPGTPI-LQLRATDYDVGVNGQIEYVFGAA-TESVRRLLRLDENSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPLIDIRKIGRIPVKDGMANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKK---YFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVATVLATDADSGKNAEIAYSL-EP----SMEGIFSIHPDTGDITVNIILDR-EQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLFIEEDSDIFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGG---DPPRSATATVSLFVMDENDNAPTI--SFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYKLFEIDSTSGVVSLVGKLTSKHYGLHRLVVQVNDSGQPPQSTIALVHVFVNET--ISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMARYCRAKSK 880          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 264.618 bits (675), Expect = 1.656e-73
Identity = 225/777 (28.96%), Postives = 366/777 (47.10%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-----------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLL------FKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTK---VSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  L++ EN  +GTL+ +P A D D                              +    +   +   +SS F+L    T D  + P+L +K  +DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++  +G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P+I + K     +KD    + E+  ++ PI  V V D DQG NG   C ++G   F L        +QN      Y L      D E        I   D G PSL+S+  + V + D NDN P FS      +  E++ +G  V  V A D D G N+++ Y + +P     M   F I  + G++ VN  LDR    + +   V+  D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I+++ + F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P    +FP+ +    +S    VR  + ++   D D+G NA ++ SI  G     F ID     V L  KL S+H G+H+L+V   D G+PP+S+   + + ++++  +S   +V +  ++                 ++K+ + I I V+  ++ +   I +V++   CR K+K
Sbjct:  131 DINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVYEADLAENSAPGTPI-LQLRATDYDVGVNGQIEYVFGAA-TESVRRLLRLDENSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPLIDIRKIGRIPVKDGMANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKK---YFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVATVLATDADSGKNAEIAYSL-EP----SMEGIFSIHPDTGDITVNIILDR-EQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLFIEEDSDIFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGG---DPPRSATATVSLFVMDENDNAPTI--SFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYKLFEIDSTSGVVSLVGKLTSKHYGLHRLVVQVNDSGQPPQSTIALVHVFVNET--ISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMARYCRAKSK 880          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 264.233 bits (674), Expect = 2.043e-73
Identity = 225/777 (28.96%), Postives = 366/777 (47.10%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-----------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLL------FKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTK---VSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  L++ EN  +GTL+ +P A D D                              +    +   +   +SS F+L    T D  + P+L +K  +DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++  +G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P+I + K     +KD    + E+  ++ PI  V V D DQG NG   C ++G   F L        +QN      Y L      D E        I   D G PSL+S+  + V + D NDN P FS      +  E++ +G  V  V A D D G N+++ Y + +P     M   F I  + G++ VN  LDR    + +   V+  D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I+++ + F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P    +FP+ +    +S    VR  + ++   D D+G NA ++ SI  G     F ID     V L  KL S+H G+H+L+V   D G+PP+S+   + + ++++  +S   +V +  ++                 ++K+ + I I V+  ++ +   I +V++   CR K+K
Sbjct:  131 DINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVYEADLAENSAPGTPI-LQLRATDYDVGVNGQIEYVFGAA-TESVRRLLRLDENSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPLIDIRKIGRIPVKDGMANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKK---YFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVATVLATDADSGKNAEIAYSL-EP----SMEGIFSIHPDTGDITVNIILDR-EQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLFIEEDSDIFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGG---DPPRSATATVSLFVMDENDNAPTI--SFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYKLFEIDSTSGVVSLVGKLTSKHYGLHRLVVQVNDSGQPPQSTIALVHVFVNET--ISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMARYCRAKSK 880          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: emc7 (ER membrane protein complex subunit 7 [Source:Xenbase;Acc:XB-GENE-945123])

HSP 1 Score: 264.233 bits (674), Expect = 2.462e-73
Identity = 225/777 (28.96%), Postives = 366/777 (47.10%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD-----------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLL------FKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTK---VSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  L++ EN  +GTL+ +P A D D                              +    +   +   +SS F+L    T D  + P+L +K  +DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++  +G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P+I + K     +KD    + E+  ++ PI  V V D DQG NG   C ++G   F L        +QN      Y L      D E        I   D G PSL+S+  + V + D NDN P FS      +  E++ +G  V  V A D D G N+++ Y + +P     M   F I  + G++ VN  LDR    + +   V+  D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I+++ + F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P    +FP+ +    +S    VR  + ++   D D+G NA ++ SI  G     F ID     V L  KL S+H G+H+L+V   D G+PP+S+   + + ++++  +S   +V +  ++                 ++K+ + I I V+  ++ +   I +V++   CR K+K
Sbjct:  131 DINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELIQDAGESLYVSGRRGAAESSLYPGKRRMESDSRSSVFELQVADTSDGEKQPQLIVKGPLDREQRDSYELTLRVRDGGEPPRSSQSILRVLITDVNDNNPRFEKSVYEADLAENSAPGTPI-LQLRATDYDVGVNGQIEYVFGAA-TESVRRLLRLDENSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPLIDIRKIGRIPVKDGMANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPANDGEGEQNKKK---YFLHTSAPLDYENVKEYNVIIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFSQAVVEVAFPENNVLGERVATVLATDADSGKNAEIAYSL-EP----SMEGIFSIHPDTGDITVNIILDR-EQTDRYEFKVIAKDKGIPVLQGTTSVVVQVADRNDNEPRFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLFIEEDSDIFSIENDTGTIYSTVSFDREHQTSYTFKVKAVDGG---DPPRSATATVSLFVMDENDNAPTI--SFPINSSYAVLSPSSNVRTVVASVVATDSDNGVNADLNYSIVGGNPYKLFEIDSTSGVVSLVGKLTSKHYGLHRLVVQVNDSGQPPQSTIALVHVFVNET--ISNATVVDYQIARSLHTPLTQDIAGDPSYDMSKQRLSIVIGVVAGIMTVILIILVVVMARYCRAKSK 880          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 245.743 bits (626), Expect = 5.241e-67
Identity = 236/799 (29.54%), Postives = 360/799 (45.06%), Query Frame = 2
Query:   65 FIFSMSIIDRDS-ITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRL-SSSGII-----SVARQ--LDCDN--DSNLCDKTLEYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY--FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDIT-------IFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDL-----IIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE------LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
              F + I+   + +   V E  P N  +  L +    P +S   + +   H Y R+   +G I     S+ R+   +C N      C    E  MT L   +  ++   I I+  D+NDN P++  P I LSI EN  IG LF IP A D D           I    +   F L      DE Q P+L +   +DRE  D  +L I + D G+P      ++ I ILD NDN P F    Y   L EN  +   + + V A D D G   ++ Y  H  S  D+V+R   ++ + G I +   +D +    L +S  VVA D G    ++ T V I I D ND  P+I + +    +T       I E+  +  P+  V V D+D+G+N    C + G   F L   + +SD        Y L      D E        I   D G P L+S+  + V + DVNDN P FS         E++ I  +V +V A D D G NSQL Y I    +   +F   +   +G + VN  LDR    E +   VV  D G P+L     + I ++D N+  P F  + ++F+V E+       +P+   +G + V D DKG NA + L+++    +F I +  G + S    DRE +  Y   L A+DG      R +  G V I + D NDN+P+      +P+ +SYK Y+  +      +  +  ED D+G NA +D SI  G     F I  +   V L + +  +H G+H+L+V   D+G+P +  +  +   I+++
Sbjct:   56 LFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYP-DSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIM--DINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQ-PQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSV-LQVKANDSDQGVNAEIDYSFHQAS--DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFS--VVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQL---KQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFS--INPDSGQIRVNTVLDR-EQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMEN-------MPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGD--PPRSSYVG-VTINVLDENDNAPV----IVVPSNISYK-YLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINET 823          

HSP 2 Score: 155.606 bits (392), Expect = 6.453e-38
Identity = 170/639 (26.60%), Postives = 278/639 (43.51%), Query Frame = 2
Query:  596 KSSIDRETNDR-----------IELVILLTDSGSP-PLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVS--NTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHS----------PIGTVVTKVRALDKDEGLNSQL-----------IYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI----SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL------FVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            ++SIDRE+              +E  + +TD  SP P   +G   I+I+D+NDN P F++    +S+ EN  +  L PI  +A D DSG  G  SY+  V     D      A +    + +LI     D     SY   +   D G PA +SS  + I+I+D ND  P     K   +  + EN+ +   ++ V  +D DQG+N + +     H+  D + +    D     +  +   DRE       ++   D G    T+   +T+ I D NDN P   +    F ++ H           P+ T V  V+  D DEG+N+ +           +  +SD  T +     + +++   L      +       +++ +V  D G P LS+   + + + D+N+  PVF+QS      PE+ +D   LV +      ++ +D D G N+QL  +I  + +   I      +G ++   VLDRE++E Y   ++A+D G P ++     T SVVI + D NDN P F  N        Y   V   +  L       V D D G NA + LS++P   +  F I     ++  +     EHQ  +   +   D G PP+SS + + I + D    +P
Sbjct:  121 ETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDG--QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPI-PAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAP--KFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSF--HQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI--RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSD--TGSDSKKKYFLQTTTALDYESVKE-------YTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPEN-NDINDLVME------VSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK----GTASVVITVLDRNDNDPKFMLN-------GYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPE--SGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAP 721          

HSP 3 Score: 145.206 bits (365), Expect = 9.764e-35
Identity = 138/472 (29.24%), Postives = 223/472 (47.25%), Query Frame = 2
Query: 1028 INIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQ--LMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI-FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPL-VPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI--NKFQISHNG-------MLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEY--VRHELIALFVEDKDSGANAVVDLSIKPGIIA-PYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVH 2389
            I I+D+ND  P  + N  +  ++I EN N+       +  D D G+NG  +  LI G +  DL   Q   D    Q  L+     DRE+      TI   D G P+  SS L+ + I+D NDN P F   A    + E+SP+G  V +V+A D D+G+N+++ Y       T +     L  S G + V   +DR   G + FS  VV  D G    + + ++TI + D N+  PV     F     +    ++   VP    +  + VSD D+GVNA +T  +  ++     Q+S  G        LQ+   LD E  +EY + ++A+D G P +    + T S+ + + D+NDN+P+F ++     +V + E   +   ++ +   D DSG N+ +  SI P   A   FSI+ D   +++N  L  E +  +   V+  D+G P    +  + IT+ D     PK M++
Sbjct:  164 IEIMDINDNTP--NFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRL-LHLDRSTGLITVQGPIDREDVGTLKFS--VVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPL----SSTNSLKVQVTDVNDNAPVFSQSL---MEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLN 623          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh7 (protocadherin 7 [Source:MGI Symbol;Acc:MGI:1860487])

HSP 1 Score: 254.603 bits (649), Expect = 4.372e-70
Identity = 212/693 (30.59%), Postives = 327/693 (47.19%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQI---------TIDDSQPL----SPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ T+G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L    +     +   Y L      D E        I   D G PSL+S+  + V + D NDN P F          E++  G  V  V A D D G N+++ Y +      + +   F I+ + G++LVN  LDR    + +   V   D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++N N F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P       LP  +SY        VR  +  +   D D G NA ++ SI  G     F ID     V L  KL  +H G+H+L+V   D G+P +S++  + +         T+ DSQ +    +P       +   +I+K+ + I I V+  ++ +   I IV++   CR K K
Sbjct:  241 SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPI-LQLRATDLDVGVNGQIEYVFGAA-TESVRRLLRLDETSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSAPLDYETTREFNVVIVAVDSGSPSLSSNNSLVVKVGDTNDNPPVFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLD-----SSVMGTFAIDPDSGDILVNTVLDR-EQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLYIEENSNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTVT----LPRNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDSTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATVIDSQIVRSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVMMARYCRSKNK 909          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh7 (protocadherin 7 [Source:MGI Symbol;Acc:MGI:1860487])

HSP 1 Score: 254.988 bits (650), Expect = 9.197e-70
Identity = 212/693 (30.59%), Postives = 327/693 (47.19%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQI---------TIDDSQPL----SPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ T+G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L    +     +   Y L      D E        I   D G PSL+S+  + V + D NDN P F          E++  G  V  V A D D G N+++ Y +      + +   F I+ + G++LVN  LDR    + +   V   D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++N N F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P       LP  +SY        VR  +  +   D D G NA ++ SI  G     F ID     V L  KL  +H G+H+L+V   D G+P +S++  + +         T+ DSQ +    +P       +   +I+K+ + I I V+  ++ +   I IV++   CR K K
Sbjct:  241 SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPI-LQLRATDLDVGVNGQIEYVFGAA-TESVRRLLRLDETSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSAPLDYETTREFNVVIVAVDSGSPSLSSNNSLVVKVGDTNDNPPVFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLD-----SSVMGTFAIDPDSGDILVNTVLDR-EQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLYIEENSNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTVT----LPRNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDSTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATVIDSQIVRSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVMMARYCRSKNK 909          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh7 (protocadherin 7 [Source:MGI Symbol;Acc:MGI:1860487])

HSP 1 Score: 254.603 bits (649), Expect = 1.042e-69
Identity = 212/693 (30.59%), Postives = 327/693 (47.19%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQI---------TIDDSQPL----SPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ T+G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L    +     +   Y L      D E        I   D G PSL+S+  + V + D NDN P F          E++  G  V  V A D D G N+++ Y +      + +   F I+ + G++LVN  LDR    + +   V   D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++N N F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P       LP  +SY        VR  +  +   D D G NA ++ SI  G     F ID     V L  KL  +H G+H+L+V   D G+P +S++  + +         T+ DSQ +    +P       +   +I+K+ + I I V+  ++ +   I IV++   CR K K
Sbjct:  241 SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPI-LQLRATDLDVGVNGQIEYVFGAA-TESVRRLLRLDETSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSAPLDYETTREFNVVIVAVDSGSPSLSSNNSLVVKVGDTNDNPPVFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLD-----SSVMGTFAIDPDSGDILVNTVLDR-EQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLYIEENSNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTVT----LPRNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDSTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATVIDSQIVRSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVMMARYCRSKNK 909          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 250.366 bits (638), Expect = 8.471e-69
Identity = 200/679 (29.46%), Postives = 320/679 (47.13%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY--FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN-NNLNEPIVD------VSVHDLDQGINGQFNCFLIGHKGFDLL-FKQNLSD-LIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFV-----EDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P++  P I L+I EN  IG+LF IP A D D                +   F L  +  D E + P+L +  ++DRE  D  +L I + D G+PP     ++ + +LD NDN P F    Y   L EN  +   + I V A D D G   ++ Y    +  + V+R   ++   G I +   +D +  + L +S  V+A D G    S+   V++ + D+ND  P I + + +  +T  +   N++E + +      V V D D+G N    C + G   F L    +  SD    Y L      D EK       I   D G P L+S+  + V +VDVNDN P F+   T  +  E++  G VV +V A D D G N++L+Y +        +F   +   NG + V   LDR    + + + VV +D G P+L     + +N++D N+  P F  S ++F+V E+       +P    +G + V D DKG NA++ L+++ +   F I +  G + S    DRE++  Y   L A+DG   V  R    G V I + D NDN+P        P+  S++       +   V     ED DSG NA +  SI  G     F I     ++ L ++++  H G+H+L+V   DRG+PP+  +  + + ++++
Sbjct:  138 DINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQ-VAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSV-IQVKANDSDQGANAEIDYTFHQA-PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFS--VLAKDRGATPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLF--TISPENGEIRVKTSLDR-EQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMEN-------MPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG--GVPPRSAYVG-VTINVLDENDNAPFIT----APSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 793          

HSP 2 Score: 146.362 bits (368), Expect = 3.657e-35
Identity = 159/637 (24.96%), Postives = 272/637 (42.70%), Query Frame = 2
Query:  629 IELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVS--NTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF--------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISD---------PRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN-IGYIAVSDCDKGVNAQLTLAIKDNINK---FQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL------FVEDKDSGANAVVDLSIKP-----------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI---DDSQPL--SPKNMVH 2389
            +E  + +TD   +GSP L  EG I +Q  D+NDN P F++    +++ EN  + SL PI + A D D+G  G  SY+        +      A +    + +LI   + D     SY   +   D G P  +SS  + + ++D ND  P     +   +  + EN+ +   ++ V  +D DQG N + +     H+  +++ +    D     +  +   DRE  +    ++   D G    ++   + V + D+NDN PT  +             +I E     T V  V+  D+DEG N+ +   ++            T +     + +++   L   +  D       +++ +V  D G P LS+   + + ++D+N+  PVF QS      PE+         KP   +  +  SD D G NA+L  +++        F IS  NG ++    LDRE+++ Y+L ++A D G+P +Q     T +V++ + D NDN P F  +        Y   V   + AL       V D D G NA V LS++            G I    S DR++QS              +   +   D G PP+S+ + + I +   +D+ P   +P N  H
Sbjct:  112 LEFEVSITDLVQNGSPRLL-EGQIEVQ--DINDNTPNFASPVITLAIPENTNIGSLFPIPL-ATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAP--KFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-------YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPEN--------NKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQ----GTATVLVNVLDCNDNDPKFMLS-------GYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQST-------------YTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSH 701          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 250.366 bits (638), Expect = 8.471e-69
Identity = 200/679 (29.46%), Postives = 320/679 (47.13%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY--FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN-NNLNEPIVD------VSVHDLDQGINGQFNCFLIGHKGFDLL-FKQNLSD-LIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFV-----EDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P++  P I L+I EN  IG+LF IP A D D                +   F L  +  D E + P+L +  ++DRE  D  +L I + D G+PP     ++ + +LD NDN P F    Y   L EN  +   + I V A D D G   ++ Y    +  + V+R   ++   G I +   +D +  + L +S  V+A D G    S+   V++ + D+ND  P I + + +  +T  +   N++E + +      V V D D+G N    C + G   F L    +  SD    Y L      D EK       I   D G P L+S+  + V +VDVNDN P F+   T  +  E++  G VV +V A D D G N++L+Y +        +F   +   NG + V   LDR    + + + VV +D G P+L     + +N++D N+  P F  S ++F+V E+       +P    +G + V D DKG NA++ L+++ +   F I +  G + S    DRE++  Y   L A+DG   V  R    G V I + D NDN+P        P+  S++       +   V     ED DSG NA +  SI  G     F I     ++ L ++++  H G+H+L+V   DRG+PP+  +  + + ++++
Sbjct:  138 DINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQ-VAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSV-IQVKANDSDQGANAEIDYTFHQA-PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFS--VLAKDRGATPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLF--TISPENGEIRVKTSLDR-EQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMEN-------MPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG--GVPPRSAYVG-VTINVLDENDNAPFIT----APSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 793          

HSP 2 Score: 146.362 bits (368), Expect = 3.657e-35
Identity = 159/637 (24.96%), Postives = 272/637 (42.70%), Query Frame = 2
Query:  629 IELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVS--NTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF--------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISD---------PRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN-IGYIAVSDCDKGVNAQLTLAIKDNINK---FQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL------FVEDKDSGANAVVDLSIKP-----------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI---DDSQPL--SPKNMVH 2389
            +E  + +TD   +GSP L  EG I +Q  D+NDN P F++    +++ EN  + SL PI + A D D+G  G  SY+        +      A +    + +LI   + D     SY   +   D G P  +SS  + + ++D ND  P     +   +  + EN+ +   ++ V  +D DQG N + +     H+  +++ +    D     +  +   DRE  +    ++   D G    ++   + V + D+NDN PT  +             +I E     T V  V+  D+DEG N+ +   ++            T +     + +++   L   +  D       +++ +V  D G P LS+   + + ++D+N+  PVF QS      PE+         KP   +  +  SD D G NA+L  +++        F IS  NG ++    LDRE+++ Y+L ++A D G+P +Q     T +V++ + D NDN P F  +        Y   V   + AL       V D D G NA V LS++            G I    S DR++QS              +   +   D G PP+S+ + + I +   +D+ P   +P N  H
Sbjct:  112 LEFEVSITDLVQNGSPRLL-EGQIEVQ--DINDNTPNFASPVITLAIPENTNIGSLFPIPL-ATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAP--KFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-------YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPEN--------NKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQ----GTATVLVNVLDCNDNDPKFMLS-------GYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQST-------------YTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSH 701          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 4.694e-68
Identity = 200/679 (29.46%), Postives = 319/679 (46.98%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY--FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFEN-NNLNEPIVD------VSVHDLDQGINGQFNCFLIGHKGFDLL-FKQNLSD-LIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA-----LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P++  P I L+I EN  IG+LF IP A D D                +   F L  +  D E + P+L +  ++DRE  D  +L I + D GSPP     ++ + +LD NDN P F    Y   L EN  +   + I V A D D G   ++ Y    +  + V+R   ++   G I +   +D +  + L +S  V+A D G    S+   V++ + D+ND  P I + + +  +T  +   N++E + +      V V D D+G N    C + G   F L    +  SD    Y L      D EK       I   D G P L+S+  + V +VDVNDN P F+   T  +  E++  G V+ ++ A D D G N++L+Y +        +F   +    G + V   LDR    E + + VV +D G P+L     + +N++D N+  P F  S ++F+V E+       +P    +G + V D DKG NAQ+ L+++ +   F I +  G + S    DRE++  Y   L A+DG   V  R    G V I + D NDN+P        P+  S+K       +      +  ED DSG NA +  SI  G     F I     ++ L ++++  H G+H+L+V   DRG+PP+  +  + + ++++
Sbjct:  160 DINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQ-VAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSV-IQVKANDSDQGANAEIEYTFHQA-PEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFS--VLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLF--TISPETGEIQVKTSLDREQR-ESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMEN-------MPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG--GVPPRSAYVG-VTINVLDENDNAPYIT----APSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET 815          

HSP 2 Score: 145.976 bits (367), Expect = 3.136e-34
Identity = 162/637 (25.43%), Postives = 270/637 (42.39%), Query Frame = 2
Query:  629 IELVILLTD---SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVS--NTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF--------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISD---------PRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN-IGYIAVSDCDKGVNAQLTLAIKDNINK---FQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL------FVEDKDSGANAVVDLSIKP-----------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI---DDSQPL--SPKNMVH 2389
            +E  + +TD   +GSP L  EG I +Q  D+NDN P F++    +++ EN  + SL PI + A D D+G  G  SY+        +      A +    + +LI   + D     SY   +   D G P  +SS  + + ++D ND  P     +   +  + EN+ +   ++ V  +D DQG N +       H+  +++ +    D     +  +   DRE  +    ++   D G    ++   + V + D+NDN PT  +             +I E     T V  V+  D+DEG N+ +   ++            T +     + +++   L   +  D       +++ +V  D G P LS+   + + ++D+N+  PVF QS      PE+         KP   I  I  SD D G NA+L  +++        F IS   G +Q    LDRE++E Y+L ++A D G+P +Q     T +V++ + D NDN P F  +        Y   V   + AL       V D D G NA V LS++            G I    S DR++QS              +   +   D G PP+S+ + + I +   +D+ P   +P N  H
Sbjct:  134 LEFEVSITDLVQNGSPRLL-EGQIEVQ--DINDNTPNFASPVITLAIPENTNIGSLFPIPL-ASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP--KFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKD-------YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPEN--------NKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQ----GTATVLVNVLDCNDNDPKFMLS-------GYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQST-------------YTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSH 723          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|O60245|PCDH7_HUMAN (Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 8.760e-68
Identity = 211/693 (30.45%), Postives = 325/693 (46.90%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITID---------DSQPLS----PKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    + + + + A D D G  G++ Y    + T+SV+R   ++ T+G + ++  +D +  N+L   F V+A D GQP  +   TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L    +     +   Y L      D E        I   D G PSL+S+  + V + D NDN P F          E++  G  V  V A D D G N+++ Y +      + +   F I+ + G++LVN  LDR    + +   V   D G P L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++N N F I ++ G + S    DRE +  Y   + A+DG        + T +V +F+ D NDN+P       LP  +SY        VR  +  +   D D G NA ++ SI  G     F ID     V L  KL  +H G+H+L+V   D G+P +S++  + + ++         DSQ       P       +   +I+K+ + I I V+  ++ +   I IV++   CR K K
Sbjct:  241 SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPI-LQLRAADLDVGVNGQIEYVFGAA-TESVRRLLRLDETSGWLSVLHRIDREEVNQL--RFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLD-----SSVMGIFAIDPDSGDILVNTVLDR-EQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTVT----LPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNK 909          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 240.736 bits (613), Expect = 3.406e-64
Identity = 204/658 (31.00%), Postives = 320/658 (48.63%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDI--TIF--ENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPF-LIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYK----EYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRP 2314
            D NDNAP +P P I +SI EN  I + F IP A D D T  N    Y++    S F L  + T +  ++P+L ++ ++DRE  D   + I + D G+P  +   I+ + + DVNDN P F   +  + + EN  + + + I + A D D G+  ++ Y        + KR FA+N+T G I + +SLD +   E +   V V    G  +  +  TV IN+ DVND  P I L   +  I  T++  E + +N  I  ++V D D  +NG+  CF+     F L  K    +  + +  +   ++  KE F++  I   D G PSL  + L+ V + D NDN P F+ P    S+ E++  G  +T + A D+D G N+ ++Y +      N  F  F L    G L  ++  DR  + E F   V   D+G P L +Q  + + ++D N+  P F  + F F V E+       +PK   +G I V+D D G N  +TL+I  DN N     ++G+++S    DRE++  Y   + A DG    Q   + T  V I + D+NDNSP+       P+  S+K      +   ++A +F  D D+G NA +  +I  G     F ID    ++ L  K      G+H+L+V   D G P
Sbjct:  134 DTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSV-IQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDRE---ETAIHKVTVLASDGS-STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHL--KAVYDNQYLLETSSLLDYEGTKE-FSF-KIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLG----PNASF--FDLDRKTGVLTASRVFDR-EEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSEN-------LPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG---QPPRSSTAKVTINVMDVNDNSPVV---ISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 162.54 bits (410), Expect = 2.989e-39
Identity = 171/587 (29.13%), Postives = 264/587 (44.97%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK---GFDLLFK-QNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSM-----PATSFSIL-EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHL---DRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPG----IIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I I + D NDN P F +    IS+ EN  +NS  PI  SA D D+G  G   Y+  + N  SV     + +  GE   +LI   + D   + +Y   +   D G P  SS+  + + + DVND  P+    +   ++ I EN  +   ++ +   D D G N +   ++ G +       LF   N + LI  Q       DRE+ A    T+   D    S  +   +T+ + DVNDN P   +     P      L E  P+ T +  +   DKD  +N ++I  I       +   PF +++   +  NQ+L     LLD E    FS  +V SD G+P+L+    + + L D N+ PP+FNQ     +V E+    L L         I+ +D D G NA +   +  N + F +    G+L +  V DREE+E +  T+ A D GTP +Q +     +V++ + D NDNSP F H +F      +  +Y    +I   V D D+G N  V LSI       ++ PY  +      +K N     E Q  +   V   D G+PP+SS+ ++ I + D    SP
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPI-PSATDPDTGFNGVQHYE--LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPV--FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIR-YIFGAQVAPATKRLFALNNTTGLITVQ----RSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFI-------EREVPFHLKA---VYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLT-------TISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQ----AAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVIT--VTDADAGENKAVTLSILNDNDNFVLDPYSGV------IKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          

HSP 3 Score: 133.265 bits (334), Expect = 3.317e-30
Identity = 157/551 (28.49%), Postives = 243/551 (44.10%), Query Frame = 2
Query:  794 INVSAVDCDSGNFGKLSYKHSVSNTDS--VKRHFAINSTNGEI----------RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING-QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQL--IYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGR-PALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLV-PKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN---KFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE--LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            +N+S ++  +G    L Y+      D+  VK    ++S+ GEI          +L     Y   NE  +   VV   +    L     + I + D ND  P+      + +I+I EN  +N      S  D D G NG Q    L G   F L   +        QL+ +   DRE++      I   D G P  +S+ ++ V + DVNDN P F        I E++P+GT V ++ A D D G N+++  I+       T ++F   L  + G + V + LDR  +  I  V V+ SD    PA   +  +TIN+ D+N+ PP  N    +   P + + +L    P    I  I VSD D  VN ++   I+  +    K    +  +L++ ++LD E  +E+   ++A D G P +      T  V + L D NDN PIF  N P+  ++S  E  R    L  +   D+DSG NA  D+  + G  A +F +DR    +  +R    E Q      V  +D G PP  S   + +T+ D    SPK
Sbjct:   47 LNISHINAATGTSASLVYRLVSKAGDAPLVK----VSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLF--ALNNTTGLITVQRSLDR-EETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPP--NIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLN----QTALVRVKLEDENDNPPIF--NQPV-IELSVSENNRRGLYLTTISATDEDSGKNA--DIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK 571          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.944e-63
Identity = 198/660 (30.00%), Postives = 323/660 (48.94%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHG-QPALSSSTTVIINIVDVNDELPIIS----LNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS--DPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-----HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRP 2314
            D+NDNAP +P   I +SI EN+ I + + +P  +D D T  N    Y + K  S F L  + T +  + P+L ++  +DRE  D   + I + D G P  +   I+ + + D NDN P F  ++  +S+ EN  + S +   + A D D G   K+ +  S   ++  K+ F +NST G I + + LD +     ++  +V+A D G  PA +    V++N+ D+ND +P I     +N     + + EN  LN  I  ++V D D   NG  +CF      F L  +   S+  + +  A   ++  +E +A   +   D G P L  S ++ + + D NDN P F+ P  S S+ E++  GT +TK+ A+D D G N+++ Y +    P   N      L    G L   + LDR    E +S  V+  D+G P L     + + ++D N+  PVF  + ++F VPE+       +P+   +G I V+D D G N+ + L+I D  + F I    G++Q     DRE++E Y   + A DG    +I  + T  V I + D+NDN P+F     + +F L    +    V   ++A+   D D+G NA +  S+  G     F ID+   ++ L  K      G+H+L+V  KD G+P
Sbjct:  131 DINDNAPLFPATVINISIPENSAINSRYALPATIDPD-TGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSV-TQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESP--NHKLLVLASDGGLTPARA---MVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVPFRL--RPVFSNQFLLETAAYLDYESTRE-YAI-KLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSEFN------LDHRTGILTAVKKLDREKQ-EKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPEN-------LPRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGG---RISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAI---DNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          

HSP 2 Score: 145.591 bits (366), Expect = 4.960e-34
Identity = 168/624 (26.92%), Postives = 276/624 (44.23%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCF---LIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSM-----PATSFSIL-EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYV-----RHELIALF-VEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT---IDDSQP--LSPKNMVHFNESKEKINKEMIVITIAVI 2449
            I   I D+NDN P F      IS+ EN  +NS   +  + +D D+G  G  +Y H +    S+     I +  GE   +LI   + D   + +Y   +   D G P  SS+  + +++ D ND  P+   N+   +++I EN  +   +  +   D D G N + + +   LI +    L    + + LI      K   DRE+       +   D G+    +  ++ V + D+NDN+P+  +     P     +L E++P+ T +  +   DKD   N   +   +D     ++ P F   SN  LL    +LD     E +++ ++ +D G+P L+    + I + D N+  PVF Q     +VPE+ S    L         I+  D D G NA++   +  D  ++F + H  G+L +V  LDRE++E+Y  T++A D G P +    TV  +V+    D NDNSP+F  N        Y  YV     RH  + L  V D D G N+ V LSI           + G+I P  S DR++Q               +   V  +D GR  +SS+ ++ I    ++D++P  + P +   F       N   +V T+  I
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSRYALPAT-IDPDTGINGVQNY-HLIKG-QSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEI--EVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITI----KEPLDREESPNHKLLVLASDGGL--TPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNG-WVSCFTDHEVPFRLRPVF---SNQFLLETAAYLDYESTRE-YAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLT-------KISAMDADSGRNAEINYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVL----DQNDNSPVFTHN-------EYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISFDREKQES-------------YTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAI 701          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.214e-63
Identity = 209/742 (28.17%), Postives = 365/742 (49.19%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISL----NKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYK--------EYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEI-QITIDDS----------------QPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRK 2506
            D+NDNAP +P   I +SI EN+ I + + +P AVD D    N    Y++ K  + F L  + T +  + P+L ++  +DRE  D   + + + D G P  +   I+ + + D NDN+P F   +  +S+ EN  + + +   + A D D G   K+ +  S   ++  +R F +N+T G I + + LD +     ++  +V+A D G   + +   V++N+ DVND +P I +    N     + + EN  LN  I  ++V D D   NG+  CF      F L  +   S+  + +  A   ++  KE +A   +   D G P L  S ++ + + D NDN P F+    + SI E++  G  +TKV A+D D G N+++ Y +          P F ++   G L V + LDR  + + +   ++  D+G P L++ + + +++ID N+  PVF  + ++F VPE+       +P+   +G I V+D D G N+ +TL+I D  + F I S  G+++     DRE++E Y   + A DG    ++  + +  V I + D+NDN P+F      P+  SY+          V  ++IA+   D D+G NA V  SI  G     F+ID++  ++ L  K      G+H+++V   D G+P    S+ I  + +++S                 P++P   +    S      +++V  +A  I+V+ +  FIT V ++CR+
Sbjct:  131 DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPD-VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETP--NHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRL--RPVFSNQFLLETAAYLDYESTKE-YAI-KLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGP-----DAPPEFSLDCRTGMLTVVKKLDREKEDK-YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN-------LPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG---RVSRSSSAKVTINVVDVNDNKPVF---IVPPSNCSYELVLPSTNPGTVVFQVIAV---DNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVV-IFITAV-VRCRQ 838          

HSP 2 Score: 134.42 bits (337), Expect = 1.774e-30
Identity = 161/588 (27.38%), Postives = 263/588 (44.73%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN---CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSM-----PATSFSIL-EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLT-LAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLN--DLNDNSPIFHRNFPLPTKVSYKEYV-----RHELIALF-VEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            I D+NDN P F      IS+ EN  +NS   LP   +AVD D G  G  +Y+  +  + ++     I +  G+   +LI   + D   + +Y   V   D G P  SS+  + +++ D ND  P+    ++  +++I EN  +   +  +   D D G N + +     L+ +    L      + LI      K   DRE+       +   D G+  + +  ++ V + DVNDN+P+  +     P     +L E+ P+ T +  +   DKD   N ++    +D     ++ P F   SN  LL    +LD     E +++ ++ +D G+P L+    + I + D N+  PVF QS    ++PE+ S  + L         ++  D D G NA++  L   D   +F +    GML  V  LDRE++++Y  T++A D G P       +T +V +F++  D NDNSP+F  N        Y  YV     RH  + L  V D D G N+ V LSI           + G+I P  S DR++Q               +   V  +D GR  +SSS ++ I + D
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLP---AAVDPDVGINGVQNYE--LIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPV--FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITI----KEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVF---SNQFLLETAAYLDYESTKE-YAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT-------KVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVP------PLTSNVTVFVSIIDQNDNSPVFTHN-------EYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQES-------------YTFYVKAEDGGRVSRSSSAKVTINVVD 665          

HSP 3 Score: 129.413 bits (324), Expect = 5.988e-29
Identity = 126/462 (27.27%), Postives = 224/462 (48.48%), Query Frame = 2
Query: 1034 IVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKG-FDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISD--PRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDP-------SDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI----SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I D+ND  P+     ++ +I+I EN+ +N      +  D D GING  N  LI  +  F L   +      + QL+ + + DRE++      +   D G P  +S+ ++ V + D NDN P F       SI E++P+GT VT++ A D D G N+++ +  S+       ++F   L  + G + + + LDR  +     ++V+ SD G   +  +  + +N+ D+N+  P  +     + V  +P       S+++PL  K   I  I V+D D   N ++T    D+   F++    S+  +L++ A LD E  +EY + L+A D G P +      +  + I + D NDN+P+F ++F +   +        +L  +   D DSG NA ++  + P    P FS+D     + + +KL  E +  +   ++ KD G PP +S++ + ++I D    SP
Sbjct:  129 IEDINDNAPLFP--ATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLF--HLNATTGLITIKEPLDR-EETPNHKLLVLASDGG--LMPARAMVLVNVTDVNDNVPSID---IRYIV--NPVNDTVVLSENIPLNTK---IALITVTDKDADHNGRVT-CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSF-VTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPD-APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP 568          

HSP 4 Score: 78.1814 bits (191), Expect = 3.153e-13
Identity = 95/370 (25.68%), Postives = 164/370 (44.32%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGN----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKD---NINK--FQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSP---------------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVV----DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I  +I D+NDN P F     + SI E+S I +  T   A+D D G+N    Y +     +  +F   +IE+  G+    L+V + LDR  + + + + V V D G P  S+   + +++ D N+  PVF ++    ++PE+        P   ++  +  +D D G NA++  +  +   NI +  F + +  G++     LDREE   +KL ++A DG             V++ + D+NDN P               +   N PL TK++           + V DKD+  N  V    D  I P  + P FS   ++  ++    L  E    + + ++  D G+PP + S  + I + D    +P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIK---SQNIFGLDVIETPEGDKMPQLIVQKELDR-EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN-------APVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-----LMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIAL----------ITVTDKDADHNGRVTCFTDHEI-PFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAP 464          
BLAST of Protocadherin vs. TrEMBL
Match: A0A158QIB0 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9059 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 5.373e-95
Identity = 263/865 (30.40%), Postives = 408/865 (47.17%), Query Frame = 2
Query:  200 MLHVHSYFRL--SSSGIISVARQLDCDNDSNLCDKTL--EYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWP-------------KP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQF------------PKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTH------------KYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKS------LKDITIF-------------ENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTV--TGSVVIFLNDLNDNSPIFHRNFP--------LPT-KVSYKEYVRHELIALFVEDKDSGANAVVDLSI-----KPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPL-SPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKA 2560
            +L   +YF L  S    + V R LD DND  LC +    E C     +  ++ +V  + I I D NDN P WP             KP IEL I+EN  I +LF++P A D D              ++   +   + T+++ +F            P+L++   +DRE  D  E+ I   D G+        + + ++D NDN P F TH            K++I + E+  +NS LP++  A D DSG+FG++ Y+ S S  + V+R F+I  T G I +  +LD D+G    Y F +VA D     L++  TV+I + DVND  P ISL  +      L D T F             E     + +  V+V D D   +G+F C L G   F L     +    +YQL++  +FDRE EA    T+ C D G P   SS++I + ++DVNDN P F  P   FSI E+ P GT+V +V   D D G+N ++   +S     +Q    F I   G +  N+ LDR  + +     VV  D G+P+     E+TI + D N+C P F    +HF++ ED   +   V   R +G +   D D G NA++   I++  + F+IS NG + +V  LDRE K  Y L+++A D  P  Q   ++  T  V + + D+ND++P+F   FP        +P  K+S  E + H +  L  +D D+G NA +  S+      P      F +  D   + +  KL +     H L V   D G PP SS++ +QI +D + P  SP +    +E  + +N   +++ I   +S+  +   I I  +   +++K    C+   +   KA
Sbjct:   62 ILQDTTYFSLIGSHQNTVVVNRLLDRDNDRKLCREPTWPEVCAWSGVLFAHDGVVLSLRITITDANDNIPRWPESALSKPRNSKDGKPAIELLIAENTPIRSLFDLPLADDRD------------YGKNGIVNYELITTENQGRFSLICTTGPNGVVPRLQVLEMLDREERDEYEMQIAAIDGGNQKTIAG--LYVYLVDENDNSPIF-THLKNLPEEEKQRTKFVIEVDESIPVNSALPMHPVATDADSGDFGRVRYRFSFSTPEYVRRDFSIEPTTGNIIVQNNLDCDAGGVAEYVFSMVAEDSAPQPLTAVATVVIIVHDVNDNAPTISLTPATLKTDGLYDSTFFPSFEDSRDTFHLIEEMPSGQLVATVAVTDPDSDQDGEFFCDLGGSSDFTLHALPWIGATKVYQLLSARRFDREVEALISVTLKCVDRGNPPQASSKIIPITLIDVNDNRPYFQQPIYQFSIRENKPPGTLVGRVIVQDNDAGINGEVDITLSCKTGRHQHL--FSINEKGEIRSNEVLDREANPKRIQFTVVAEDRGKPSFRTTAEVTIEIEDENDCSPKFAFQNYHFSIEEDQEAYRRTV---REVGSVQAFDQDIGPNAEIQYLIEEPDSPFEISQNGTIYAVRKLDREVKSTYLLSVMAKD-LPTQQFEKSLNSTTQVRVTITDINDHAPVFI--FPRLNTSSDAIPKIKLSALEPIGHRIAKLQAKDADTGTNAKIRYSLLENSRLPMGTEKLFHLSEDSGELFIAAKLPTSKGSSHHLKVQATDGGSPPLSSTLSLQIVLDPTLPATSPGDSSGHDEGGDVLNNIYLIVIITFAVSIAFVILVIAIYFMSKDRRSK-GYCCFASSSARNKA 902          
BLAST of Protocadherin vs. TrEMBL
Match: A0A4V3SCX5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009656 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.341e-92
Identity = 245/809 (30.28%), Postives = 386/809 (47.71%), Query Frame = 2
Query:  251 VARQLDCDNDSNLCDKTL--EYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWP--------KPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXS----SYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHK--------------YIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPII--------------SLNKSLK-DITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPL-VPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHR----NFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD---SQPLSPKNMVHFNESKE------KINKEMIVITIAVIISVLALGSFITIVIIKCRK 2506
            V   LD D D  LC +    E C     I  ++  +  + I++ D+NDN P W           +++S++EN  +GT  ++P A D D    +     ++ +++    + FD+      +  ++ KL ++  +DRET     L+I   D G     G   +TI I D NDN P F+  K              + I++ E+  + S LP    A D D G+FG+++Y  ++S  + VKR F I+   G I +   LDYD+G    Y FV+VA DHG P L++S+ VII + D ND  PII              S  K  K  + + EN      I  ++VHD D G NG+F C L       L F +NL  L +YQL +    DRE       T+ C D+G+P   S++L+ V I DVNDN P F     SF   E +    ++  V A+D D G+N++L Y I  P   NQ   PF+I + G +     LDR    E F   V+  DHG P+LS   ++ + LID+N+C P F Q  +HFTV E+    +P  +     IG +  +DCD G NAQ+   ++     FQIS +G L +   +DRE+   + +T+ AID     + R +    V I + D+NDN PIF R    N      +S  E +  +++ +   DKD   N  +   +   +    F+++ +   + L R+L  E  GI  L ++  D G  P++++  I+I   D   ++P S    + ++E         ++N    +I   V+I+++       ++ +  RK
Sbjct:   83 VKSPLDRDTDRKLCSEGGWPEVCSWSGVIFSSDGRLLSLRIVVRDVNDNTPSWLTSQQHDGLAQLQISVTENCPLGTAIDLPLASDPDVGSNSVVNYERVIQEAVDHRAPFDIISTREPNGVRY-KLVVRGKLDRETTPLYRLMIAAVDGGGN--RGLAQLTILIADENDNRPVFTHTKMEESQSDLGEQQTEFTITIDEDLPVGSRLPRYPVATDADEGDFGRITYSFAISVAEVVKRDFRIDEVTGAIFVRAPLDYDTGGLTHYQFVIVAQDHGIPPLTASSKVIIEVQDRNDNAPIITVTPTTTATMTSSKSNEKHEKTSLHLLENAPSGSLIATITVHDPDSGENGKFMCQLGKVDSLRLEFLKNLGKLSVYQLYSSLPLDRESNPEIRVTLRCRDHGVPGRVSTELLMVNISDVNDNAPMFVNHRYSFQTSEGNDQDELIGLVTAVDSDSGVNAELSYSIIWP--NNQGLNPFIINARGEIRARMTLDRESRPEGFQFTVLAKDHGVPSLSALAKVEVALIDVNDCSPTFTQGVYHFTVEEE----IPFNLSNAYVIGQVKATDCDIGNNAQILYQLETTDAPFQISSDGYLSTTRPIDREQSSSFVITIQAIDSPQTTERRLSSFAEVQITVVDINDNDPIFLRPPFENGTHQVTLSIYEDINCKVVKIEAIDKDIERNGEIRFRLANDVSRGMFALNPESGELTLKRRLTVEEVGIIPLRILAIDNGLKPRTATTTIEILAADVPATKPTSFSGNLDYSEQPNTFLGNLRVNANKFIIVCIVVITLIICLILAAVICVVSRK 882          
BLAST of Protocadherin vs. TrEMBL
Match: A0A5J4NT48 (Protocadherin delta 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0000856 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.156e-90
Identity = 237/761 (31.14%), Postives = 371/761 (48.75%), Query Frame = 2
Query:  263 LDCDNDSNLC--DKTLEYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKP-------IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSY----FDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTF-----------STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISL-----------NKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN----IGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHR-NFPLPT-KVSYKEYVRHELIALFVE--DKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKIN 2416
            LD D D  LC  +   E C     I ++N  +  + +II D+NDN P W          ++ ++SEN  +GT  ++P A+D D    +      + +  S     FD+  + T +   + +L +   +DRE      + +   D G     G   +TI + D NDNYP F               ++I + E+  + + LP    AVD D G FG+L Y  S+S  D VKR F I+   GEI +   LDYD+G  + Y F+VVA DHG P L +S  VI+NI D ND  PII++           ++   ++T+ EN+   + I  ++VHDLD G NG F C L       L + +++  + I+QL++    DRE        + C D+G+PS  S++L+ V I+DVNDN P F+    SF   E    G  +  + A D D  LN+Q+ Y I  P+   Q   PF+I SNG L  +  LDR    E +   V+  D G P LS+  ++ + LID+N+C P F Q+ ++F+V E+       +P   N    IG +  +DCD G NAQ+   +      F++S+ G L + +  +RE +  + L L A+D     + R + T  + I + D+NDN P+F R  F   T ++    + + E +  +VE  D+D G N  V   +        F++  +   + L R L  E  G + L V+  D G  PK+++ +I+I I D  P      +  +E+   +N
Sbjct:   87 LDRDADRQLCIENGWPETCSWSGVIFVSNGRLLALRVIIRDVNDNTPSWSTKHKDGMAVLQTTVSENCPLGTTVDLPLAIDPDFGGNSIVRYEMVTQGISEGRPPFDVLSVNTSNGVIY-RLVVNGLLDREQKPNYIVTVGAIDGGGN--KGLARLTINVADENDNYPQFVHLKNDTERLHDDQGFVIYIDEDLPVGTRLPRCPVAVDDDEGEFGRLMYSFSISTGDVVKRDFRIDEHVGEIFVRSKLDYDAGGLIQYEFLVVAQDHGLPPLVASARVIVNIQDKNDNPPIITVTSVQRSTDWNNSRGRSNLTLPENSLAGKLIATLTVHDLDSGKNGMFTCKLGETNQLQLSYLKSMGKMNIFQLISTQPVDREMRTELRVMLRCSDHGMPSQVSTELLVVKIIDVNDNPPRFTNQHYSFQTPEGDAAGQFIGSITAYDSDSDLNAQITYFIEWPQI--QESNPFIINSNGELKAHLPLDRESQPEGYQFTVIAHDSGSPRLSSYAKVEVALIDVNDCAPNFTQNVYYFSVEEE-------LPAATNSTYVIGQVKATDCDIGSNAQVNYYLDSLGALFKVSNEGYLYTSSTFNRESQAVFTLKLSAVDSAHAPEQRLSSTAEIQITVTDINDNEPVFVRPPFENGTNEILLSVHEKPESLVTWVEATDEDDGQNGFVSYLLVGE--KRTFNLHSNSGELILLRMLSVEDLGKYPLTVLAVDSGEQPKTATAQIEIRIADIPPKEASQSMKDSETGLSMN 833          
BLAST of Protocadherin vs. TrEMBL
Match: A0A419QFC3 (Protocadherin-11 X-linked OS=Clonorchis sinensis OX=79923 GN=PCDH11X PE=4 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 7.999e-90
Identity = 248/853 (29.07%), Postives = 401/853 (47.01%), Query Frame = 2
Query:  251 VARQLDCDNDSNLCDKTL--EYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWP--------KPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXS----SYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHK--------------YIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISL-------------NKSLK--DITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPL-VPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHR----NFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD---SQPLSPKNMVHFNESKE------KINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEISDMDISMNFKVFNEENCMEC 2638
            V   LD D D  LC +    E C     I  ++  +  + I++ D+NDN P W           +++S++EN  +GT  ++P A D D    +     ++ +++    + FD+      +  ++ KL ++  +DRET     L+I   D G     G   +TI I D NDN P F+  K              + I++ E+  + S LP    A D D G+FG+++Y  ++S  + VKR F I+   G I +   LDYD+G    Y FVVVA DHG P L++S+ VII + D ND  PII++             N+ L+   + + EN      I  ++VHD D G NG+F C L       L F +NL  L +YQL +    DRE       T+ C D+G+P   S++L+ V I DVNDN P F     SF   E +    ++  V A+D D G+N++L Y I  P   NQ   PF I + G +     LDR    E F   V+  D+G P+LS   ++ + LID+N+C P F Q  +HFTV E+    +P  +     IG +  +DCD G NAQ+   ++     FQIS +G L +   +DRE+   + +T+ A D     + R +    V I + D+NDN PIF R    N      +S  E + ++++ +   DKD   N  +   +   +    F+++ +   + L RKL  E  GI  L ++  D G  P++++  I+I   D   ++P      + ++E         ++N    +I   V+I+++       ++ +  R+              ++K + +   S+  + +   VF+    ME 
Sbjct:  138 VKSPLDRDTDRKLCSEGGWPEVCSWSGVIFSSDGRLLSLRIVVRDVNDNTPSWLTSQQHDGLAQLQISVTENCPLGTAIDLPLASDPDVGSNSVVNYERVIQEAVDHRAPFDIISTKEPNGVRY-KLVVRGKLDRETTPLYRLMIAAVDGGGN--RGLAQLTILIADENDNRPVFTHMKMEESQSDLDEQQTEFTITIDEDLPVGSRLPRYPVATDADEGDFGRITYSFAISVAEVVKRDFRIDEVTGAIFVRAPLDYDTGGLTHYQFVVVAQDHGIPPLTASSKVIIEVQDRNDNAPIITVTPTITTTAPSSKSNEKLEKTSLQLLENAPSGSLIATITVHDPDSGENGKFTCQLGKVDSLRLEFLKNLGKLSVYQLYSTLPLDRESNPEVRVTLRCRDHGVPGRVSTELLMVNISDVNDNAPMFMNHRYSFQTTESNDQDELIGLVTAVDADSGVNAELSYSIIWP--NNQGLNPFTINARGEIRARMTLDRESRPEGFQFTVLAKDNGVPSLSALAKVEVALIDVNDCSPTFTQGVYHFTVEEE----IPFNLSNAYVIGLVKATDCDIGNNAQIFYQLEATDAPFQISSDGYLSTTRPIDREQSSSFVITIQATDSPQITERRLSSFAEVQITVVDINDNDPIFLRPPFENGTHQVALSIYEDINYKVVKIEAIDKDIERNGEIRFKLANDVPRGMFALNPESGELTLKRKLTVEEAGIIPLRILAIDNGLKPRTATTTIEILAADVPATKPTGISGNLDYSEQPNTFLGNLRVNANKFIIVCIVVITLIICLILAAVICVVSRRGCAAWTGAPNTSARNQKQIHLVSHSNGGLPLTEPVFSTAPDMEA 981          

HSP 2 Score: 106.686 bits (265), Expect = 1.689e-19
Identity = 146/581 (25.13%), Postives = 248/581 (42.69%), Query Frame = 2
Query:  530 SSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPL-TGEGII----------TIQILDVNDNYPTFSTH-------KYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINST---NG-EIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS---LNKSLKD---------ITIFENNNLNEPIVDVSVH-DLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYT--TITCCDYGIPSLTSSQLITVIIVDVNDNLPTF-----------------SMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQ-----HLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPE-DPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI----KDNINKFQISHNGMLQSVAVLDREEK-EEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRN 2071
            +SYFD       D HQ   L +KS +DR+T+ +     L ++ G P + +  G+I           I + DVNDN P++ T        +  IS+ EN  L + + + + A D D G+   ++Y+  +      +  F I ST   NG   +L+     D      Y  ++ A D G     +  T++  I D ND  P+ +   + +S  D         ITI E+  +   +    V  D D+G  G+    F I     +++ +    D +   +  +   D +     +    +   D+GIP LT+S  + + + D NDN P                    +  TS  +LE++P G+++  +   D D G N +    +    +    F    +++ G L V Q      LDR  + E+  V +   DHG P   +   + +N+ D+N+  P+F    + F   E +  D L        IG +   D D GVNA+L+ +I       +N F I+  G +++   LDRE + E ++ T++A D G P +    +    V + L D+ND SP F + 
Sbjct:  123 TSYFDF------DPHQPNTLIVKSPLDRDTDRK-----LCSEGGWPEVCSWSGVIFSSDGRLLSLRIVVRDVNDNTPSWLTSQQHDGLAQLQISVTENCPLGTAIDLPL-ASDPDVGSNSVVNYERVIQEAVDHRAPFDIISTKEPNGVRYKLVVRGKLDRETTPLYRLMIAAVDGGGNRGLAQLTIL--IADENDNRPVFTHMKMEESQSDLDEQQTEFTITIDEDLPVGSRLPRYPVATDADEGDFGRITYSFAISVA--EVVKRDFRIDEVTGAIFVRAPLDYDTGGLTHYQFVVVAQDHGIPPLTASSKVIIEVQDRNDNAPIITVTPTITTTAPSSKSNEKLEKTSLQLLENAPSGSLIATITVHDPDSGENGKFTCQLGKVDSLRLEF----LKNLGKLSVYQLYSTLPLDRESNPEV-RVTLRCRDHGVPGRVSTELLMVNISDVNDNAPMFMNHRYSFQTTESNDQDEL--------IGLVTAVDADSGVNAELSYSIIWPNNQGLNPFTINARGEIRARMTLDRESRPEGFQFTVLAKDNGVPSL----SALAKVEVALIDVNDCSPTFTQG 670          
BLAST of Protocadherin vs. TrEMBL
Match: A0A158REZ2 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8401 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.395e-89
Identity = 247/810 (30.49%), Postives = 380/810 (46.91%), Query Frame = 2
Query:  200 MLHVHSYFRLSSSG--IISVARQLDCDNDSNLCDKTL--EYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWP-----KP---------IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQF------------PKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIIT---IQILDVNDNYPTF-----------STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKS------LKDITIF-------------ENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVI-------VVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPED--PSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTV--TGSVVIFLNDLNDNSPIFHRNFP--------LPT-KVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGI----IAPYFSIDRDRQSVKLNRKLKSEHQGI-HKLIVIGKDRGRPPKSSSIEIQITIDDSQP 2365
            ML   +YF L   G  I+ V R LD DND  LC +    E C     +  ++ +V  + I + D+NDN P WP     KP         IEL I+EN   G++F++P A D D               +   +   +  D   +F            P+L++   +DRE  +  E+ I   D G     G+ ++    + ++D NDN P F              +++I + E+  + + LP +  A D D+G+FG++ Y+ S S  + VKR FAI S  G+I +   LD D+G    Y F ++A D     L++  TV+I + DVND  PIISL  +      + D T +             E     + +  V+V D D   +G+F C L   + F L     +    +YQL++  +FDRE EA    T++C D G+P   SS++I + ++D+NDN P F      FSI E+ P GT+V +V   D D G N  + + IS    T Q    F I   G +  N+ LDR  + + +  I       VV  D GRP     +E+ I + D N+C P F+   +HF++ ED  P  H      PR +G +  SDCD G NA++   ++     F+IS NG + +V  LDRE K  Y LT++A D  P      T+  T  V I + D+ND+SP+F   FP        LP  ++S  E + + +  L  +D DSG NA +  ++   +        F +  D   + +  KL +  + + + L V   D G PP+SS+  + I +D + P
Sbjct:   70 MLQDTTYFALRGPGQKIVVVNRLLDRDNDRKLCREASWPETCAWSGVLFAHDGVVFSLRITVIDVNDNIPRWPDSALSKPRNSEEKEPSIELFIAENTPTGSMFDLPLAEDRD------------YGNNGIVNYELVEMDKNGRFSLRCTNGPNGVIPRLQVLEMLDREEREEYEMQIAAADGG-----GQRVVVGLRVYLVDENDNPPIFVHLKNASQEEAQRARFVIEIDESLAIGTALPFHPIATDADAGDFGRVRYRFSFSTPEFVKRDFAIESETGKIIVKNILDCDAGGIPEYVFSMIAEDGAPQPLTALATVVIALHDVNDNAPIISLTPATPKIEDMYDTTFYPTFEDSRDTFCLVEEMPSGQMVATVAVTDPDSDADGEFECGLSTTQDFALHALPWIGATKVYQLLSARRFDREMEALTSVTLSCVDRGVPPRVSSKIIPITLIDINDNRPYFQQQFYQFSIPENRPPGTLVGRVIVQDNDAGKNGLVDFSIS--CKTGQYQHLFSISGMGEVRANEMLDRETNPQNYLEIICFLILKVVAEDKGRPTYRTSVEVCIEIEDENDCIPKFDFPNYHFSIDEDVEPYKH-----GPREVGIVQASDCDTGGNAEIHFFLEGTDTPFKISSNGTIFAVQQLDREIKSSYLLTVVARDSPPPRSPDKTLNSTAQVRITVTDINDHSPVFI--FPRLNSTSGSLPEIRMSALEPIGYRVAKLQAKDADSGVNADIRYTLTEELSVSSTEKLFRVSEDSGELFIAAKLSTSTKEMRYPLQVHATDGGTPPRSSTFNLIIYLDPTLP 853          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 254.218 bits (648), Expect = 1.213e-69
Identity = 204/674 (30.27%), Postives = 330/674 (48.96%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS----LNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS---------DPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-----HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEI 2338
            D+NDNAP +    I +SI EN  I   + +P A D D      Q    +K  +  F L  + T +  ++P+L ++ ++DRET D   + I + D G+PP +   I+ + + DVNDN P F   +  +++ EN  + + +   + A D D G+  ++ +  S   + + KRHFAI+S+ G I + + LD +S     +  +V+A D    A  S  TVI+N+ DVND +P I     +N     + + EN  LN  I  ++V D D  +NG+  C+      F L  K   +D  + +  A   ++  +E +A   I   D G P L +S ++ + I D NDN P F  P    SI E++  GT + K+ A D D G N+ +IY +          DPR+             G L V++ LDR    E +S  V+  D+G   L + + + + + D N+  P F  + ++F VPE+    LPL      +G I V+D D G NA +TL+I +  + F I    G+++     DRE++  Y   + A+D      I+ T    V I + D+NDN P+F     + ++ L   V +       +  +F  D D+G NA +  SI  G     F+ID+   ++ L  K+ +  QG+H+L+V  KD G+P    SI +
Sbjct:  131 DINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSV-TQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNP--VHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRL--KPVFNDQFLLETAAPLDYETTRE-YAI-KIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRS-------------GILSVSKRLDREKQ-EKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPEN----LPLY---GTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG---LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL---VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIAL 768          

HSP 2 Score: 136.732 bits (343), Expect = 3.107e-32
Identity = 136/466 (29.18%), Postives = 224/466 (48.07%), Query Frame = 2
Query: 1034 IVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING--QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPP----FLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDP----SDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN---KFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPT-KVSYKEY--VRHELIALFVEDKDSGANAVVDLSIKPGIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I D+ND  P+     ++ +I+I EN  +N      S  D D GING   +    +G   F L   +        QL+ +   DRE +      I   D G P  +S+ ++ V + DVNDN P F       ++ E++P+GT VT++ A D D G N+Q+ +  S     NQ+ P     F I+S+  L+ V Q LDR     +  +IV+ SD    A  ++  + +N+ D+N+  P  +  T +   P +     S++ PL  K   I  I V+D D  +N ++T     ++    K   +   +L++ A LD E   EY + ++A D G P +      +  V+I + D NDN+P+    FP P  ++S  E      +LI +   D DSG+NA++  S+ P   AP  F+ID     + ++++L  E Q  +   VI +D G  P  S++ +++ + D    SP
Sbjct:  129 IEDINDNAPL--FQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFS-----NQISPATKRHFAIDSSTGLITVKQPLDR-ESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSID--TRYIMNPVNGTVLLSENAPLNTK---IALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLN----TSAMVLIKIKDENDNAPV----FPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD--APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSP 569          

HSP 3 Score: 129.028 bits (323), Expect = 8.557e-30
Identity = 148/547 (27.06%), Postives = 241/547 (44.06%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINST---NGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVI-IVDVNDNLPT----FSMPATSFSIL--EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP----PFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPE--DPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL-----IALF-VEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQS 2233
            I D+NDN P F +    IS+ EN  +N+  P+  SA D D G  G   Y+  +    +++    I  T   +   +LI   + D   + ++   +   D G P  SS+  + + + DVND  P+     S  ++ + EN  +   +  +   D D G N Q + F   ++      +    D     +  K   DRE        +   D    S T S+   ++ + DVNDN+P+    + M   + ++L  E++P+ T +  +   D+D  LN ++  + +D     ++ P     FL+E+   L      +       +++ +V SD G+P L+    + I + D N+  PVF Q     ++PE  DP   L           I  +D D G NA +  ++  D  + F I   +G+L     LDRE++E+Y  T+IA D G+  +Q   TV     + + D NDNSP F       T   Y  YV   L     + L  V D D+G NA+V LSI           K G+I P  + DR++QS
Sbjct:  129 IEDINDNAPLFQSTVINISIPENTAINNRYPV-PSAFDPDVGINGIQHYE--LVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPV--FKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIH-FSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDG---SATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY-TDHDVPFRLKPVFNDQFLLETAAPLDYETTRE-------YAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI---------KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVK----LIVQDQNDNSPAF-------THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQS 638          

HSP 4 Score: 84.3445 bits (207), Expect = 5.179e-16
Identity = 96/371 (25.88%), Postives = 156/371 (42.05%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGN----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDG--TPDVQIRHTVTGSVVIFLNDLNDNSP---------------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIK---PGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I  +I D+NDN P F     + SI E++ I        A D D G+N   I H    +     F   +IE+  G+    L+V Q+LDR    + F + + V D G P  S+   + + + D+N+  PVF  S     VPE+        P   ++  +  +D D G NAQ+  +  + I+     H       G++     LDRE    +KL ++A DG  TP          +V++ + D+NDN P               +   N PL TK++           + V D+D+  N  V        P  + P F+   D+  ++    L  E    + + ++  D G+PP ++S  + I I D    +P
Sbjct:  125 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGING--IQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETK-DTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPEN-------APMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPS-------RATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIAL----------ITVTDRDADLNGKVTCYTDHDVPFRLKPVFN---DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAP 465          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 252.292 bits (643), Expect = 2.248e-69
Identity = 205/674 (30.42%), Postives = 330/674 (48.96%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS----LNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS---------DPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-----HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEI 2338
            D+NDNAP +    I +SI EN  I   + +P A D D      Q    +K  S  F L  + T +  ++P+L ++ ++DRET D   + I + D G+PP +   I+ + + DVNDN P F   +  +++ EN  + + +   + A D D G+  ++ +  S   + + KRHFAI+S+ G I + + LD +S     +  +V+A D    A  S  TVI+N+ DVND +P I     +N     + + EN  LN  I  ++V D D  +NG+  C+      F L  K   +D  + +  A   ++  +E +A   I   D G P L +S ++ + I D NDN P F  P    SI E++  GT + K+ A D D G N+ +IY +          DPR+             G L V++ LDR    E +S  V+  D+G   L + + + + + D N+  P F  + ++F VPE+    LPL      +G I V+D D G NA +TL+I +  + F I    G+++     DRE++  Y   + A+D      I+ T    V I + D+NDN P+F     + ++ L   V +       +  +F  D D+G NA +  SI  G     F+ID+   ++ L  K+ +  QG+H+L+V  KD G+P    SI +
Sbjct:  171 DINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSE-FGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSV-TQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNP--VHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRL--KPVFNDQFLLETAAPLDYETTRE-YAI-KIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRS-------------GILSVSKRLDR-EKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPEN----LPLY---GTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG---LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL---VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIAL 807          

HSP 2 Score: 132.109 bits (331), Expect = 8.213e-31
Identity = 136/465 (29.25%), Postives = 223/465 (47.96%), Query Frame = 2
Query: 1034 IVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING-QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPP----FLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDP----SDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN---KFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPT-KVSYKEY--VRHELIALFVEDKDSGANAVVDLSIKPGIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I D+ND  P+     ++ +I+I EN  +N      S  D D GING Q    +     F L   +        QL+ +   DRE +      I   D G P  +S+ ++ V + DVNDN P F       ++ E++P+GT VT++ A D D G N+Q+ +  S     NQ+ P     F I+S+  L+ V Q LDR     +  +IV+ SD    A  ++  + +N+ D+N+  P  +  T +   P +     S++ PL  K   I  I V+D D  +N ++T     ++    K   +   +L++ A LD E   EY + ++A D G P +      +  V+I + D NDN+P+    FP P  ++S  E      +LI +   D DSG+NA++  S+ P   AP  F+ID     + ++++L  E Q  +   VI +D G  P  S++ +++ + D    SP
Sbjct:  169 IEDINDNAPL--FQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFS-----NQISPATKRHFAIDSSTGLITVKQPLDR-ESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSID--TRYIMNPVNGTVLLSENAPLNTK---IALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLN----TSAMVLIKIKDENDNAPV----FPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD--APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSP 608          

HSP 3 Score: 130.568 bits (327), Expect = 2.405e-30
Identity = 146/543 (26.89%), Postives = 236/543 (43.46%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPT----FSMPATSFSIL--EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP----PFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPE--DPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL-----IALF-VEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQS 2233
            I D+NDN P F +    IS+ EN  +N+  P+  SA D D G  G   Y+   S ++           +   +LI   + D   + ++   +   D G P  SS+  + + + DVND  P+     S  ++ + EN  +   +  +   D D G N Q + F   ++      +    D     +  K   DRE        +   D    +  S   + V + DVNDN+P+    + M   + ++L  E++P+ T +  +   D+D  LN ++  + +D     ++ P     FL+E+   L      +       +++ +V SD G+P L+    + I + D N+  PVF Q     ++PE  DP   L           I  +D D G NA +  ++  D  + F I   +G+L     LDRE++E+Y  T+IA D G+  +Q   TV     + + D NDNSP F       T   Y  YV   L     + L  V D D+G NA+V LSI           K G+I P  + DR++QS
Sbjct:  169 IEDINDNAPLFQSTVINISIPENTAINNRYPVP-SAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPV--FKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIH-FSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY-TDHDVPFRLKPVFNDQFLLETAAPLDYETTRE-------YAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQL---------IKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVK----LIVQDQNDNSPAF-------THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQS 677          

HSP 4 Score: 84.3445 bits (207), Expect = 4.237e-16
Identity = 93/370 (25.14%), Postives = 155/370 (41.89%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDG--TPDVQIRHTVTGSVVIFLNDLNDNSP---------------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIK---PGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I  +I D+NDN P F     + SI E++ I        A D D G+N   I H    ++ ++     +    G+    L+V Q+LDR    + F + + V D G P  S+   + + + D+N+  PVF  S     VPE+        P   ++  +  +D D G NAQ+  +  + I+     H       G++     LDRE    +KL ++A DG  TP          +V++ + D+NDN P               +   N PL TK++           + V D+D+  N  V        P  + P F+   D+  ++    L  E    + + ++  D G+PP ++S  + I I D    +P
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGING--IQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETK-DTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPEN-------APMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPS-------RATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIAL----------ITVTDRDADLNGKVTCYTDHDVPFRLKPVFN---DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAP 504          

HSP 5 Score: 52.373 bits (124), Expect = 2.637e-6
Identity = 61/277 (22.02%), Postives = 123/277 (44.40%), Query Frame = 2
Query: 1676 IEITINLIDINNCPPVFNQSTFHFTVPEDPS--DHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKF-----QISHNGMLQSVAV---LDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAP----YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT-IDDSQP-------LSPKNMVHFNESKEKINKEMIVITI 2440
            ++I   + DIN+  P+F  +  + ++PE+ +  +  P VP        +  D D G+N      +  ++++F     +         + V   LDRE K+ + + +   DG        + T  + + ++D+NDN P+F ++  +   V     +   +  L   D D G+NA +  S     I+P    +F+ID     + + + L  E   +HKLIV+  D    P  +++ + +T ++D+ P       ++P N          +N ++ +IT+
Sbjct:  163 VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYP-VP--------SAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGG---NPPKSSTAILQVTVSDVNDNRPVF-KDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFS-NQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITV 425          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 253.062 bits (645), Expect = 3.640e-69
Identity = 205/674 (30.42%), Postives = 330/674 (48.96%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS----LNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS---------DPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-----HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEI 2338
            D+NDNAP +    I +SI EN  I   + +P A D D      Q    +K  S  F L  + T +  ++P+L ++ ++DRET D   + I + D G+PP +   I+ + + DVNDN P F   +  +++ EN  + + +   + A D D G+  ++ +  S   + + KRHFAI+S+ G I + + LD +S     +  +V+A D    A  S  TVI+N+ DVND +P I     +N     + + EN  LN  I  ++V D D  +NG+  C+      F L  K   +D  + +  A   ++  +E +A   I   D G P L +S ++ + I D NDN P F  P    SI E++  GT + K+ A D D G N+ +IY +          DPR+             G L V++ LDR    E +S  V+  D+G   L + + + + + D N+  P F  + ++F VPE+    LPL      +G I V+D D G NA +TL+I +  + F I    G+++     DRE++  Y   + A+D      I+ T    V I + D+NDN P+F     + ++ L   V +       +  +F  D D+G NA +  SI  G     F+ID+   ++ L  K+ +  QG+H+L+V  KD G+P    SI +
Sbjct:  171 DINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSE-FGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSV-TQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNP--VHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRL--KPVFNDQFLLETAAPLDYETTRE-YAI-KIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRS-------------GILSVSKRLDREKQ-EKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPEN----LPLY---GTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG---LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL---VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIAL 807          

HSP 2 Score: 133.265 bits (334), Expect = 4.148e-31
Identity = 136/465 (29.25%), Postives = 223/465 (47.96%), Query Frame = 2
Query: 1034 IVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING-QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPP----FLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDP----SDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN---KFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPT-KVSYKEY--VRHELIALFVEDKDSGANAVVDLSIKPGIIAP-YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I D+ND  P+     ++ +I+I EN  +N      S  D D GING Q    +     F L   +        QL+ +   DRE +      I   D G P  +S+ ++ V + DVNDN P F       ++ E++P+GT VT++ A D D G N+Q+ +  S     NQ+ P     F I+S+  L+ V Q LDR     +  +IV+ SD    A  ++  + +N+ D+N+  P  +  T +   P +     S++ PL  K   I  I V+D D  +N ++T     ++    K   +   +L++ A LD E   EY + ++A D G P +      +  V+I + D NDN+P+    FP P  ++S  E      +LI +   D DSG+NA++  S+ P   AP  F+ID     + ++++L  E Q  +   VI +D G  P  S++ +++ + D    SP
Sbjct:  169 IEDINDNAPL--FQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFS-----NQISPATKRHFAIDSSTGLITVKQPLDR-ESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSID--TRYIMNPVNGTVLLSENAPLNTK---IALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLN----TSAMVLIKIKDENDNAPV----FPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD--APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSP 608          

HSP 3 Score: 131.339 bits (329), Expect = 1.539e-30
Identity = 147/544 (27.02%), Postives = 238/544 (43.75%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVI-IVDVNDNLPT----FSMPATSFSIL--EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFP----PFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPE--DPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL-----IALF-VEDKDSGANAVVDLSI-----------KPGIIAPYFSIDRDRQS 2233
            I D+NDN P F +    IS+ EN  +N+  P+  SA D D G  G   Y+   S ++           +   +LI   + D   + ++   +   D G P  SS+  + + + DVND  P+     S  ++ + EN  +   +  +   D D G N Q + F   ++      +    D     +  K   DRE        +   D    S T S+   ++ + DVNDN+P+    + M   + ++L  E++P+ T +  +   D+D  LN ++  + +D     ++ P     FL+E+   L      +       +++ +V SD G+P L+    + I + D N+  PVF Q     ++PE  DP   L           I  +D D G NA +  ++  D  + F I   +G+L     LDRE++E+Y  T+IA D G+  +Q   TV     + + D NDNSP F       T   Y  YV   L     + L  V D D+G NA+V LSI           K G+I P  + DR++QS
Sbjct:  169 IEDINDNAPLFQSTVINISIPENTAINNRYPV-PSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPV--FKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIH-FSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDG---SATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY-TDHDVPFRLKPVFNDQFLLETAAPLDYETTRE-------YAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQL---------IKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVK----LIVQDQNDNSPAF-------THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQS 677          

HSP 4 Score: 84.3445 bits (207), Expect = 4.218e-16
Identity = 93/370 (25.14%), Postives = 155/370 (41.89%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH------NGMLQSVAVLDREEKEEYKLTLIAIDG--TPDVQIRHTVTGSVVIFLNDLNDNSP---------------IFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIK---PGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            I  +I D+NDN P F     + SI E++ I        A D D G+N   I H    ++ ++     +    G+    L+V Q+LDR    + F + + V D G P  S+   + + + D+N+  PVF  S     VPE+        P   ++  +  +D D G NAQ+  +  + I+     H       G++     LDRE    +KL ++A DG  TP          +V++ + D+NDN P               +   N PL TK++           + V D+D+  N  V        P  + P F+   D+  ++    L  E    + + ++  D G+PP ++S  + I I D    +P
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGING--IQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETK-DTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPEN-------APMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPS-------RATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIAL----------ITVTDRDADLNGKVTCYTDHDVPFRLKPVFN---DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAP 504          

HSP 5 Score: 52.373 bits (124), Expect = 2.777e-6
Identity = 61/277 (22.02%), Postives = 123/277 (44.40%), Query Frame = 2
Query: 1676 IEITINLIDINNCPPVFNQSTFHFTVPEDPS--DHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKF-----QISHNGMLQSVAV---LDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAP----YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT-IDDSQP-------LSPKNMVHFNESKEKINKEMIVITI 2440
            ++I   + DIN+  P+F  +  + ++PE+ +  +  P VP        +  D D G+N      +  ++++F     +         + V   LDRE K+ + + +   DG        + T  + + ++D+NDN P+F ++  +   V     +   +  L   D D G+NA +  S     I+P    +F+ID     + + + L  E   +HKLIV+  D    P  +++ + +T ++D+ P       ++P N          +N ++ +IT+
Sbjct:  163 VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYP-VP--------SAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGG---NPPKSSTAILQVTVSDVNDNRPVF-KDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFS-NQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITV 425          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:103034658])

HSP 1 Score: 252.677 bits (644), Expect = 4.531e-69
Identity = 227/774 (29.33%), Postives = 356/774 (45.99%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD----------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLI---IYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFP-------LPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQI---------TIDDSQPL----SPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                                 K+     + +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G P  + + I+ + I DVNDN P F    Y   L EN    + + + + A+D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP  +   T+IINI D ND +P I + K     L+D    + E+  ++ PI  V V D D+G NG   C ++G   F L     +   +    Y L      D E        I   D G PSL+S+  + V + D+NDN P F+      S  E++  G  V  V ALD D G N+++ Y +    + N +F   +   +G++ VN  LDR    E +   V+  D G P +     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA+++L I++    F I +N G + S    DRE+K  Y   + A+DG        + T +V +F+ D NDN P     FP       LP   + +  VR     +   D D+G NA +  SI  G     F ID D   + L  KL+ +H G+H+L+V   D G P +S++  + +         T+ D+Q      +P N     +    + K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  131 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSPRFEKSVYEADLPENSSPGAPI-LQLKAMDADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVSQL--RFTVMARDRGQPPKTDKATMIINIKDENDNVPNIDIRKIGRIYLRDGVANVAEDVVVDTPIALVQVSDRDKGPNGVVTCTVVGDVPFQLKPASEIEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDINDNPPIFTKSTVEVSFPENNAPGERVATVVALDADSGKNAEIFYSLDS--SVNGIF--SIDADSGDIRVNTILDR-EQTERYEFKVIAKDKGVPVMQGSATVVVLVADKNDNEPKFMQDVFTFYVKENLQPNSP-------VGMVTVMDSDKGQNAEMSLYIEEEEEIFSIENNTGTIFSTVAFDREQKTTYSFRVKAVDGG---DPPRSATATVSLFVMDENDNPPSV--TFPINSSYTLLPPSSNIRTVVR----TVIATDTDTGVNADLSYSIIGGNPFKLFEIDPDTGVISLVSKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHVYVNETLSNSTVVDAQIAKSLGTPLNADIAGDPNYDLGKQRLSIAIGVVSGIMTVILIILVVVMARYCRPKNK 879          

HSP 2 Score: 131.724 bits (330), Expect = 1.352e-30
Identity = 161/605 (26.61%), Postives = 265/605 (43.80%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYK--------------HSVSNTDSVKRHF-------------AINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVN-QHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA------LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+               + ++  S KR F               ++T+GE   +LI     D     SY   +   D G PA SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE+ +    T+   D G P  T    + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   IE + N      H    LD E    ++V++V  D G P+LS+   + + + DIN+ PP+F +ST   + PE+ +      P  R +  +   D D G NA++  ++  ++N  F I + +G ++   +LDRE+ E Y+  +IA D G P +Q   T    VV+ + D NDN P F ++        +  YV+  L        + V D D G NA  ++S+        FSI+ +  ++        E +  +   V   D G PP+S++  + + + D
Sbjct:  129 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSP--RFEKSVYEADLPENSSPGAPILQLKAMDADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREEVSQLRFTVMARDRGQPPKTDKATMIINIKDENDNVPNIDIRKIGRIYLRDGVANVAEDVVVDTPIALVQVSDRDKGPNGVVTCTVVG-DVPFQLKPASEIEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDINDNPPIFTKSTVEVSFPENNA------PGER-VATVVALDADSGKNAEIFYSLDSSVNGIFSIDADSGDIRVNTILDREQTERYEFKVIAKDKGVPVMQGSAT----VVVLVADKNDNEPKFMQDV-------FTFYVKENLQPNSPVGMVTVMDSDKGQNA--EMSLYIEEEEEIFSIENNTGTIFSTVAFDREQKTTYSFRVKAVDGGDPPRSATATVSLFVMD 704          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 248.825 bits (634), Expect = 1.553e-68
Identity = 204/719 (28.37%), Postives = 329/719 (45.76%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVD-------LDR----------------------------XXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDIT------IFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL----------AIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY-----KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D       +DR                             ++ ++       +S+ F+L    T D  + P+L +K  +DRE  D  ELV+ + D G+PP + + ++ + I DVNDN P F    Y   + EN    + + + V A D D G  G++ Y    + T+SV+R   ++  +G + ++  +D +  ++L   F V A D GQP  +   TVI+N+ D ND +P++ + K  + +       + EN  ++ P+  V V D DQG NG   C ++G   F L       +   + L      D E       TI   D G PSL+S+  + V +VD+ND+ PTF+         E++  G  V  V A D D G N+++ Y + DP + N  F  ++   NG++     LDR    E +   V+  D G P+L     + + + D N+  P F Q  F F V E+   + P       +G + V+D D+G NA+L L          A       F I +N G + S A  DRE +  Y   + A+DG    +   + T +V +F+ D NDN+P    +   P   SY         R  +  +   D D+G+NA +  ++  G     F I      + L   L+  H+G+H+L+V   D G P   ++  + + I++S
Sbjct:  138 DVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPV-LQVRASDRDIGVNGQVEYVFGAA-TESVRRLLRLDEASGWLSVLHRIDREEVSQL--RFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAGENRNKKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSL-DP-SVNGAF--YIDADNGDIRATGALDR-EQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSP-------VGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGG---EPPRSATATVSLFVTDENDNAP----SVTAPANESYTLLPPASGARTVVRTVMASDGDAGSNADLRYALVGGNPFQLFEIGPSSGVITLAEPLERRHRGLHRLVVRVNDSGVPSLCATALVHVFINES 833          

HSP 2 Score: 139.428 bits (350), Expect = 4.224e-33
Identity = 162/639 (25.35%), Postives = 268/639 (41.94%), Query Frame = 2
Query:  695 IQILDVNDNYPTFSTHKYIISLRENFQLNSL--LPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFA-----INSTNGEIR-------------------------------LIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPA--------TSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQ----HLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN-KFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA------LFVEDKDSGANAVVDLSI--------KPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            I + DVNDN P+F +    +S+ EN  + +L  LP   +A D D G  G   Y+    + D  +   A     IN+  G+ R                               LI     D     SY  V+   D G P  SS   + + I DVND  P     +++ +  + EN     P++ V   D D G+NGQ   ++ G     +     L +   + L   H+ DRE+ +    T+T  D G P  T    + + + D NDN+P   +           +  + E+  + T V  V+  D+D+G N  +   +           PF ++  G     +    H   LLD E    ++V +V  D G P+LS+   + + ++DIN+  P F QS       E+ +      P  R +  +A +D D G NA++  ++  ++N  F I + NG +++   LDRE++E Y+  +IA D G+P +Q     + +VV+ + D NDN+P F +         +  YV+  L+A      + V D D G NA + L +          G     FSI+ +  ++        E +  +   V   D G PP+S++  + + + D    +P      NES
Sbjct:  134 IVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSP--RFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVE-YVFGAATESVRRLLRLDEASGW-LSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGD-------VPFTLKPAGENRNKKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNA------PGERVVTVVA-ADADSGKNAEIAYSLDPSVNGAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQ----GSATVVVQVTDRNDNAPKFVQEV-------FTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANES 740          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 213.001 bits (541), Expect = 2.846e-57
Identity = 205/755 (27.15%), Postives = 346/755 (45.83%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLDRXXXXXXXXX---XXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-----HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKD----ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHK-GFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS-DPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVE-----DKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPK-----------------SSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKC---RKKA 2512
            D+NDNAP +  P+  +S+ ENA  G  F I PA D D      +            S F+L+   T +  + P L ++ S+DRE     E+ +   D GSPP +G  ++ I + D NDN P F   +  + + EN  + + + + + A D D+G+  ++ Y+         +    KR F ++  +G + +   L+ +      Y  +++A D G   + ++ TV + + DVND  P I +   +      I I E +++N P+  ++V D D G NG   C++   +  F L   + L+    Y L  +   D E +      I   D G  SL+ +  +T+ ++D NDN P F+ P    S+ E++ IG  +  V A D+D   N++++Y +  D  T   M P       G + + + LDR      +S  ++  D G P L     + +N++D+N+  P F+ + F F V E+       VPK   +G + V+D D+G N ++ L+I   DN   F I   +GM++S    DRE++  Y L + A DG   V+   + T  VVI + D+NDNSPI       P+  +YK  V   L    V      D D+  NA +   I  G     F ID    ++ L   L   H G+H+L+V   D G   +                 ++ IE  I      PL   ++  F   +++ NK +++  +   +  +AL   + +++ +C   R+K 
Sbjct:  145 DINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHV-VQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREE--SPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQL---KKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDP-----ETGIISLTEQLDREKKAN-YSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNEN-------VPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVR---SSTVKVVIHVMDINDNSPIV---LMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYIEWLIAGSLQTPLD-TDVAGFGRREQEDNKVLLLAAVLAGVLGVALIVLLGVLVHRCYCNRRKG 873          

HSP 2 Score: 110.153 bits (274), Expect = 8.054e-25
Identity = 164/599 (27.38%), Postives = 259/599 (43.24%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKR-HFAINST-NGE----IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDL-------LFK--QNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSM-----PATS-FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQM----FP-PFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDP--SDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYV-----RHELIALF-VEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            + I + D+NDN P F+     +S+ EN       PI   A D DS   G   Y+   S+  +V     ++  T NGE    + + KSLD +      Y   + A D G P  S S  + IN+ D ND  P+   +++  ++ I EN+ +   +V +   D D G N +    L    G          LF+  QN   + +  L+     +RE+       I   D G   + ++  +TV + DVNDN PT  +     P      I E S +   V  +   D D G N  +  +I +P    Q+    +P  +L+E+       + LD     E + V +  +D G  +LS  + +TI L+D N+  PVF + T+  +VPE+     HL  V         + +D D   NA++   +  D    F +    G++     LDRE+K  Y  T++A D G P ++   TV  +V+    D+NDN P F       +   +  YV     +H  + +  V D D G N  V LSI        FSID +   ++ N     E +  + L V   D G P +SS++++ I + D    SP
Sbjct:  139 VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQ-PANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREE--RQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPV--FDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLL-----NREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETR------ETLDYETKNE-YVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITV---------SATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVL----DVNDNRPRF-------SLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSP 700          

HSP 3 Score: 65.0846 bits (157), Expect = 7.426e-11
Identity = 58/232 (25.00%), Postives = 104/232 (44.83%), Query Frame = 2
Query: 1676 IEITINLIDINNCPPVFNQSTFHFTVPED--PSDHLPLVP------KPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLN--DLNDNSPIFHR---NFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAP--------YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRG 2308
            IE+ IN+ DIN+  P F       +VPE+       P+ P      +   +    +   D    +   L++ +  N  ++ +  + +S   LDREE++ Y++ L A+DG          +GS V+ +N  D NDNSP+F +   N  +P       +V    + L   D+D+G+NA V   +                F +D++   V +N  L  E   ++++I++  D+G
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKS---LDREERQLYEMNLRAVDGGSPPH-----SGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHV----VQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKG 356          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 2.390e-50
Identity = 166/599 (27.71%), Postives = 275/599 (45.91%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLL-PINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIY---QLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPA-LSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN--INKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +  + S+DRE     +L +   D G        I+TI + D  D  PTF+   Y   + EN    +L+  ++ S +D ++      +  + + + D  +  F+I  + G I    ++D +   +  Y   VVA+  G   ++   +V + + DVN+  P+   +++  +++I E+  +N     V   D D G NG+   + IG       F        I+   QL  +++ DRE       T++  D G+  L+SS  + V ++DVNDN P F+  +  F   E   +G++V  V+A D D G N  + Y    P+   ++       ++  +   + L R      FS  VV +D GRP  L ++  + + + D+N+ PP F +S +  +V E  S+   L+        +  SD D+GVN  L  AI +     KF + +  G +  +  LDREE   Y L + A D GT  +    TV   V+    D NDN P F  +  L         V   LI L   D+D+G +  V  +I  G     F+IDR   SV L R+L  E Q +++L V  +D GRPP+SS+  + + + D
Sbjct:  610 VSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNA------NVTYLIVSGDQ-RGSFSIEWSGGRIFTANAIDRE--EQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPV--FDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVK-YEIGEGNGGEKFG-------IFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLL-------RVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVL----DENDNPPRFTESL-LSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRD 1174          

HSP 2 Score: 182.57 bits (462), Expect = 6.182e-47
Identity = 160/616 (25.97%), Postives = 262/616 (42.53%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKG-FDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQST--FHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI-SHNGMLQSVAVLDREE------KEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            K+    S+DRE  +   LV+   D GSPPL     +T+ + D+NDN+P F   +Y  S+ EN +        V+A D D G  G + Y+ +  +       F +N+  G +    SLD +      Y   V A D G     S   V I + D  D  P  + +       +FEN      +  VS   LD   N  +       +G F + +          ++   +  DRE++AF    +     G+    S   ++V++ DVN++ P F   +   SI E  P+ +    VRA DKD G N ++ Y I +     +    F I  +G L V   LDR    E +S+ V   D G   LS+ + + + ++D+N+  P+FN S+  FHF   ++             +G +  +D D G N  +T + +     F++ S  G + S+ V DRE          +  +++A DG     ++   T  V +F+ D+NDN P F ++      VS       +L+ +   D D G N  +  +I  G     F++D     + L   L  E    + L+V   D G  P ++S  + + + D     P+    F ES
Sbjct:  505 KVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILEN-EPGGTAVTTVTATDPDRGANGTVRYQLTAGDA----ARFQVNAVTGAVSTRVSLDRE--ERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDD--YSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGG-------RIFTANAIDREEQAFYQLRVVANSGGVAGEAS---VSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK----FGIFPDGQLYVRYELDRETR-EEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSL---------VGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRAT--VQVFVQDVNDNPPQFAKSV-YQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPR----FTES 1080          

HSP 3 Score: 176.792 bits (447), Expect = 3.822e-45
Identity = 183/689 (26.56%), Postives = 303/689 (43.98%), Query Frame = 2
Query:  377 DLNDNAPHWPKP--IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTD--DEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIIS---LNKSLKDITIFENNNLNEPIVDVSVHDLDQ-GINGQFNCFLIG--HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIV-DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVV---VSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI-----NKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLP--TKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            D+NDNAP +P+P  +E++  E+A +G    +  AVD D    N    +  K  S   +   +P     +  F  L     +DRE N    L +   D GSP   G   + + + D NDN P F    Y  S+ E+       P+  +  D      G L+                 +   G +   + LD+++  +  Y+  + A D G P LS   T +I ++DVND  P I    L  + +  ++ E+         V+V D D    NG+ +  ++G   +G  +L    +  L + ++ +  + DRE+      TI   D G P   S+    V+ V DVND+ P F++ A + ++ E +P G+ V  V A+D D GLN++L Y I    + N +    + ES G +  +  +DR    E+ S +V+     D G    +    +T+ L+D+N+ PP+F Q+ +  T  E+    L +V        ++ +D D G N  +      ++       F++ S  G + ++  LDREE EEY L + A D G+P +      T  V + + DLNDN P+F   +P+     +   E     +  +   D D GAN  V   +  G  A  F ++    +V     L  E + +++L V   D G     S   + IT+ D+Q   P
Sbjct:   15 DVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRD-VGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDS------PVGAALRDLLHRGRGPLAVP--------------FDPKTGMVSTRQPLDFEARRQ--YTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVAS--QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIV---SGNDLGWFSVDESTGLVTTDGKVDR----EVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVV-------SVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLG----STAKVTVVVGDLNDNHPVF---YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAA-RFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPP 656          

HSP 4 Score: 167.548 bits (423), Expect = 2.427e-42
Identity = 171/675 (25.33%), Postives = 293/675 (43.41%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENF----QLNSLLPINVSAVDCDSGNFGKLSYKHSVS-NTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQF----------NCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGI---PSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS-----DPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLT--LAIKDNINKFQISHNGMLQSVAV---LDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE---LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKD 2302
            D+NDN P +  P +EL + EN   G +     A D D+ +        +      F +       +     L+    +DRE      L +  +D        +  +++ + D NDN P FS H Y   + E+     +    +   V A D DSG FG+++Y  + S ++D     F ++   G + + + LD +S     Y     A D G   L+++  + +N++D ND  P +  N SL    + E+      ++ +S  D D+G+N +             F +G+ G               QL      DRE+++F    +   D        L+S+  +++I+ DVNDN P F+ P ++ +  E SP+G VV  V+A+D D G NS + Y ++               PF + +  G + + + LDR    + +++ V+  D GRP L++   + + + D N+  P F +  +   + ED        P    +  ++  D D+G N +L   +A  D    F++  + +L ++AV   LDRE    Y+L + A DG    +   + T SV + L+D+ND SP F  +   P  V  +E  +     ++ +   D D G++  V  +   G     FS+  D   V L R L  E Q  H LI+   D
Sbjct: 1508 DVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVV-------DAASGVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRES--RACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQ-NDSLA-AEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDG---------------QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAP-EDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREAR-QSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDE-------PPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRL--DPVLGTLAVARPLDRERTASYELAVRARDGGGPAR---SDTASVRVTLSDVNDCSPAFQLS---PYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGH-VHLLRSLDREAQPQHVLIITATD 2133          

HSP 5 Score: 159.844 bits (403), Expect = 5.979e-40
Identity = 177/625 (28.32%), Postives = 283/625 (45.28%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSP-PLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFV--VVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING--QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF-SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTG--SVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQ---SVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT---IDDSQPL--SPKNMVHFNESKE 2407
            LK+ S +DRE      L IL +D+G P   +    + + + DVND+ P F+   Y  +L E     S +  +V+A+D DSG   KL Y   VS  D     F+++ + G +     +D     E++ S V  + A D G    ++ T++ + ++DVNDE P+ +  K +   T  EN+     +V VS  D D G NG  ++N        +  +F+    D +  ++      DRE+       +   D G P L S+  +TV++ D+NDN P F  P   F SILE+ P GT VT V A D D G N  + Y ++           F + +  G +     LDR  +  ++ + V   D G     +   +TI + D  + PP F +  + F V E+       V     +G ++ S  D   N    +   D    F I    G + +   +DREE+  Y+L ++A  G         V G  SV + ++D+N+++P+F R       ++  E V     ++   DKDSG N  V   I  G     F I  D Q     +L+R+ + E    + L V   D G  P SSS+ + +T   ++D++PL  S   + HF E +E
Sbjct:  292 LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVK-DVTAMDADSGLNAKLRYSI-VSGND--LGWFSVDESTGLVTTDGKVD----REVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVA--TAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRL---DSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR-----FQVNAVTGAVSTRVSLDR-EERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFEN-------VAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSG--------GVAGEASVSVLVHDVNNHAPVFDRA-SYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREE----YSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQE 876          

HSP 6 Score: 141.354 bits (355), Expect = 3.089e-34
Identity = 131/451 (29.05%), Postives = 205/451 (45.45%), Query Frame = 2
Query:  641 ILLTDSGSP-PLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQ-LNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG---HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF-SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPP---FLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHG------RPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-SHNGMLQSVAVLDRE 1936
            ++ TD G P PL     + + + DVNDN P F+   Y  S+ E+   L  LL   V+A D D G  G L Y  +  N       F ++++ G+I L+ SLD +     SY+ VV A D G   L++S TV + ++D ND  P     +SL  +   E+  + E ++ ++  D D G +G     ++    H  F +       D     +    + D E +      ++  D G P  +S+ ++ V + D NDN P F +P   F SI+E+ PIGT V  V A D D  +N +L Y I+      + FPP   F I+  +G +     +DR + G +F V V  +D        R AL N   +T+ + D N+  P F   T          D L        +G +  SD D+  NA +  A+   D    F++    G++++   LDRE
Sbjct:  941 VVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLL--RVTASDVDEGVNGALRYAINEGNEGG---KFTVDASTGQITLLGSLDRE--ETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPP--RFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAI-------DRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAF-LPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIA------RQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKN---VTVLVTDENDNAPRFVTPTAILV------DGL-RAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 7 Score: 134.806 bits (338), Expect = 3.480e-32
Identity = 127/479 (26.51%), Postives = 211/479 (44.05%), Query Frame = 2
Query:  995 QPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILE-HSPIG----TVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK--DNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP---------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            +P +SS   V I++ DVND  P+ ++ +   ++ + EN    E I  +S  D DQG N       L G +G  ++      D     L A  + DRE+ A    T+   D    +  +   ++V + D NDN P FS  A SF + E  +P G     V+  V A D D G   ++ Y ++    ++     F +    G L V + LDR      + +    +D G   L+    + +N++D N+  P     +    VPED        P   ++  I+ +D D+GVNA+L  +I   D   +F + ++G L     LDRE +  Y L +   D       R +    V + L D+NDN+P F    P          V   +  +   D DSG N+ V+ ++           G     F+++     V+L R+L  E +  + L V+  D+GRPP +S+  + +T+ D+   +P+
Sbjct: 1493 RPPMSSFNQVEISVEDVNDNPPVFAVPE--MELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVV------DAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRA-CYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPED-------APPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF--TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPR 1948          

HSP 8 Score: 102.834 bits (255), Expect = 2.543e-22
Identity = 168/690 (24.35%), Postives = 277/690 (40.14%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRE-TNDRIELVILLTDSGSPPLTGEGI---ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSG-NELSYSFVVVAHDHGQPALS-SSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSV-HDLDQGINGQ--FNCFLIG-HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGI-----PSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRN-IGYIAVSDCDKGVNAQLTLAIKDNINKFQISH-------NGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLN--DLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGR-PPK--SSSIEIQITIDD 2356
            D NDN P + P  +  SI EN  IGT      A D D     +      ++          P   E     +   + IDRE T    E+ +  TD   P  T       +T+ + D NDN P F T   I+         S++   + A D D      + Y  +V+  D+    F ++   G I     LD +SG    +   V V      P    +  T+I N +  N  LP    +     I + +   +  P   + + H LD    GQ  F   L+G  +G  ++   +    + + L A+  F      F+    +  D G      P ++S   + + + DVNDN P F++P     + E++  G V+  + A D D+G N+ + Y +      +     F+++ ++G L  ++ LDR  +     ++ V +  G  A   ++ + +   D N+  P F++  + F V ED +   P     R  IG +   D D G   ++T A+  + +              G L     LDRE +  Y L   A DG         +  +  +++N  D NDN+P    N  L  +V         L+ +   D D G NA ++ SI  G     F++  D Q + + R L  E Q  + L+V   DR R PP   SS++ + + + D
Sbjct: 1174 DFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGE-----ICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVG-TLQASDPDEAENAAVRY--AVTGGDAAI-LFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDYE-SPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMF----IVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV-----LSGSEGAFVVDAASGVLRASRRLDR--EERASYLLTVRASDGTHATDARLSVAVR--DANDNSPRFSRHAYSFDVAEDAA---PDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDG-------GGLAATARLYVNVLDANDNAPSVQ-NDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQ-LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTD 1828          

HSP 9 Score: 90.8929 bits (224), Expect = 1.138e-18
Identity = 148/616 (24.03%), Postives = 242/616 (39.29%), Query Frame = 2
Query:  593 LKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPA---LSSSTTVIINIVDVNDELP-IISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIV----DVNDNLPTF----------------SMPATSFSILEH----SPIGTVV--TKVRALDKDEGLNSQL--IYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALS--NQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHR---NFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPY----FSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRG 2308
            L   +D ET     L +   D G PP +   I+ + + D NDN P F       S+ EN  + + + I V+A D D+   G+L Y  S++       HF I+  +GEI     +D +    L +   V A D   P     S+   V + + D ND  P  ++    L D       ++   +  +   D D+  N      + G     +LF+ +    II       + DRE    A+T          +   +Q     I+      N  LP F                 MP +S+  L H     P G +V  T +  + +  G+ + L   + +S   T   MF          ++ +  L  L D    S I       RP +S  NQ+EI++   D+N+ PPVF        V E+  +          I  ++ +D D+G NA +T ++   +   F + + +G+L++   LDREE+  Y LT+ A DGT      H     + + + D NDNSP F R   +F +    +        +I  +   D DSG    V  ++ P   + +    F +     ++ + R L  E +  + L     D G
Sbjct: 1136 LARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRV-ITVTARDPDADVNGELHY--SIARQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSV---VGTLQASDPDEAENAAVRYAVTGGDAA-ILFRLDRRTGII---ETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDYESPINLLQGQTIPMP-SSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMF----------IVFSSLLSSLRDNGAGSFI-------RPPMSSFNQVEISVE--DVNDNPPVFAVPEMELEVEENTGEG-------EVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGT------HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG 1707          

HSP 10 Score: 75.8702 bits (185), Expect = 4.041e-14
Identity = 87/357 (24.37%), Postives = 152/357 (42.58%), Query Frame = 2
Query: 1355 ITVIIVDVNDNLPTFSMPAT-SFSILEHSPIGTVVTKVRALDKDEGLNS--QLIYHISDPRTTNQMFPPFLIESNG--NLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF--PLPTKVSYKEYVRHELIALF--VEDKDS-GANAVVDLSIKPGIIAPYFSIDR----DRQSVKLNRKLKSEHQGIHKLIVIGKDRGRP-PKSSSIEIQITIDDSQPLSPK 2377
            + V++ DVNDN P+F  P     +  E + +G  V    A+D+D G N      Y I       ++ PP  +      +L     LDR  +   +++ V   D G P    ++++ + + D N+ PP F +  +  +V ED     P+    R++ +            +  LA+  +         GM+ +   LD E + +Y L+L A D G P +  R T     VI L D+NDN P     +  P     S  E      +A    V D DS  AN  + +SI  G    +F +        + +K+  +L  E   ++ L ++  D G+P  +S++  + + ++D    +P+
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREAN-PSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDS----PVGAALRDLLH----------RGRGPLAVPFD------PKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRAT----AVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPR 340          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 5.657e-47
Identity = 206/811 (25.40%), Postives = 353/811 (43.53%), Query Frame = 2
Query:   92 RDSITLSVEERFPVNYFVTDLK--NILAI---PLNSSTRFNMLHVHSYFRLSS-SGIISVARQLDCDNDSNLCDKTLEYCMTKLFXXXXXXXXXXXXXXXX------------DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPK-----------------LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTF-STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISL----NKSLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPAT--------SFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPF-LIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVF---NQST---FHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL-----AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVR-----HELIALFV--EDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRG 2308
            + ++   V+E   V Y + DL+  N+L +   P         LH  S   ++  SG +SVA +LD +    LC +  + C +  F+    V         +            D+ND+AP +  P + +SISE+  +G    +P A+D D    + Q             L      +                       L+L+  +DRE     EL++   D G+P L+G  ++TI ++D NDN P F       + + E+ ++ + + + + A D D+G  G ++Y  H+   + + +    ++ T G + +  +   D      +  VVVA D GQ + S+S TV + + D ND  P+  +     + L D  + I EN     P+V +SV D D G +G  +  L    G +L     +     + L      D E+      ++   D G P L+    + + +VD+NDN P F  PA+          S+ E+ P GTVV  + A D D G N  + + +S+      +   F L    G L +   LDR      + + V   D G P    +  + + ++D N+  P F   + ST   + F V E+ S           +G ++ SD D+G NA++ L     A  D I     +  G+++++ VLDRE++ +Y+L++ A+D G P +    + +  V I ++D NDN+P+       P      ++VR       L+ + V   D D+G N      I  G     F ++ D  ++ L R + S  +G+H+L+V  +DRG
Sbjct:   26 QGALLYEVDEEVLVGYVIGDLRQSNLLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREA---LCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSV-VQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ----FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMR-YELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETS-------VGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPAL----SASCRVSITVSDTNDNAPVITS----PNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 123.25 bits (308), Expect = 7.639e-29
Identity = 154/625 (24.64%), Postives = 264/625 (42.24%), Query Frame = 2
Query:  686 IITIQIL--DVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRH-FAINST-------------------NGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGING----QFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFS--------MPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPP----FLIESNGNLLVNQHLDRLLD---GEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVF-NQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-------HNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL-IALFV-----EDKDSGANAVVDLSIKPGIIAPYFSIDRD------RQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            ++ +Q+L  D+ND+ P F      +S+ E+  +   +P+   A+D D+G      Y+ S ++ D ++   F++  +                      + L + LD ++    SY  ++   D G P LS S  + I +VD ND  P+  ++   + + I E++ +   +V +   D D G NG     F+  L        L     + L+  +     K DRE        +   D G  S ++S  +TV + D NDN P F         +P     I+E+ P GT V  +   D D G +  +   +  P T  ++  P    FL+++           RLLD    + ++V V+ +D G P LS  + + I+++DIN+  PVF N ++    V           P    +  +  +D D G N  +T  + +      ++         G L     LDRE++  Y+L++ A DG +P  + R  V  +V+    D NDN+P F       T   Y+ +V  E  +  +V      D D G NA V L++       +     D      R  V L+R+ + +++    L V   D GRP  S+S  + IT+ D+   +P
Sbjct:  127 LLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLP-RAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREA--VPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVF-VDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVR--NAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFP-TGAELASPNKVQFLLKTT----------RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVL----DENDNAPTFV-GVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYE----LSVRAVDSGRPALSASCRVSITVSDTNDNAP 725          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 1.832e-45
Identity = 199/728 (27.34%), Postives = 328/728 (45.05%), Query Frame = 2
Query:  383 NDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQF---PK---LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPI-NVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGE--IRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGIN-GQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITV--IIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFL--------IESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRP--ALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK--FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE--LIALFVEDKDSGANAVVDLSIKPGIIAPYFSID-RD---RQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT-IDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLA 2464
            NDN P +  P+  +S+ ENA +GT      A DLD                 +  +++  +DD  +F   P    + + +++D E   R  + ++  D G     G   + I +LDVNDN P F    Y+ + REN   NSL P+  V A D DS    +++Y  S+  T +   +F+I  + G   + L ++LDY+     + S  ++A D G P L+S+ T I+ + D ND  PI   N     I I EN      ++ V+  D DQ    GQ +                  D+    L+     DRE  +     +   D G  +   + + TV   ++DVNDN P +     + +I+E++P GT +  V A D D   N  L+Y I  P        PF         I + G  L  + L+ +    + S++V  +D G P    +    +T+ L D+N+  P F    +   V E        +P    +  +  +D D+G N  +T ++   + +  FQ+ +  G++ ++  LDRE    Y+L L+A D GTP   +  T T S+V+   D+NDN+P FH   P  + VS  E V  +  +I+L   D DSG NA +   I  G     FS+  RD   R  V L+R+ K+ +  + + I  G    R   ++++++ +  ++D++PL       F E   +++    V   A+I+ V A
Sbjct:   24 NDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLD--------------AGVFGQVSYHFSDDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGR--VRINLLDVNDNTPVFQRDSYVGTAREND--NSLTPVVRVRATDEDSPPNNQITY--SILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNS--YSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLL-----DREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPN-------PFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEG-------LPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTP--ALSSTTTLSLVVL--DVNDNAPTFH---PARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPL-------FLEGSYEVSVPENVTRGAIILQVQA 696          

HSP 2 Score: 159.844 bits (403), Expect = 7.935e-40
Identity = 157/580 (27.07%), Postives = 267/580 (46.03%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIIT--------IQILDVNDNYPTF-STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRHFAI--NSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVF----NQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-------KDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIF---------HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDR 2221
            ++  ++++DRE  D   L +L  D G  P     ++T        + + D NDN P F +    ++ +RE+    +LL + + A D D+G+ G +S + H+ + T    ++  I  N +   I  +   D+         F +VA D G P  S++  + + ++DVND +PI  L+     +++ E       +  V   D D G NGQ   F I   G D L     SD II ++      DRE  A     +   D G P L+ S ++ V++ DVND  P F  P  + S+LE   +G+ V  V+A +  +G N++  Y I+           F + +   L+ +  L  L   E F++  V +DHGRP L  Q  + + ++D+N+  PVF    N +  + T      + +P+V   R +  +AV D D+G N  +  +          +   F+I + +G++ +   LDRE +  Y L L+A D G P   + +  T  + + L+D++DN P+F         +++F +P        V +   A+   D D GANA+V   I  G     F++ R
Sbjct: 1784 EITTQAALDREATDSYMLTVLSRDGG--PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTV-LHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF-LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQV-TFRIESGGGDKL-SIGPSDGII-RVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKN-----AFTVHATSGLVTSTRL--LKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNIT------EVMPVV--IRIVEVLAV-DGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQP---VSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAV---DADVGANAIVYYFIAAGNEGNKFNLSR 2334          

HSP 3 Score: 152.91 bits (385), Expect = 1.031e-37
Identity = 163/628 (25.96%), Postives = 278/628 (44.27%), Query Frame = 2
Query:  377 DLNDNAPHWPKPIE--LSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAF-LPTDDEHQFPKLKL-KSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTF-STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMP--ATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYH-ISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGE---IFSVIVVVSDHGRPALSNQIE-ITINLIDINNCPPVF------NQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLT--LAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAI---DGTPDVQI-------RHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVV 2170
            D NDN+P +       + + E+A  GTL  +  A D D                +     + L   +E     + + K+    +T+  I   I+  D GSPP +    +++ +LDVNDN P F S   Y +S+ E     +L+  +V A D D+G  G+++++      D      +I  ++G IR+    + D     +Y+ +VVA D G P LS S  V + + DVNDE P  +    ++ +++ E+ ++   +  V   +  +G N ++   + G      + K   +      L+   +  +  E F  T +   D+G P L     + V ++DVND+ P F +P   T  +I E  P+   + +V A+D DEG N  + Y  +      ++ +  F I +   ++      R LD E   ++S+I++ SD G+P      + + + L DI++  PVF            F++PE    H P      N+      D D G NA +   +A  +  NKF +S  G+L  ++ LDRE    Y + + A    + TP V         +      V ++L D+ND  P+F  N      V+    V  EL+ L   D+D G N++V
Sbjct: 1831 DENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLV-ASVWATDADAGPNGQVTFRIESGGGDK----LSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERP--AFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAG------IGKNAFTVHATSGLVTSTRLLKSYERFNLTAV-ATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTA---RALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPE----HSPPGTAVGNVS--GAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVF-TNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIV 2434          

HSP 4 Score: 148.288 bits (373), Expect = 3.011e-36
Identity = 169/628 (26.91%), Postives = 279/628 (44.43%), Query Frame = 2
Query:  689 ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQ-PA--LSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTF-SMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIE--ITINLIDINNCPPVFNQSTFHFTVPED-PSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQISHNGMLQSVAV---LDREE--KEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGA--NAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPL 2524
            + I+I D NDN P F    Y + L E      +   NV+A D D G+  ++ Y     NT +    F I++  G +  +K+LD++    L Y  VV A D  + PA  L+S+ TV +++ DVND  P   L      I + E       I      D D G+NG+    +I G    + +      DL + + +   + DRE +AF   TI   D G P L S+  + V ++DV+DN P F ++PA + S+ E + +  +V++VRA D +EG N   +   S     N     +     G + VN+ LDR    E    + V  +   P+ + +    + + ++D N+  PVF+Q T+   +PE+ P+  +  V      G I  SD D GVNA L  ++    +  F I  +    S+A+   LDRE       +LT++  DG      R   T  + + + D+NDN+P F+        +     V   +I +   D+D G      V  SI  G     F ID     +     +  E +  + L+V+  D+  P  ++S E+++++              NE  EK++  +     A  +S  A+   + + +   + KA P L
Sbjct: 1158 VLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAAT---FGIDNGTGVLTAVKALDFEVSAGL-YLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF-LRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYV---ELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANA-SLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLN----GPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG-----RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASG-GNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQ-------------NELDEKLSFSLAAYQAA--LSEAAVPGTVVVRVAAPQMKAPPKL 1750          

HSP 5 Score: 138.272 bits (347), Expect = 3.717e-33
Identity = 160/608 (26.32%), Postives = 262/608 (43.09%), Query Frame = 2
Query:  677 GEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREK--EAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI--SHNGMLQSVAV-LDREEKEEYKLTLI-------AIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISV 2458
            G   + I +++ NDN P FS   Y +S+ EN  L + + + V A D D+G FG++SY  S    DS K  F+++  +G I +  +LD+++     ++  V+A D G     ++  V IN++DVND  P+   +  +   T  EN+N   P+V V   D D   N Q    ++    +   F   +S       +A+   D EK        TI   D G P L S+    V + D NDN P F   + S +I E+   G  V  V A D D+      +  I     + Q    F I + +G++     LDR  +   I  V  V    G    +    + I L+D+N+  P +    +  T+ E+        P   +I  ++ +D D   N  L  AI D  N F    + +G +++  + LDRE+        +       A  G+P    R T + +V + L D+NDN P F    P   +V         L  +   D D GAN  V  S+   +  P F +D     +    +L  E    ++L ++  DRG P  SS+  + + + D    +P     F+ ++  ++    V   +V+IS+
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSV-VQVLATDLDAGVFGQVSYHFS---DDSDK--FSLDPASGLISVAAALDFEATPR--FTVTVMARDGG--GQETAGRVRINLLDVNDNTPVFQRDSYVG--TARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLAR-ALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ----FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVEN-------TPGGTDIFTVSAADPDLNENGTLVYAI-DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSP--PRRATASATVTVLLQDVNDNEPSF-VGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPT----FHPARSAVSLMESVARDSVVISL 587          

HSP 6 Score: 126.716 bits (317), Expect = 1.374e-29
Identity = 155/620 (25.00%), Postives = 269/620 (43.39%), Query Frame = 2
Query:  215 SYFRLSSSG---IISVARQLDCDNDSNLCDKTLEYCMTKL-FXXXXXXXXXXXXXXXXDLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPT-DDEHQFPKLKLKSS-------IDRETNDRIELVILLTDSG--SPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIK-SLDYDSGNELSY----SFVVVAHDHGQPA--LSSSTTVIINIVDVNDELP-IISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG---HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEIT---INLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI----KDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAID 1975
            SYF ++ SG   ++++AR LD +    +   T+   +  L              + + D NDN+P + +    ++I EN   G       A D D++               Y  L+ + + +   QF ++  +S        +DRE   +  L++   D G  +   TG   + I +LDVNDN P +    Y +++ EN    + +   VSA D D    G L Y       D     + IN+ +G+IR     LD +  N +S+    S VV   D G P    ++S TV + + DVND  P  + L  +L+   + E    N  +  V+  D D+G NG     +        F L     L   ++       + DRE  A     +   D G P+L+S+  ++++++DVNDN PTF    ++ S++E     +VV  +   D D GLN++L + I+      Q    F    +G +     LDR      +S+++   D+G PA S +   T   + ++D+N+  P+F + ++  +VPE+       V +   I  +  +D D+G+N ++   I    +D      +S   + +    LDRE    + L + A +
Sbjct:  178 SYFSITVSGGYGVVTLARALDYEK---IPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQS-------------PEYGQLSLIYSLEGSTQF-RINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDI-FTVSAADPDLNENGTLVYA-----IDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQ---VLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLV-------QLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGF---RDGLVRTVVSLDRETKAS-YSLVIEAIDNG-PAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPEN-------VTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFN 752          

HSP 7 Score: 118.242 bits (295), Expect = 4.312e-27
Identity = 154/625 (24.64%), Postives = 264/625 (42.24%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAH-DHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNN-------LNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSP-IGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI------KDNINKFQISHN--------GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIR---HTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLS--IKPGIIAP--YFSIDRDRQSVKLNRKLKSEH-QGIHKLI---VIGKDRGRPPKSSSIEIQITIDD 2356
            +++    +DRET     L I+  D G+PPL     + +++LDV+DN P F       SL E   + +++   V A D + G       +HS ++  + +R F  +S  G + + + LD +   E   +  V  + D+   A   S  +I+ I+D ND  P+ S  +   +  I EN+        LN PI      D D G+N      L+G      L  ++  ++    +      DRE        +T          ++  + V ++DVNDN PTF++ + +  +LE+SP +GT V  V+A+D+D G+        S     N  F   + ES G ++    +D     E + ++VV +D   P  +   E+ ++L +  +    F+ + +   + E        VP    +  +A           L LAI      +D  +K Q S N        G + + A LDRE  + Y LT+++ DG P   I    +     V + + D NDNSP F        +V         L  L   D+D+G+N  V        G   P  Y  I ++   V +    K++  +   + I   ++  D G PP+S++  + + + D
Sbjct: 1340 RVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVS-RVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFS--QVTYEAEIPENSPNGTVLTVLNGPIY---ASDADFGVNATLAYSLLGGSSAYFLIDRDRGNV---SMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTF--GIDESTGLIVTVAPIDYETRPE-YLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSE------AAVPGTVVV-RVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLD 1945          

HSP 8 Score: 85.1149 bits (209), Expect = 6.076e-17
Identity = 86/323 (26.63%), Postives = 152/323 (47.06%), Query Frame = 2
Query:  623 DRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTF--STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK--HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTT---VIINIVDVNDELPII--SLNKSLKDITIFENNNLNEPIVDVS-VHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDY---GIPSLTSS-----------QLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI 1516
            +R  L  + TD G PPL G+  + +++LDVND+ P F    +  ++++ E   +  +  + V AVD D G  G + Y   H+          F IN+T+G I   ++LD +S  +  YS +++A D GQP    ST    V+++ +D N+ + I+        +  +I E++     + +VS   D D G N     F+  G++G     K NLS   +  L+     DRE   + Y  I          P++T+            + + V + D+ND  P F+    +  +   + +G+ + ++ A+D+D G NS ++Y I
Sbjct: 2126 ERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPV-VIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRES--QAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGN----KFNLSRWGL--LVVLSDLDREVSPY-YAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 9 Score: 71.633 bits (174), Expect = 7.904e-13
Identity = 164/707 (23.20%), Postives = 272/707 (38.47%), Query Frame = 2
Query:  605 IDRETNDRIELVILLTDSGSPPLTGEG---IITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPI---NVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLI--KSLDYDS--GNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENN-NLNEPIVDVSVHDLDQGI-NGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI------SDPRTTNQMF--PPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRP-----ALSNQ--IEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK---------FQISHNGMLQSVAVLDREEKEEYKL--TLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEY-VRHELIA-LFVEDKDSGANAVVDLSIKPG-----IIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEISDM 2587
            +DRE      L + + D+   P        I+ + ILD NDN P FS   Y   + EN    ++L +    + A D D G    L+Y    S       +F I+   G + +   + LD +   G  L  + +V   D G+   +++  + + ++DVND  P  + N + +   + EN+  +   ++ V   D D G+ +     + I   G D       + LI+         D E        +   D   P  T+S  + V + +  D   +FS+ A   ++ E +  GTVV +V A          L   I       D R   Q       +    G +     LDR  +     ++ V+S  G P      L+N+    + +N+ D N+  P F   +       + +    L      +  +  +D D G N  ++     +             Q      +  VA  D  EK    +   ++A+DG +P    R T     VI L D+NDN PIF    P    VS  E      L+A ++  D D+G N  V   I+ G      I P   I R      ++R    E +  + L+V+  DRG PP S S  +++ +DD     P  +               V T++V+ S L++GSF+  V      K       Y++  + K A ++   S +
Sbjct: 1455 LDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAY----SLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILV--QDGGR--RNATVRLGVTVLDVNDNTP--TFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIV----TVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDR--EATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTL------LTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPP---RSTTFNLSVIVL-DVNDNVPIFLS--PGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDR----ETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAP-------------VQTVSVLES-LSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGL 2115          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 3.448e-44
Identity = 172/607 (28.34%), Postives = 278/607 (45.80%), Query Frame = 2
Query:  656 SGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHG-QPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG--HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKD-NI-NKFQISHN-GMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLS-IKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK--NMVHFNESKEKINKEMIVITIAV 2446
            +G P LTG G +T+ + D NDN P F   +   ++ E+  + S + + V+A D D+G    +SY+  +   D    HF++N + G+I    SLD + G E SY   V A D G  P LSSS T+++ + DVND  P   LN          +      +  V+  D D G NG     L G    GF +  ++ +       + A       ++     T+   D G P  ++   +TV   D  +  P F+    SFS  E  P GT +T V A  +       + YH++       +F   +   +G + V++ LD       + ++V   D G P  S  +++ ++++DIN+  P F+ S F   VPE+          PR I  +   D D G+N Q+  +I D NI N F+++ N G ++SV+ LDRE    Y+LT+ A D G+P    +H  T  V+I + D NDNSP F + F     V     V   ++ +   D D G NA +  S + P +    FSI      + ++R+L  E +  + + V   D   P  + S ++ I +DD    +P+     ++ E  E    E +V  ++ 
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVAL-VNATDADAGLNAIISYR--LRGGDG---HFSVNPSTGQIITTASLDRE-GRE-SYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF-LNAPYVAYAP-SSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGV-------IHAARALQGPRDDLTL-TVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVF--AVDPQSGEVSVHRALDHEYQ-HHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPEN--------TPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSP---TQH-CTVKVLISVTDENDNSPRFTQIF--SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP---FSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSA 563          

HSP 2 Score: 164.851 bits (416), Expect = 2.272e-41
Identity = 159/616 (25.81%), Postives = 266/616 (43.18%), Query Frame = 2
Query:  575 QFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMF------------PPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKS--SSIEIQIT-IDDSQPL 2368
            Q  ++ +  ++D E     ELV+   DSG PP +    + + +LD+NDN P FS+ ++   + EN    ++  + ++AVD DSG  G++ Y     N  +V   F +N  +GEIR + +LD +  N  SY   V A D G P    +  V+I++ D ND  P  +    +    + E+  +  P++ VS  D D+G N      L+      L F  + S     ++    + +RE  +     +   D   P+ T S  +T+++ DVNDN P F   A      E S    +V +V A D D+G N Q+ + +   R+  + F             P             +L++      +S +V   D GRP LS+   +TIN++  N   P F +  +   V          V     I  ++  D D+ VN Q+  ++   +   +F +   G L   A L  +    + +T+ A D G P +  R T     +I + + N  +P F  + PL   +         L  +   D D+G N  +  SI  G  +  F I R    V L  +L  E + ++ L V   D G   K+  S + I +T ++D+ P+
Sbjct:  284 QSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTI--VVLTAVDKDSGINGQVDYSIIDGNIGNV---FRVNPNSGEIRSVSTLDRE--NVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT---QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS---LPFSIHPS---TGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFM---RSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNK------YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPV-------AATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRAT----AIISVTEENQYAPRFA-HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPM 859          

HSP 3 Score: 153.295 bits (386), Expect = 8.541e-38
Identity = 150/588 (25.51%), Postives = 261/588 (44.39%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDY------DSGNELS-YSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGH---KGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI--SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRG 2308
            ++ +   ++RE      + +  +D   P  T    +TI + DVNDN P F    Y I   E  +  +L+   VSA D D G  G++ +        S   +F +   +GEI  ++ L Y       SG  L+ YSFVV A D G+P LSS  TV INIV  N   P     +      +         I+D+S  D D+ +NGQ    ++G    + FD+       D   + L  +     +  +    T+   D G P L+S     + + + N   P F+ P    S+ E+ P G+ + +V A D D G+N  ++Y I+    +  +F   +  ++G++L+   LD   + +++++ V  +D G  A +    ++I++ D+N+ PP+ N S ++  +PE+        P    +  +   D D   NA    ++ D      +     G+L +   LD E K+ Y+LT+ A +  PD    H  T  V + +  +N+  P F  R +     VS    V   + ++F  D+D+G +  V   +     +  FS++     + ++ +L  E +    L VI K+ G
Sbjct:  493 EITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALV-ARVSASDADDGANGQVFFFMR-----SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAP--RFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV-------DAGGF-LHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSG-LFD--ISRASGDVLLVGELDYETE-KLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPEN-------APSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFN-YPDTF--HYSTAQVHVQITGVNEYFPRFVQREYNF--VVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAG 1045          

HSP 4 Score: 135.961 bits (341), Expect = 1.932e-32
Identity = 152/607 (25.04%), Postives = 249/607 (41.02%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSG-SPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIY-----QLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRN-----FPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLK-----SEHQGI----HKLIVIGKDRGRPPKSSSIEIQITI 2350
            +S+DRE  +   L +   D G +P L+    + + + DVND+ P F    Y+     +    + +   V+A D D+G  G L +    S + S    F+++   G I   ++L    G     +  V   D G P  S+ TTV +   D   E P  +     +  +  E+      I  V+     +           G   + L    NL D+        ++      D E +      +   D G P  ++   + V ++D+NDN P FS       + E++P  T+V  + A+DKD G+N Q+ Y I D    N     F +  N G +     LDR  +   + + V  +D G P     +++ I++ D N+  P F Q  F   V ED +   P++        ++  D D+G NA +T ++ D    F I    G +     L+RE++  Y + + A D         TV+  V I ++D+NDN+P F +      FP P++          L+A +   D D GAN  V   ++       F + RD   +   R L+         G     +  +V   DRGRPP SS   + I I
Sbjct:   85 ASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAV-FAVTARDADAGPNGDLRF----SLSGSASAGFSVDPRRGVIHAARALQ---GPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAG-EFPRFAPGP--RSFSFREDQPPGTTITVVAARSSRR----------AGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNV----FRVNPNSGEIRSVSTLDR-ENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVL-------RVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPA------WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSE-------GEALVARVSASDADDGANGQVFFFMR--SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINI 641          

HSP 5 Score: 132.109 bits (331), Expect = 2.472e-31
Identity = 156/613 (25.45%), Postives = 267/613 (43.56%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLN----------KSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI-SDPRTTNQMFPPFLI-ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHG--RPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDK--GVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKD----SGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            L L++S+  +      + +   D G PPL+      I + + N   P F+     +SL EN    S L   V+A D D+G  G + Y  S+++ D     F I+  +G++ L+  LDY++  E  Y+  V A D G  A +  + V I++ DVND  P+++ +           S   + + +  + + P   V+++ LD   +G+ + F++  K   +L  Q   D   Y+   K  ++    AF Y              S+  + V I  VN+  P F     +F + E +P+G  V  V A D+D G++  + Y +  + R+       F + E  G ++V+  LDR  +    ++ V+  + G  R    +++ + + + D N+ PPVF+ + +H  V E  S    +V        ++  D D   G      L    N  + F I +H G++   + LDRE    Y LT++A+D G P      T T  VV+ L D+NDN P          KV+  +     ++ L   D D     G      L   P     YFS+      +K  R +  E +    L V   D G PP +S++ + +++ D
Sbjct:  707 LHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSL-ARVTATDTDAGVNGAIVY--SIASGDGSGL-FDISRASGDVLLVGELDYET--EKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLD---DGEADLFVLNQK-TGVLTTQGFLD---YET--KQTYELTVRAFNYPDTF--------HYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-----FSVNEHTGEIIVSSQLDREREASA-TLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVV-------GVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPA----TGTTVVVVALEDVNDNGPFL---LTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRG-YFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLD 1273          

HSP 6 Score: 125.176 bits (313), Expect = 4.092e-29
Identity = 134/589 (22.75%), Postives = 246/589 (41.77%), Query Frame = 2
Query:  623 DRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLL-FKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQL--TLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVI--FLNDLND----NSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANA-VVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            ++   V+   D G PPL+ +  +TI I+  N N P F   +Y   +    +  + + +++SAVD D    G+++Y     N     R F +++  G + L  SL  D+G+   +S  V A D G+P LSS  T II++ + N   P  +      ++++ EN+     +  V+  D D G+NG     +    G  L    +   D+++       + D E E     ++   D G  + T    +++ + DVNDN P  +       I E++P GT V  + A+D D   N+  +Y + D          F++     +L  Q        + + + V   ++      +  ++ + +  +N   P F Q  ++F V E         P    +G +  +D D G++  +   L  +     F ++ H G +   + LDRE +    L +IA +      IR      V++   + D ND    +S ++H       +VS    V   ++ +   D DS          I+ G     FSI+     + +   L  E   ++ L V+  D G PP + +  + + ++D
Sbjct:  615 NKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRI-LDMSAVDPDRDVNGQIAYSVVGGN---ASRRFDVDA-GGFLHLRASLAGDAGS--IFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFA--HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVG-----ELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL-----FVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSES-------APVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAG---SIRGFDVDEVLVNVAITDANDPPVFSSALYH------GRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALED 1168          

HSP 7 Score: 98.2117 bits (243), Expect = 7.019e-21
Identity = 97/385 (25.19%), Postives = 168/385 (43.64%), Query Frame = 2
Query: 1325 GIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDG-EIFSVIVVVSDHG-RPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQIS-HNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGI-IAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESK--EKINKEMIVITIAVIISV 2458
            G P LT +  +TV++ D NDNLP F       ++ E +PIG+ V  V A D D GLN+ + Y +   R  +  F   +  S G ++    LDR  +G E + + V   D G  P LS+   + + + D+N+  P F  + +    P          P    +  +   D D G N  L  ++  + +  F +    G++ +   L +  +++  LT+   DG      R  VT +V +   D  +    F R  P P   S++E          V  + S     V   +  G  +   F++D     V ++R L  E+Q  ++L+V  +D G PP S+ +++++ + D       N   F+ S+   K+ +     TI V+ +V
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL---RGGDGHF--SVNPSTGQIITTASLDR--EGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSS-------APAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDG--GAPPRSAVT-TVTVRFRDAGE----FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDIN----DNAPEFSSSRFWAKVPENTPPRTIVVLTAV 360          

HSP 8 Score: 88.9669 bits (219), Expect = 3.897e-18
Identity = 120/461 (26.03%), Postives = 192/461 (41.65%), Query Frame = 2
Query:  377 DLNDNAP------HWPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPIN-VSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIIN--IVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNS-----QLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCP 1717
            D+NDN P      ++P      I ENA  GT   +  AVD D       +      ++  F L         +   L  +  +D ET    EL +   +           + +QI  VN+ +P F   +Y   + E+  + +  P+  V A D D+G  G + Y   +   +S  + F++N   GEI +   LD +   E S +  V+A + G         V++N  I D ND  P+ S   +L    + E  ++   +V VS HD D     +   FLI        F  N    +I   +     DRE       T+   D G P  T + ++ V + DVNDN P   +  +S  + E+ P G  V  + A D D   N      QL+   SDP         F + S+G L   + +DR    E F + V ++D G P L++ + + ++++D N+ P
Sbjct:  852 DVNDNPPMLNASDYYPV-----IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVL-------NQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGA--PVGSVFATDRDAGIDGTVFY---MLFGESRSKGFSVNEHTGEIIVSSQLDRE--REASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFS--SALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLI---VVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPF--LLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLG--SDPAWRGY----FSLSSSGLLKTARPIDREQKPE-FHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          

HSP 9 Score: 62.003 bits (149), Expect = 7.038e-10
Identity = 62/234 (26.50%), Postives = 106/234 (45.30%), Query Frame = 2
Query:  593 LKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCD-SGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEP-----IVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFD 1276
            + S +DRE+     L ++  D G PP TG  ++ + + DVNDN P   T    ++  EN Q   +  +N+ A D D   N G  +++  +  +D   R +   S++G ++  + +D +   E  +   V   D G P L+S+ T+ ++++D ND           +D+ +   N    P     I DV   D D  I+ +FNC L         F+ N   LI     A+ +F+
Sbjct: 1130 VASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVT--EN-QPAGMTVLNLEAGDPDLPPNKGPYTFQ--LLGSDPAWRGYFSLSSSGLLKTARPIDREQKPE--FHLPVAIADAGSPPLTSTVTLHLSVLDQNDN------PSEARDVRV-HVNYFGSPFPGGFIGDVRPRDPD--ISDRFNCDLTSGPFNVFSFQPNTCRLISQPRSAEGRFE 1347          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 220.32 bits (560), Expect = 1.074e-58
Identity = 184/611 (30.11%), Postives = 294/611 (48.12%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGI---ITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRH------ELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            + +   +DRET     LV+  T++GS    GE +    TI++LDVNDN P F+   Y  SL EN  +   +   V+A D D G   K++Y+ SV +T      F +N   G +   + LD +  ++ SYS  V A DHG+P+ S+   + + I D+ND  P  S +K    +T+ EN      I+ V   D D G NG+    +I G+ G           + +  ++     DRE  A    TI+  D G+P   S+  + + + D NDN P F+   TS+ I E   IG+ V  V A D+DEG N+Q+ Y I    T+      F I + NG L V + ++R      +++ +  SD G P +++  E+T+ + D+N+ PPVFN  ++  +V E+ +    ++        +A  D D G NA L  +I   ++  +F+I S +G++ +   LD EEK +Y L + A D       ++T   +V I + +LND +P F       T+ +Y   VR        ++ +   D+DS  +  +  SI  G  +  FSID+    +     L  E   ++ + V   D G PP S+   + I I D    SPK
Sbjct: 1051 ISVAKRLDRETTANYTLVVRATETGSQ---GESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVA-KVTATDRDEGENAKVTYELSVGDT----SKFEVNPATGLVTTKRPLDRE--DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYT--LTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVV-----DREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS-----AFAINAMNGVLTVKKEINRET-VPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLT-------VAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS------KYTAKTNVTIRVINLNDITPAF-------TQQNYTASVRENSPTSTSVVKVSASDRDSFGS--LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPK 1616          

HSP 2 Score: 207.223 bits (526), Expect = 1.435e-54
Identity = 188/624 (30.13%), Postives = 293/624 (46.96%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIA------LFVEDKDSGANAVVDLSIKPGIIAPYFSIDR 2221
            D+NDNAP +   + +  + E+  +G++     AVDLD     +     +   +SYF      T D      ++ K + DRET    ++ +   D GSP  +G+  + I+ILDVNDN P FS+ +Y  S+ E+  + + + + V+A D D+GN   L Y  +  NT+     F +++  G + + +SLD++     SY+  +   D G P L+ ++ ++IN+ D+ND  P+ S   S     + EN         VS  D D   NG    F I     D +F  + S  II   +AK   D E +     T+   D G+P    +  +T+ I DVND+ P FS    S  I E + IG+ V  V A D D G   +L Y +     +  +   F I++N G++ V+  LDR      +S+ V   D G  + S+   +TI L DIN+  P+F Q  + F V E  S           IG +A +D D   N  +  A+ DN + F I +  G++     LD E+K +Y +T+ A DG    +   TV   V + ++D+NDN P F ++        Y   V   L A      +   D DSGAN  +  SI  G     F++DR
Sbjct:  160 DVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYF------TVDSQGV--IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAM-VTVTASDKDNGNNADLRYSFTSGNTN---HAFTLDAVTGVVTVSRSLDFE--QRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS--PSAYQSRVKENTPAG---TQVSATDRDSSTNGAL-VFGIIKGNDDGVFTIDGSTGIIS--IAKSP-DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL----ISGNVKGAFNIDANSGSIRVSSELDRETTPS-YSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSS-------PGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTV---VKVMVDDVNDNPPQFAKSL-------YTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDR 737          

HSP 3 Score: 187.963 bits (476), Expect = 1.810e-48
Identity = 217/760 (28.55%), Postives = 338/760 (44.47%), Query Frame = 2
Query:  206 HVHSYFRL-SSSGIISVARQLDCDNDSNLCDKTLEYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKL---KSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI---KDNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNF--------PLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT---IDDSQPL----SPKNMVHFNESKE 2407
            +  S F++  SSG+ISVA++LD +  +N    TL    T+        +     I + D+NDNAP + P     S+ EN  IG       A D D  +  K         +S F++           P   L   K  +DRE      L +   D G P  +    IT+ I D+NDN P FS  KY +++ EN    S + + V A D D+G  G+++Y     N  +    F I+ST G I ++  +D ++    SY+  + A D G P   S+  V I + D ND  PI + N++     I E  ++   +  V+  D D+G N Q    ++  +G    F  N  + +   L  K + +RE       TI   D G P +TS + +TV++ DVNDN P F+  +   S+ E+S   T V  V A D D G N+ L Y I       +    F I S +G ++    LD   +   + + V  +D    A +N   +TI +I++N+  P F Q  +  +V E+          P +   + VS  D+     L+ +I   KD+ +KF I   +G++ +  VLDRE    Y + +   D G P +     VT    I + D NDNSP F  +           P+  S+K         L   D D G NA +  ++        F I      + L + L  E++  + L +  +D G PP++SSI I++T   I+D +PL    S +  V  N+ KE
Sbjct: 1037 NAGSSFKIDQSSGLISVAKRLDRETTANY---TLVVRATET-GSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVN----------PATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNI-LRVLASDPDAGANGRVTYSIISGNHGNA---FRIDSTTGRITVVGVVDREA--LASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNET--SYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV--RGDTSAFAINAMNGV---LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR----FKINSTSGVIMTTTPLD-FEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNYTASVREN---------SPTSTSVVKVSASDRDSFGSLSYSIVGGKDS-DKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVT----IKILDENDNSPKFDSSSYSSSILENSAPSSFSFK---------LAATDADEGTNARITYNLSRN---DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKE 1735          

HSP 4 Score: 187.193 bits (474), Expect = 2.924e-48
Identity = 208/807 (25.77%), Postives = 364/807 (45.11%), Query Frame = 2
Query:  179 NSSTRFNMLHVHSYFRL-SSSGIISVARQLDCDNDSNLCDKTLEYCMT---KLFXXXXXXXXXXXXXXXXDLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLI-ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLT--LAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSM 2569
            N   R+ +      F + +S+G+I++  QLD +       K  +Y +T   K     +   + V+ ++++D+NDN P + K +   ++ EN   G       A D D               S   ++AF     +    ++  +  +DRET     L I   D           + I I D NDN PTF T     ++ E+    + +   ++A D D G  G ++Y     N       F ++  +G + +  +LD ++    SY+ VV A D G P  S + ++ ++++DVND  P     KSL    I E+ +++  ++ V V D D+G NG     L G +G D     N +      +++K   D E  A    T+T  D G PS +++  + + I++VNDN+P+F  PA   SI E   I T V K+ A D D    + L + I +          F I +S+G + V + LDR      ++++V  ++ G    S     TI ++D+N+  PVFN  ++  ++ E+       +P  + +  +  +D D+G NA++T  L++ D  +KF+++   G++ +   LDRE++  Y L + A+D G P      +   ++ + +NDLNDNSP F ++    T V+        ++ +   D D+GAN  V  SI  G     F ID     + +   +  E    + L +  KD G PP  S+  + IT+ D    SP  +   NE+   I++             +++GS + +V    R +     + Y +   D  A ++
Sbjct:  614 NGDVRYALSDNTDVFSINTSTGLITLKTQLDYE-------KKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDAD---SGANGKISYSILSGNENMAFAM---DRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVG-QLTATDRDIGPNGAVTYAIISGNQ---GNSFQLDPRSGILSVRSTLDRET--IPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAP--RFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSG-EGSD-----NFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVE----GNAGSSFKIDQSSGLISVAKRLDRETTAN-YTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHEN-------LPIGQTVAKVTATDRDEGENAKVTYELSVGD-TSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKP----SQSAVAAITLTINDLNDNSPQFSQSKYTLT-VTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP--IFASNETSYGIDEG------------VSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAI 1357          

HSP 5 Score: 182.185 bits (461), Expect = 1.260e-46
Identity = 169/595 (28.40%), Postives = 276/595 (46.39%), Query Frame = 2
Query:  608 DRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLA-IKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFH-RNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            DRE+  R  L +L  D+ +    G  ++ I + D NDN P F  + Y+ ++REN     +    V+A D DSG    ++Y        S +  F +NS  GEIR +  LD+++ +  SY+  + A D            +I + DVND  P  +L  S+    ++E+  +   +  ++  DLD GIN + +  L+ G   +  +  Q +       +  K  FDRE +A     +   D G PS +    + + I+DVNDN P FS    + S+ E   IG  +  V A DKD G N+ L Y  +    TN  F   L    G + V++ LD       +++ + V+D G P L++   + IN+ DIN+ PPVF+ S +   V E    + P   +      ++ +D D   N  L    IK N +  F I    G++      D E K  Y LT+ A D G P   +++  T  V IF+ D+ND+SP+F   N+    ++     +   ++ +   D DSG    ++  +  G +   F+ID +  S++++ +L  E    + L V  +D G   +SSS  + I + D    SP
Sbjct:   29 DRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI--VTATDRDSGTNAAITYSLF-----SGENKFMMNSKTGEIRTVTPLDHETKD--SYTMRISAFDGKHTTF----VPLITVDDVNDNAPFFAL--SVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV-------IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGN-TNHAFT--LDAVTGVVTVSRSLD-FEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKE----NTPAGTQ------VSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVP---VKYD-TAQVTIFIEDVNDHSPVFSPSNY--SKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP 581          

HSP 6 Score: 175.252 bits (443), Expect = 1.958e-44
Identity = 169/569 (29.70%), Postives = 270/569 (47.45%), Query Frame = 2
Query:  377 DLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLREN-FQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK--FQISH-NGMLQSVAVLDREEKEEYKLTL-IAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFH 2065
            D NDN+P +        I E   IG+   +  A D D     +     ++  +S F +  +          L +K  I+RET     L I  +D GSP +T +  +T+ + DVNDN P F++  YI S+REN  Q  S+L   V+A D D G    L Y   +S  D  ++ F INST+G I     LD++  ++  Y   V A D      ++ T V I ++++ND  P  +  +     ++ EN+  +  +V VS  D D    G  +  ++G K  D       S +I          DRE  +     +   D G P L++   +T+ I+D NDN P F   + S SILE+S   +   K+ A D DEG N+++ Y++S     N  F   +  S+G + + Q LDR  +   + + +   DHG P  ++ I I + +IDIN+  P+ N S+   +V E+        PK  ++  I  SD D G+NA+LT ++  N +K  F + +  G + +   LDRE++  Y L + +A  G P +    +    V+I + D +DN P F 
Sbjct: 1300 DENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMN-------GVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVL--TVAADDSDVGANAVLRYSI-ISGND--EKRFKINSTSGVIMTTTPLDFEEKSQ--YGLEVTATDS---KYTAKTNVTIRVINLNDITP--AFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGII----STADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLS----RNDAF--MIGASSGVITLAQPLDR-ENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQ-------PKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSL----SSVADVIIDVIDEDDNCPRFQ 1825          

HSP 7 Score: 152.525 bits (384), Expect = 2.273e-37
Identity = 148/558 (26.52%), Postives = 242/558 (43.37%), Query Frame = 2
Query:  695 IQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLA-IKDNI-NKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            I + DVNDN P F+   Y   + E+  + S++   ++AVD D G   +LSY     +T     +F ++S  G IR   + D ++  + SY   + A D G P+ S   TV I I+DVND  P+ S   +    ++ E+  +   +V V+  D D G N      F  G+            D +   +      D E+ +     ++  D G P LT +  + + + D+NDN P FS  A    + E++P GT   +V A D+D   N  L++ I            F I+ +  ++         +   + + V   D G P   +  ++TI + D+N+  PVF+ S +   +PE       +V        +  +D D G   +L    I  N+   F I  N G ++  + LDRE    Y L + A D         + +  V I L D+NDNSPIF    P   +VS      H++  +   D D  +N  V  ++        FSI+     + L  +L  E +  + + V  KD G P +SS   +++ +DD
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVR-QLTAVDLDVGINARLSYSLVSGDT----SYFTVDS-QGVIRTKGAFDRET--KASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFS--SAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTL-----DAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGI----IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVT-------VTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD---GGSTSRSSSTRVTIALQDINDNSPIFQG--PYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN--TDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDD 677          

HSP 8 Score: 117.857 bits (294), Expect = 9.441e-27
Identity = 87/293 (29.69%), Postives = 146/293 (49.83%), Query Frame = 2
Query:  605 IDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKD 1483
            +DRE      + + +TD+G+PPL+    +TI+ILD NDN P F +  Y  S+ EN   +S     ++A D D G   +++Y  S ++       F I +++G I L + LD +  N+ +Y   + A DHG P  +SS T+ + ++D+ND  P+I  N S    ++ EN      ++ +   D D G+N +    L+ ++   +    N +      +  K   DRE++A     I   D G PSL+S   + + ++D +DN P F     + +I E  P G  + +V A D D
Sbjct: 1575 LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSF-SFKLAATDADEGTNARITYNLSRNDA------FMIGASSGVITLAQPLDRE--NKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI--NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTG----DISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 96.6709 bits (239), Expect = 3.487e-20
Identity = 96/378 (25.40%), Postives = 160/378 (42.33%), Query Frame = 2
Query: 1265 HKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEIT------------INLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLA-IKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDG-TPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
             KFDRE E+    T+   D          ++ + + D NDN P F + +  F+I E++P   V   V A D+D G N+ + Y               L       ++N        GEI +V  +  DH     S  + I+            I + D+N+  P F  S +   V ED       V     +  +   D D G+NA+L+ + +  + + F +   G++++    DRE K  Y++ L A DG +P    + TV     I + D+NDN P+F  +      V     +   ++ +   DKD+G NA +  S   G     F++D     V ++R L  E +  + L +   DRG PP + +  + I ++D
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYS--------------LFSGENKFMMNSKT-----GEIRTVTPL--DH-ETKDSYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYED-------VAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVE----IEILDVNDNRPVFS-SAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVND 368          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 202.986 bits (515), Expect = 2.946e-53
Identity = 180/615 (29.27%), Postives = 295/615 (47.97%), Query Frame = 2
Query:  596 KSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRH--FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISL--------NKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQF----------NCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQH-LDRLLDGEIFSVIVVVS--DHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN---INK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYV-RHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI 2350
            K  +DRET D  +L I  TD G+P L G  +I I ILD ND+ P F+ + Y+ S+ EN +    + + VSA D DSG+ G + Y     + D+++ +  F ++S+ G IR  ++LD++  N  SY+F V+A D G P+ +   TV IN++D ND  P + +        +K+++     EN+ +N  I  + V D D   N Q            CF +   GF             Y +  +   DRE   F   T+   D G+PS ++   + + + DVNDN P F+  A + +I E +  G+ V ++ A D DEG N  + Y I    T       F ++    L+     LDR    ++ SV + ++  DHG    +    +T+ +ID N+  P F +S++  T+ E  S    ++        ++ +D D G N ++T  I  +   +N  F++ +  G+L + + LDRE K  Y  T++A D G P  Q+  +V   V + ++D+NDN+P+F   +P+    S  E     +L+ +   D D G NAV+   I  G     FSID     +     L  E +    LI+  KD G    + +  + +T+
Sbjct:  161 KKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSI-LRVSAADRDSGSNGDIKY---AIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKN--SYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS----ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGF-------------YFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI----TGGNDLGWFQVDFQSGLVTTAKPLDRE---QVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQ-------VSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDP--QLMSSV--KVELTISDINDNAPVF---YPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTV 731          

HSP 2 Score: 151.369 bits (381), Expect = 4.770e-37
Identity = 158/609 (25.94%), Postives = 271/609 (44.50%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDL--IIYQLMAKHKFDRE-KEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLP----TFSMPATSFSIL--EHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVV--DLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +   + IDRET  +I L +   +  + P++    + +Q+ D+NDN P F T  Y + +RE+  +N+  PIN +A D D+GN G + Y   S  NT +         T   + +I     D      Y   + A D G PAL     + I I+D ND  P+ + N  L   +I EN      I+ VS  D D G NG     +     +D +   ++ DL      +  K   D E K ++ +  I   D G+PS      +T+ ++D NDN P    T+  P      +  E+S I T +  +   DKD   NSQ    I    T       F +E  G   +   L + LD E+   +++ + V+D G P+ S    + I++ D+N+  P F  + +   + E       L      +  +  +D D+G N  ++ +I   +++  FQ+   +G++ +   LDRE+     +T+ A D G+       TVT +++    D NDN P F ++      +S    +   ++ +   D DSG N  +  ++S     +   F ++     +    +L  E + ++   V+ KD G P   SS+++++TI D
Sbjct:   51 ISTTARIDRETTTQISLQLRTLNPSNQPIS----VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPIN-TATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLG--SIAENTKPGVSILRVSAADRDSGSNGDIKYAI----DWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVI-ASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI----TNGDDEGCFKVEFLGFYFI--QLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISE-------LAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTII----DGNDNKPRFMKS-SYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISD 629          

HSP 3 Score: 150.599 bits (379), Expect = 7.917e-37
Identity = 179/698 (25.64%), Postives = 297/698 (42.55%), Query Frame = 2
Query:  377 DLNDNAPHWPKPIELSISENAFIGTLF-NIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPT----DDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFST-----HKYIISLRENFQLNSLLPINVSAV---DCDSGNFGKLSYKHSVSNTDS--------VKRHFAINSTNGEIRLIKSLDYDSGNELS--YSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRT-TNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF---HRNFPLPTKVSYKEYVRHELIA-LFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            D ND+AP +        ++N+++G++  N  P V + R     + +          D   + +    D +     ++ K ++D E  +     ++ +D G P       +TI +LD NDN P         H    ++R     NSL+  N++ +   D DS    +   K  ++N D         +  +F        I+L K LD     EL   Y+  +   D G P+ S+   V+I++ DVND  P  + N    +I+    N     ++ ++  D D+G NG  +  + G  G DL + Q   D     +      DRE+ +    TIT  D+G    T S  +TV I+D NDN P F   +   +I E + IG  V +V A D D G N ++ Y IS      N +F   L    G L     LDR     ++S  V+  DHG P L + +++ + + DIN+  PVF    +  ++ E+          P  +  +  +D D+G NA ++  I   +N   F I S  G++ ++A LD E +E + L + A DG      +  V    V  LN   DN P+F     NF +     Y+   +  L+  ++   KD   N  +  +I  G     F +D     +K+N  +  E +  + L VI +     P S+   + I + D    +P+
Sbjct:  198 DENDHAPVF--------TQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSE---NSLINTNIAYILVTDKDSNTNSQTELK--ITNGDDEGCFKVEFLGFYF--------IQLQKPLD----RELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNG--SYVLQLNATDPDEGDNGTVSYSITG--GNDLGWFQ--VDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFE--LNTQTGVLWTKSQLDRETK-SLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN--------EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVN--VTVLNKA-DNLPVFLYEMYNFTV-----YENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQ 843          

HSP 4 Score: 146.747 bits (369), Expect = 1.255e-35
Identity = 151/610 (24.75%), Postives = 275/610 (45.08%), Query Frame = 2
Query:  578 FP--KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVS-AVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDS--GNELSYSFVVVAHDHGQPALSSSTT-------VIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGM---LQSVAVLDREE----KEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQI 2344
            FP  KL ++ S+ +      +L++  TD G P  +    +TI I D ND+   F  + +  ++ EN    +L+   V+ A+D           K  V +  S + HFA++  +G+I     LD +    N  S  +++ A      A+ + TT       VI+ + D+ND  P+ S  +++  IT+ E +    P+  +   D D+G N +F   L+   G D  F  + +     +L      DRE  +     +   D    +L S+  I + + D ND  P F     + +I E + IG++V  + A DKD G N  + Y IS+      +   F +ES  G L+V + LD     +++ + +   DHG   LS+ + +T+N++D+N+  P+F       TV E+ +   P       +G    SD D G NA +  ++         S N     + ++A +D E     ++ ++L ++A D G+P +  R ++T    + + D NDNSP     F  P   +    +   ++ +  ED D  +N  V  SI  G    YF++      +++  ++  ++  I++L +   D G+P + +   + +
Sbjct:  997 FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHS-------RTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAE-----AMYNDTTIKRDKAIVIVTVTDLNDNAPVFS--RAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTG----ELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN----GNLAAMFDVESATGRLIVAKSLD-FETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFP-------VGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSIT----VQVTDENDNSP----GFVSPPAAAAGSSLN--VMTITAEDPDRNSNGKVTYSIISGNNG-YFNLHPSTGQLQMIHQIP-DNPTIYQLTIQASDGGQPSRQTQTVVSV 1564          

HSP 5 Score: 127.102 bits (318), Expect = 1.321e-29
Identity = 144/515 (27.96%), Postives = 222/515 (43.11%), Query Frame = 2
Query:  881 RHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPII-SLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQ---LMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS-DPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHL----PLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQISHNG--MLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNM 2383
            + F  NS  G I     +D ++  ++S     + +   QP      +V + + D+ND  P   +L  +L+   I E+ ++N      +  D D G NG  + + I        F    +         ++ K   DRE   F    IT  D G P+L    LI + I+D ND+ P F+  +   SI E++  G  + +V A D+D G N  + Y I  D   +N +F   L  S G +   Q+LD  +    ++  V+ SD G P+ ++   +TIN++D N+  P   Q    +  P +    +     L+    NI YI V+D D   N+Q  L I   D+   F++   G   +Q    LDRE    Y LTL   D G P    R T+ G V+I + D+NDNSP F  N      +S        ++ L   D D G N  V  SI  G    +F +D     V   + L  E      + +  +D G  PK+ S  + +TI D     P+ M
Sbjct:   40 KQFGFNSNTGVISTTARIDRETTTQISLQLRTL-NPSNQP-----ISVQVQVDDINDNEPRFPTLYYTLR---IRESMDVNTTNPINTATDPDAGNNGTVD-YTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFD--LDSSTGVIRTKQNLDFEVKNS-YTFNVIASDGGVPSKNDLATVTINVLDTNDNSP---QLKITYLPPHNGDKAIRSENSLINT--NIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPS---RSTL-GFVLIDVTDVNDNSPAFTSN-AYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM 531          

HSP 6 Score: 121.324 bits (303), Expect = 7.792e-28
Identity = 152/571 (26.62%), Postives = 239/571 (41.86%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGE--IFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK--FQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRN 2071
            D NDN P + K   + +ISE A IG       A D+D     +         +    L  L T    Q   L  KS +DRET       +L  D G P L     + + I D+NDN P F   +Y  S+ EN     LL   V+A D D G    +SY     N +    +F+I+S+ G I  + SLD++   E  +S ++ A D G    + +  V + +++  D LP+      + + T++EN      +  V     D+  NG  +  ++     +L    +   +I          DRE++A     +      +  L++   + + ++D NDN P FS  +    I     +G VV    A+D D G N  + Y +    T+N     ++  ++G + + +   +L DG+   ++V V+ SD G P   + + I I L  IN+ PP F  S++   V       L   P      Y+   D D G N QL  +I     +  F I   G L     L +  K  Y L + A D G P       VT    I++ D ND+  +F  N
Sbjct:  522 DGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNT----QTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL--QVTATDADEGTNAVISYDIIGGNNNG---NFSIDSSTGVISTLASLDHEV--EEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLY--EMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGII----KINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQL----TSNAEGLLWINSTSGVIKLAR---KLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL-SINH-PPKFTLSSYVTHV-------LASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVT----IYIQDSNDHRSLFVNN 1053          

HSP 7 Score: 119.783 bits (299), Expect = 2.705e-27
Identity = 173/689 (25.11%), Postives = 290/689 (42.09%), Query Frame = 2
Query:  377 DLNDNAPHWP-KPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREK-----EAFAYTTITCCDYGIPSLTSSQLITVIIV-DVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAV----SDCDKGVNAQLTLAIKDN--INKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE--LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSV----KLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            D NDNAP +    + + I     +G +     AVDLD  K                    L  +      KL  K +   ET   ++  +L +DSGSPP      +TI I    ++ P F+   Y+  +  +  L S     V AVD DSG  G+L Y     N + +   F      G++ + KSL      + SY  +V A D G P+ S+S  V I I D ND   +  +N + +   + EN++    +  +  H LD          LI  +    +      D+   Q+  + + DRE+      +  Y       Y   ++   + I ++ V D+NDN P FS    + ++ E S  G+ V +++A+D DEG N++  Y +      ++    F+  S G L    HL + LD E    ++++V  +D     L +  +I I + D N+  PVF +S +   + ED             IG + +    SD D G N  +  +I +      F + S  G L     LD E  + Y+LT+ A D      I  + T +V + + D+NDN+P+F      P  ++ +E V     +      D+D+G NA +  S+     +  FS++     +     ++ +     +   +L+V+  D+G P  S+   I + + D    SP
Sbjct:  836 DRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAE-----GLLWINSTSGVIKLARKLTDGDETQYTVQ--VLASDSGSPPQ--HSTMTIHITLSINHPPKFTLSSYVTHVLASQPL-SYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP----GGKLYIRKSLL--QALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLF-VNNTFR-FAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAV------DVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKF---FINSSTGEL----HLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDAL-----------IGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQD---HGLIPLSSTVNVTVNVLDVNDNAPLFPTQ---PVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSP 1476          

HSP 8 Score: 114.775 bits (286), Expect = 8.377e-26
Identity = 133/505 (26.34%), Postives = 229/505 (45.35%), Query Frame = 2
Query:  218 YFRLSSSGIISVARQLDCDNDS--NLCDKTLEYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPIN-VSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDS--GNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSD-HGRPALSNQIEITINLIDIN 1708
            +F  SS+G + +++ LD +  S  NL  K  +     L+      I         D ND  P +P+    ++I+E+A IG+L      ++L+ + K+      IK   S  +LA +  D E    +L +  S+D ET    EL I   D G  PL+    +T+ +LDVNDN P F T    +++REN  +N+  P+   +A D D+G    +++    S T S  + F++NS   EI  I ++D ++      S+  VV+A D G P LS+  ++ + + D ND  P       +        ++LN  ++ ++  D D+  NG+    +I G+ G+  L        +I+Q+        +       TI   D G PS  +  +++V         PTFS      S+ E+   GT V  V A      LN  + Y+++   +        +++S G +   + +DR   G  F+++V   D  G  A ++   +TI + D+N
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVG------DSNDQRPVFPESDYTVNITEDALIGSL-----VINLNASDKDIGQNGLIKYSISNGNLAAM-FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVREN--VNTGFPVGRCTASDRDTGTNAHIAFSM-YSQTPS--KTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-----VSPPAAAAGSSLN--VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQI-------PDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGF---EVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 195.282 bits (495), Expect = 1.141e-50
Identity = 196/686 (28.57%), Postives = 300/686 (43.73%), Query Frame = 2
Query:  602 SIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQP-ALSSSTTVIINIVDVNDELPIISLNKSLKD-ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVR--HELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRG-------------------RPPKSSSIEIQITIDD-SQPLSPKNMVHFNESKEKINKEMIV-ITIAVIISVLALGSFITIVI---------------IKCRKKAKPPLICY 2533
             +DRE  D   L I  +D G+P   G   ++I + D NDN P FS   Y  ++ EN  + + + + VSA D D G   ++ Y  S+      +  F I+ T G I     LDY++  + SY  VV A D G    LSSS  V I ++DVND  P+I ++ +L     + EN  +   +  VSV D D G NG+ N  L G  G+  +    L+D  I  +      DRE     +    C D G P  T+ +   + + DVND  P F        + E++ + T+V  V A+D+D G NS+L+Y I++   +      F I+ S+G +     LDR    ++  + V+V D G P LS+   + +NL D N+  P FNQS+++ ++ E+     P+V        +   D D G N+ +  +I   N   F     G++ +   LD E +  Y   + A DG        +   +V + L DLNDN P+F    P    V Y E  R    +  L   D+DS   A+    I+ G     FS+D     + L + L  E Q  + L V   D G                    PP  S  E   TI + SQ LS    VH     +  N E++  I+     +++ + S  T+ +               ++ + K  PPL  Y
Sbjct:  129 GVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSI-LQVSASDKDIGTNAEIQY--SIETHSDPQAIFGIHPTTGVIVNNVRLDYEA--KRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESI--IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVV-LTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVV-------QLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG-----GRSCNATVHVSLTDLNDNQPVFD---PSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGY 790          

HSP 2 Score: 191.045 bits (484), Expect = 2.116e-49
Identity = 178/606 (29.37%), Postives = 283/606 (46.70%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNEL-SYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGE-IFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI-----DDSQPLSPKN 2380
            L L+S +D E    + L +   D G+PPL G   +TI ++D+NDN P F++   ++ L E+  +       VS  D DSG  G++S+   +SN  ++   F ++S  G + L K +DY  GN   SY+  V A D G P  SS+  + + +VDVND  P+   N S     + E    +  I++V   D+D G NG+ +              +N   + I     K K DRE        +   D+G P  +SS  + VI+ DVNDN P F   + +F + E+ P+ T +  V A D DEG N  + Y     R   Q+    + +  G +  +Q LDR      +FS  +V +D G     ++ ++T+ + D+N+C P F+++ +  TV ED    LP+      +  IA  D  +G N+ +T  I      F ++   G+L  V+ LDRE    + L ++A D   + Q   T+T  + I + D+NDN P+F       T V  K  +   + A+   D D G N  V   I  G     F I+     +   R L  E    + L V   D G+  + +S ++ +TI     +D++P   KN
Sbjct:  759 LYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTF-YTVSVFDADSGVLGRVSFSL-LSNPGTL---FNLDSNTGALSLTKLIDY--GNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFG-NWSYT-AHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFI-----KSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTY-----RFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFS--IVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNED----LPVGSSLLTL--IATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGN-QSLETIT-YIEINVLDVNDNYPVFINETTFKT-VPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQL-VTIYVEDANDNRPTFDKN 1333          

HSP 3 Score: 182.185 bits (461), Expect = 1.333e-46
Identity = 185/679 (27.25%), Postives = 303/679 (44.62%), Query Frame = 2
Query:  377 DLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLD-REEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            D+ND AP + +   E  + ENA + TL  I  AVD D    ++ +        S   L +   D       +   + +DRE   ++ L +L+ D GSPPL+    + + + D NDN P F+   Y  SL EN    S + + + A D D G    + Y     NT      F ++   G +   ++LD++   + SY+F V A D G    S + TV +++ D+ND  P+   + S   +  FEN  + + I  +   D D         F+I     D +F  + S LI    +     DRE +     T+   D G     +  ++ + ++DVND  P FS    +F+I EHS   +V+  V A+ +D+G N++++Y IS   T N +    LI S G L +   +D      ++ + V   D G P L     +TI +IDIN+  P FN S+    +PED        P       ++V D D GV  +++ ++  N    F + S+ G L    ++D       Y L + A DG    +   + T  + + + D+ND SP+F  N+     V         +I +   D DSG N  +  +    +    F + R+   + +  KL  E    + L VI  D G P +SSS ++++ +DD    +P    HF ++
Sbjct:  381 DVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGM--ITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPV-VQLLAQDPDIGENSLILYSILTPNT-----PFFLDPRKGLVTNSRTLDHEV--QSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPV--FDPSSYSVEYFENTRIGQSICQLKAIDRDSP-KFAITRFIIEQGNADEVFSVDGSGLITLAKL----LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIV----LINSTGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPED-------TPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPR---SSTAMLELKVVDVNDYSPVFG-NWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL-RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNP----HFQQA 1019          

HSP 4 Score: 181.8 bits (460), Expect = 1.839e-46
Identity = 190/680 (27.94%), Postives = 325/680 (47.79%), Query Frame = 2
Query:  377 DLNDNAP----HWPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRH---FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQ-FNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNI-NKFQISHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSI--KPGIIAPYFSIDRDRQSVKLNRKLKSEHQG-IHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            D+NDN P     +       ++ENA IGT        D D + KN ++   ++    YF + F   +DE     + +  S+DRET+D   L  +  D G PP T E    I + DVND  P F  H Y   + EN  +N+L+ I V+AVD D G+  +L Y  +++NT   + +   FAI+ ++G I     LD +   ++     V+ HD G P LS + +VI+N+ D ND  P    N+S  + ++FEN+    P+V +   D D G N       L  +  F L  ++ L       +      D E ++     +   D G  S  ++  + V + D+NDN P F   + S    E++ IG  + +++A+D+D      +   I +    +++F    ++ +G + + + LDR         +  V   G+ +++  I + I ++D+N+ PP+F+++ ++FT+ E  S  L +      IG++     DKG NA++  +I K N  N   I+  G L   + +D E+     LT+ A D GTP +     VT +V+    D+NDNSP F+ +  L  ++     + H    + V D DSG    V  S+   PG +   F++D +  ++ L + +   +    + L V  +D G PP+SS+  +++ + D    SP
Sbjct:  271 DVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDAD-SGKNGEVNVTLEGGDGYFSMKFDVLNDES---IIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAI-VNAVDQDFGSNSELVY--TIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQV--VLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPY--FNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGL-------VTNSRTLDHEVQSSYTFQVAATDGGGRSCNAT--VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDS-PKFAITRFIIEQGNADEVFS---VDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAI-VNITVLDVNDEPPIFSKAEYNFTIQEH-SQALSV------IGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVI----DINDNSPQFNSSSIL-VRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTL---FNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSP 910          

HSP 5 Score: 158.303 bits (399), Expect = 3.755e-39
Identity = 168/600 (28.00%), Postives = 269/600 (44.83%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVD-VSVHDLDQGINGQFNCFLI-GHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGI-PSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLD-----RLLDGEI---FSVIVVVSDHGRPALSNQIE-ITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK--FQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIF-HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAP---YFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSS 2326
            K+ +KS +DRE  +   L ++  D G+P  +    + + + DVNDN P F    Y   ++EN  + + L   VSA D D G+ G ++Y+      D+    F ++   G+I   + LD ++  + SY F +VA D G       T V + + DVND  P  S NK    +T+ E+  +   ++  ++  D  QG N      ++ G K F L       + +   L      DRE        +   D G   SL +   I + ++DVNDN P F    T  ++ E  PIG+VV  V A+D D+G N ++ Y I +  T            +G   +N+        R LD E+   + + V  +D G+       + +TI + D N+  P F+++     + E+       VP   N+  I   D D G+N+++   I     +  F+I S  G++Q+   +DREE  EY L + A D     Q R   T ++ I + DLNDN+P F  RN    T V   E    ++ ++   D D+G    V+      I++P    FS+D     +KL   L  E    + L +   D G PP +S
Sbjct:  967 KIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGA-VSASDSDEGSNGHVTYRF-----DTQVAQFIVDKQTGKITTSQVLDREA--KASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNK--YSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL-------NQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT------------DGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYEN-------VPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNL---TYVMEDEPFNFQVTSITALDPDTGQGGNVEYR----IVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTS 1523          

HSP 6 Score: 156.377 bits (394), Expect = 1.659e-38
Identity = 175/603 (29.02%), Postives = 273/603 (45.27%), Query Frame = 2
Query:  602 SIDRETNDRIELVILLTDSGSPPL-TGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHG---QPALSSSTTVIINIVDVNDELP-IISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG--HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLV-NQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            ++D E  +R  L +  TD G     T   ++TI + D NDN PTF  +  I  + EN  +N+ +   + A D DSG   ++ Y     ++ S + HF INS  G I+    +D +  +E  YS  V A D     Q  L ++ T+ I I D+ND  P  +S N +     + E+   N  +  ++  D D G  G     ++      F L  K  +  LI          D E        I+  D G P LTS QL  V++VDVNDN P F+      ++ E+ P GT V KV A D+D G N++L Y I      ++    F I+ +  L+V N  LDR      F + V  +    P   +   + IN++D N+ PP F        VPE+    L        I  + V D D G N ++  +I   +    F I  + G L +   LDRE K  Y+L++ A D TP     +T   ++ IF+ D NDN P+F ++    + +S        ++ L   DKDSG+N  +  ++       Y SID     V    + ++  +  +    I KD+G+ PK + + ++I I+D    +P+
Sbjct: 1286 ALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNV-TTIKAHDDDSGLNSRIWY---TIDSQSPRAHFKINSETGLIQTTHPIDREEISE--YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY----VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLI-------GSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK----FSIDKHSGLIVTNSILDREKKDTYF-LTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARL--------IYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPY---YTAFANITIFIEDQNDNPPVFQQSL-YSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVY-SIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQ 1853          

HSP 7 Score: 154.066 bits (388), Expect = 7.907e-38
Identity = 165/628 (26.27%), Postives = 270/628 (42.99%), Query Frame = 2
Query:  602 SIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENF-QLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLL------------------FKQNLSDLIIYQL-------MAKHKFD-REKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLN-SQLIYHISDPRTTNQMFPPFLI-ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK--DNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEY--VRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHK--LIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            ++D E+     L ++ T  G   L G  I+ I ++D NDN P F     +  L E+         + V+A D DSG  GK++Y     N   V   F I+ST GEI   K LD ++    S+  V+   D G P  S++  V + + D+ND  P+      L ++ I E+      +  V   D D+     +N       G  +L                  F    SD I Y++        A+   D R +++F    +   D G+P   +   + +II       P F +P+    + E++ +GT V  VR  D   GL   ++ Y+I +          F I + +G + VN+ LD         V+  + D   P+   ++ + IN+ D+N+  PVF QS +     E        +P    +  ++ +D D G N ++  AI+  D+   F I    G++++   LD E  + + +++ A D G+P +   HT   SV I + DLNDN P+F    P P  V   E   +   L  +   D+DSGANA +  ++  G     F ID+    +  N     E+  +++  L +   D G PP SS+I I + + D     P
Sbjct: 2024 ALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKLLDRET--TASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF---DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNY-------FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTA-PSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEG-------IPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPM---HTDV-SVTIRVLDLNDNPPVFR--VPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDP 2618          

HSP 8 Score: 152.14 bits (383), Expect = 2.813e-37
Identity = 185/684 (27.05%), Postives = 290/684 (42.40%), Query Frame = 2
Query:  377 DLNDNAPHWPKP-IELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFV--VVAHDH-GQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSL-TSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHI--SDPRTTNQMFPPFLIESNGNLLVNQH-LDRLLDGEIFSVIVVVSDHG---RPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI-KDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNS---PIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            D+NDN PH+ +      + EN  + T      A D D                  FD        + Q  K+     +DRE        I+ TD GS P   +  +T+ + DVND  P FS +KY +++ E+  + S L   ++  D   G    ++Y           + F++N   G + L+  LD     E+++  +  VVA D  G  +L + T + IN++DVND  P+     + K  T+ E   +   +  V   D DQG NG+   + I +   D  FK N +  +I  L A    D E        ++  D G     TS QL+T+ + D NDN PTF        I E+ PI T VT ++A D D GLNS++ Y I    PR        F I S   L+   H +DR    E +S+ V  +D     +  L N   + I + D+N+  P F      + + ++P +          +  I   D D G    +   I   +  KF +    G+L+ +  LD E+  +Y L + A D G+P +        S  +F   + D +   P F R+  + T VS  +     ++ +   D+DSG+NA +  SI  G+    FSID+    +  N  L  E +  + L V       P + SS  ++I + D     PK
Sbjct: 1008 DVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYR--------FDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG-----PKAFSLNQVTGVLTLVSPLD----REVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFK--TVPEKLPIGSVVAAVLAVDSDQGDNGKVR-YKIVNGNTDGTFKINETTGVISTLRA---LDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAH------FKINSETGLIQTTHPIDREEISE-YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNF--------QVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLT-------SYQLFNVVVVDVNDNPPEFTRDLFIGT-VSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPK 1645          

HSP 9 Score: 137.887 bits (346), Expect = 7.456e-33
Identity = 209/836 (25.00%), Postives = 339/836 (40.55%), Query Frame = 2
Query:  110 SVEERFPVNYFVTDLKNILAIPL----NSSTRFNMLHVHS--YFRLS-SSGIISVARQLDCDNDSNLCDKTLEYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSS---------IDRETNDRIELVILLTDSG---SPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRE---NFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK-DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYV-----RHELIALFVE---DKDSGANAVVDLSIKPGI-IAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAK 2515
            +V E+ P+   V     +LA+      N   R+ +++ ++   F+++ ++G+IS  R LD +  +      L    T +         +++ I + D NDN P + K PI   I EN  I T      A D D               S      +   D +      K+ S          IDRE      L +  TD        L     + I I D+NDN P F +      + +   NFQ+ S     ++A+D D+G  G + Y+  + + D+ K  F+++   G ++LI SLDY+  +   Y+  + A D G P L+S     + +VDVND  P     + L   T+ EN      +V V+ +D D G N +    +      D       S LI+   +     DREK+   + T+       P   SS  + + ++D NDN P F  P  +  + E+SP   + T +   D D G N++++Y I    T        +  S G L     LDR      + + V   D   P  +    ITI + D N+ PPVF QS +  T+ E       L P   +I  +  SD D G N  +   +  D    + I S  G++ S A  +   K+EY    IA D   D ++       V I + D N+++P F       TK  Y+ ++        L+ +      D D   N  V   +         F ++ +  SV+ +    +  QG H L +I +D G PP      +QI I + Q   P+     N++  +++          I     +GS+IT V  +    A+
Sbjct: 1232 TVPEKLPIGSVVA---AVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYV---LRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDD---------------SGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTS-----ITALDPDTGQGGNVEYR--IVSPDTGK--FSLDLKTGVLKLIGSLDYE--DVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPP--EFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSI----LDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYT-LTVQDLDYGNNTKVLYSIMSGNTDGAFT---IGRSTGELSTTTKLDRETKAS-YQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISE-------LTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIV---PVRIKIEDKNNHAPQF-------TKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPR---FLNQTPARVS----------IPENSKVGSYITTVRARASSDAQ 1994          

HSP 10 Score: 131.724 bits (330), Expect = 5.485e-31
Identity = 171/699 (24.46%), Postives = 282/699 (40.34%), Query Frame = 2
Query:  377 DLNDNAPHWPK-PIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHK-YIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKS--LDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEP--IVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVT----------------------------KVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAIDGT-PDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVE--DKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            D N++AP + K P E+ I  N     L  +  A D D  K            S      F+    E     ++  +        R  L I+  D GSPPL G GI+ I I ++ D+ P F       +S+ EN ++ S     ++ V   + +  +++Y     N     R F ++   G I +  +  LDY+S    ++   +VA   G  +L+    + IN++D ND  P    +  L  +   E+    +P  +V V+  D+D G NG+       G++           ++   +L+     DRE  A     I   D GIP  +++  + V++ D+NDN P F  P +  +I E +  G VVT                            +V A D+D G N+Q+ Y    P T +      +    G +   + +D  +      + V   D G P     + + I    I    P F   ++   VPE+      ++        + V+D   G+         +N N F+I   +G++     LD E K  + L + AID T P   +R      V I ++D+ND  P+F ++  +     + E +    I + V   DKDSGAN  V  +I+ G     F+IDR    ++  R L  E    H + V   D G PP  + + + I + D
Sbjct: 1846 DKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVV---ESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSY----ITTVRARASSDAQVTYSIISGNK---GRAFYVDPFTGVISVASADALDYESTK--NFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLA--EDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLL-----DRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFD-PLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF--PITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRI----IITREPKFELPSYFGKVPENAMMGTSVLT-------VRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRV----PVYINVSDVNDEKPVFGQSGYM---AQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLD 2504          

HSP 11 Score: 130.954 bits (328), Expect = 9.625e-31
Identity = 160/639 (25.04%), Postives = 269/639 (42.10%), Query Frame = 2
Query:  599 SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDK--DEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVF-NQSTFHFTVPEDPSDHLPLVPKPRNIG-YIAVSDCDKGVNAQLTLAI--KDNINKFQISHNGMLQSVA---VLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLN--DLNDNSPIFH-RNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITI---DDSQPL-SPKNMVHFNESKEKINKEMIVITIAVIISVLA 2464
            S +DRE  D   L +  T    P       + I ++D NDN P F +    + + EN     +  + V   D D GN  K+ Y     NTD     F I  + GE+     LD ++  + SY   V A D   P  ++   + I I D ND  P+    +SL   TI E       I++++  D D G NG    + + +  + +    + + ++      +    +E   F        D G     +   + + I D N++ P F+       I  ++    +VT V A D   D+  N ++ Y + D + +  +   F++ESN G++  +        G   ++ ++  DHG P L     + I + +I + PP F NQ+    ++PE+             +G YI         +AQ+T +I   +    F +     + SVA    LD E  + ++L L+A   TP   +  ++ G +++ +N  D NDNSP FH  N           +    ++ +   D DSG N  V  SI  G  A  F+ID     +   + L  E      L++ G D G PPKS++ ++++ +   +D+ PL  P + V+  E            T AV+ SV+A
Sbjct: 1602 SILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQ--DLDYGNNTKVLYSIMSGNTDGA---FTIGRSTGELSTTTKLDRET--KASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPV--FQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNI-VYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFC----IAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSL---FVVESNTGSVRTSAGFSNPPQGR-HALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPEN-----------SKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVA---TPQGWV--SLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTR---------TGAVVTSVVA 2197          

HSP 12 Score: 125.946 bits (315), Expect = 3.779e-29
Identity = 161/634 (25.39%), Postives = 281/634 (44.32%), Query Frame = 2
Query:  554 LPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTF---STHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRL-----IKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIP-SLTSSQLITVIIVDVNDNLPTFSMPAT---SFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLL-VNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISH-------NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE------LIALFVEDKDSGANAVVDLSI-KPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQIT-IDDSQPL 2368
            +P D E+    +  K+ +DRE      L I+  +  +PP +   ++ +Q  D+NDN P+F   ++ K ++     F+ +      + AVD D G+    SY     N  +V +  +   T+G++         S+  D     SY   + A D G PA      + I + D ND  P  S N S    TI EN ++   I+ VS  D D G N +    +  H     +F  + +  +I   +   + D E +      +   D G    L+SS ++ + ++DVNDN P   +  T   S+ + E++ IGT V +V   D D G N ++   +        M   F + ++ +++ V Q LDR      F   V + D G P  + +    IN+ D+N+C P F++ T+   V E+ + +         +  +   D D G N++L   I +        H       +GM+ +   LDRE+  +  LT++  D G+P +    +   SV++ L D NDN P F+++       SY   +         ++ L  +D D G N+++  SI  P    P+F +D  +  V  +R L  E Q  +   V   D G    ++++ + +T ++D+QP+
Sbjct:    3 IPADLEYNAGVITTKTVLDREKVSAYNLTIV--EFSTPPKSYTVLVYVQ--DLNDNSPSFVRGTSAKLVV-----FENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFS-NVSYSG-TIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNV---RLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSM--KFDVLNDESIIAVGQSLDRETHDHFFLKAVCI-DKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTL-------VAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPL----SDNCSVIVNLTDSNDNDPYFNQS-------SYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPN--TPFF-LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPV 598          

HSP 13 Score: 117.087 bits (292), Expect = 1.894e-26
Identity = 90/315 (28.57%), Postives = 154/315 (48.89%), Query Frame = 2
Query:  605 IDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEA-FAYT-TITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQM 1543
            +D ET  R  LV+   D  +P       + I + DVND  P F    Y+    E   + +++ +NVSA D DSG  G++ +  ++ + D  K  FAI+   G IR  ++LD+++    ++   V A D G P + +  +V I ++D+ND  P+  +     D+ + EN  LN  + +++  D D G N + +  +IG  G  L      S  +   +     FD E  A + Y+ TI   D G P L+S+  I V + D ++  P+F+     F +  ++ IG  V +V A D+D G   ++ +   +P T+N +
Sbjct: 2365 LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIV-VNVSAADKDSGANGRVWF--AIQSGDD-KGSFAIDRKTGVIRTQRALDHETIK--THHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRV-PGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNIT----FDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNP-TSNAL 2667          

HSP 14 Score: 112.079 bits (279), Expect = 5.857e-25
Identity = 168/663 (25.34%), Postives = 282/663 (42.53%), Query Frame = 2
Query:  584 KLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLP-----INVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSV--HDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTF--SMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAI--KDNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQ-GIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPP 2521
            +L   + +DRET    +L +   D   P  T    ITI I D NDN P F    Y  ++ E      L P     +N++A D DSG+ G + Y  S ++T  V   ++I+S  G +    +  +++  +  Y+F  +A D GQ    +   V I I D N+  P     K+  ++ IF N + +  +  V+    D D+  NG+    L   K    LF   + +     +     F    +      I   D+G P L    ++ ++I ++ D+ P F    PA   SI E+S +G+ +T VRA    +   +Q+ Y I     +      F ++    ++     D  LD E    F + +V +  G  +L+  + + IN+ID N+  P F+ S     + ED         KPR +  +  +D D G N ++T +I   +    F I S  G + +  +LDRE    + L +   D G P      +    V + + DLNDN P+F    PL ++V+ +            ED  +GA           ++    + D D++S +L   LKS    GI  L V   D+      S+ +I+ +     P++  + + +     KI+ +  VI+    I V    SFI I  ++   +  PP
Sbjct: 1701 ELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISE------LTPPGTSILNLTASDKDSGSNGNIVYTLS-NDTYGV---YSIDSRTGIV--YSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAP--QFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLF---VVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPA-RVSIPENSKVGSYITTVRARASSD---AQVTYSI----ISGNKGRAFYVDPFTGVISVASAD-ALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAF-----KPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIP----PKSTNCQVKVVVTDLNDNPPLFD---PL-SEVNIR------------EDTRTGA-----------VVTSVVATDTDKES-RLTYNLKSASTPGIAILRVSATDQD---SGSNAQIKYSF----PITNSDQIDY-----KIDADTGVISARRTIDVRIRDSFIQIP-VQAMDQGVPP 2287          

HSP 15 Score: 105.145 bits (261), Expect = 8.046e-23
Identity = 104/395 (26.33%), Postives = 179/395 (45.32%), Query Frame = 2
Query:  587 LKLKSSIDRETNDR-IELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSG-NFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPA-TSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDRLLDGEI-FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVP 1756
            +  + +ID    D  I++ +   D G PP     ++ ++I+   +  P F    Y   + EN  + + + + V   D  +G   G++SY    SN      +F I   +G I + K LDY++  +  +  VV A D   P+      V IN+ DVNDE P+   +  +   +  E   +   +V+VS  D D G NG+   F I        F  +    +I     +   D E     + ++   D G P + +   +T+ ++D+NDN P F +P      +LE+ P+ + + ++ A D+D G N++L + +     T Q    FLI+  +G L  N   D        +S+ +  +D G P LS+ I I +N+ D +   P FN+  + F VP
Sbjct: 2259 ISARRTIDVRIRDSFIQIPVQAMDQGVPPQ--RALVYVRIIITRE--PKFELPSYFGKVPENAMMGTSV-LTVRVTDNAAGLPLGRISYNIENSN------YFRIGQRSGVISVNKPLDYET--KRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWS--EGIPVGTIVVNVSAADKDSGANGRV-WFAIQSGDDKGSFAIDRKTGVI---RTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIG--GTGQGL--FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVP 2630          

HSP 16 Score: 87.4261 bits (215), Expect = 2.271e-17
Identity = 105/423 (24.82%), Postives = 194/423 (45.86%), Query Frame = 2
Query: 1253 LMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNG----NLLVNQH---LDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI----SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLN--DLNDNSPIFHRNFPLPT--KVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSID----RDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVL 2461
            +  K   DREK + AY  +T  ++  P    S  + V + D+NDN P+F +  TS  ++          K+ A+D D G NS   Y I      N        +++G    +L+VN     +DR  LD  + +  +  SD G PA    + ++I + D N+  P F+  ++  T+PE+       +    +I  ++ SD D G NA++  +I+ + +   I       G++ +   LD E K  Y + + A     D    H ++ S ++ +   D+NDN+P+ H ++ L    +V+    +  ++  + V D DSG N  V+++++ G    YFS+      D   + + + L  E      L  +  D+G PP+++    +I + D    +PK   H  E+  ++ +   V T+  I++ +
Sbjct:   14 ITTKTVLDREKVS-AYN-LTIVEFSTPP--KSYTVLVYVQDLNDNSPSF-VRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLN--ISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPEN-------IDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKA----EDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGG--DGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYET--RVWENATVNTLVAIVNAV 414          

HSP 17 Score: 77.7962 bits (190), Expect = 2.284e-14
Identity = 64/221 (28.96%), Postives = 108/221 (48.87%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFST-HKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLII 1246
            ++ + ++D ET     + +  TD GSPP+  +  +TI++LD+NDN P F       + + EN  LNS L   ++A D DSG   +LS+   +  T   +  F I+  +G +    + DY++     YS  + A D G P LSS+ T+I+N+ D ++  P  S N+      +  N  + + +  V+  D D G  G+   F + +       K N +  II
Sbjct: 2464 IRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRL-YEINATDRDSGANARLSFT-VIGGTG--QGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDP--SFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGR--VFFVFYNPTSNALKMNATTGII 2676          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 191.045 bits (484), Expect = 2.383e-49
Identity = 180/665 (27.07%), Postives = 294/665 (44.21%), Query Frame = 2
Query:  386 DNAPHWPKPIE-LSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXX----XXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLI-ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKG-VNAQLTLAIKDNINK-FQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            +N P + +  E  S+SE+A +GT+     A D D                   ++YF +       +     +  K  +DRE  DR    +   D G P L G   +TI +LDVNDN P F  + Y   + E+  +   + + V A D DSG+ G++  K+ + N+D     F+I   +G + ++K LD +     +Y+  V A D G P  S++ TV I ++DVND  P  S  K +   TI E+  +N+ +  V   D DQG NG+   F     G D+ F     + I  ++  K K D E        +T  D G P L +   + + ++DVNDN P F        I E+  +G    +V+A DKD G N ++ +        N +  PF I E+ G + + + LDR    + F+  +   D G P      +ITI L+DIN+ PP F+Q  +H ++ E+      ++        +   D D G  N   ++      ++ F+I+  G++     L+   K  Y  ++ A DG        + T  V + + D N ++P F R      +V     +   ++ +   D+D+G+NA +  SI    + P FS+D     +K    L  E    ++  V   D G P   +   + I I D
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSI-------DQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFV-LAVRASDADSGSNGEV--KYCILNSDGDNSAFSIGEVSGAVTVMKKLDRE--KVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFS--KKVYSATIREDVPVNQLVTTVRATDCDQGSNGEV--FFEIVSGNDMNFFS--INRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF----MQNDL--PFSINENTGGISIKEELDREKVPK-FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQ-------VKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGM------LSSTALVYVNVTDSNTHAPEFKRR-SYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI--ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIAD 638          

HSP 2 Score: 162.54 bits (410), Expect = 1.918e-40
Identity = 161/591 (27.24%), Postives = 255/591 (43.15%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVP-KPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVT-----GSVVIFLNDLNDNSPI---FHRNF-----PLPTKVSYK 2101
            D+NDNAP +     +  I EN  +G  F    A D D     +            F    LP         + +K  +DRE   +    I   D G P   G   ITI +LD+NDN P FS  +Y  S+ EN +  + + + V A+D DSG     +  +S+ ++    R F IN   G I L  +L+Y++ +   Y F V A D     LSS+  V +N+ D N   P     +      + E+ +L   ++ V   D D G N + +           L  +   D     +      DREK       +T  D+GIP L +   + + I DVNDN P F  P+    + E    G  V +V A D D G N+Q+IY  +        F   +  + G +   + LDR    E + + VV +D G P     +++ + L D+ + PP+F +  +  TVPED     P++  K ++       D         ++   ++   F I+ N G +Q++  LD E + EY+LT           +R T++      +V+++L D+NDN+P+   FH N       +P +  YK
Sbjct:  331 DVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFS--------FMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSV-LQVKAIDPDSG---PTNVVYSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKH--VYVFSVSASDG---MLSSTALVYVNVTDSNTHAP--EFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKIS------YSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFT--IDSTQGIIRTLKPLDRETIPE-YELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKS------QDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLT-----------VRATLSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYK 875          

HSP 3 Score: 157.532 bits (397), Expect = 6.918e-39
Identity = 169/648 (26.08%), Postives = 296/648 (45.68%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQG-INGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLI-ESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIK---DNINKFQI-SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYV--RHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIV 2290
            D+ND  P + K +   +I E+  +  L     A D D+    +     +    S  D+ F   +  +   ++++K  +D E      L++   D G P L  +  + I ++DVNDN P F +  +   + EN+ +       V A D D G  G++++    ++       F+IN   G I + + LD +   +  ++F + A D G P    +  + I ++D+ND  P  S  +     +I EN+     ++ V   D D G  N  ++  ++   G D  F+ N   LI       +     K  + + +++  D G+  L+S+ L+ V + D N + P F   + S  + E + +GT V  V A D+D G N+++ Y I+       + P F + E+ G +     LDR    + +   V  +DHG P L  +  + I++ D+N+  PVF + ++   V ED      + P  R I  ++ SD D G NAQ+  +     D    F I S  G+++++  LDRE   EY+LT++A D GTP  Q     +  V + L D+ D+ P+F +  PL  +V+  E    R  +I +  + +D      +  SI  G     F I+ +  +++   KL  E Q  ++L V
Sbjct:  226 DVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIV----SGNDMNFFSINRING--EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEF-YRVQAYDKDHGTNGEITFSFMQNDLP-----FSINENTGGISIKEELDREKVPK--FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEE--YHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYS--IVSSSGHDRCFRINPQGLITLSCTLNYN---TKHVYVF-SVSASD-GM--LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIA------TLVPEFSVDETTGVIKTAGSLDR-EKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVRED------IRPGGRVI-EVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQ----ASVKVKVILEDVKDSPPLFEK--PL-YEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTV 827          

HSP 4 Score: 109.768 bits (273), Expect = 3.765e-24
Identity = 103/350 (29.43%), Postives = 159/350 (45.43%), Query Frame = 2
Query: 1382 DNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIES-NGNLLVNQHLDR-LLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIG----YIAVSDCDKGVNAQLTLAI----KDNINKFQISH-NGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL------IALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            +N P FS      S+ E + +GTVV  V A D D G N  + Y +S P         F I+   G +   + LDR  LD   F V     D G P+L   +++TIN++D+N+  P+F ++ +   +PED S           IG     +  SD D G N ++   I     DN + F I   +G +  +  LDRE+   Y L + A D G P      + T +V I L D+ND +P F       +K  Y   +R ++        +   D D G+N  V   I  G    +FSI+R    V++ +KL  E  G+  L+V  +D+G+P   +   + I + D    +P+
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMS-PSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRV--KAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKS-----------IGDFVLAVRASDADSGSNGEVKYCILNSDGDN-SAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPP----RSATVTVKITLLDVNDCTPQF-------SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQ 338          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 180.644 bits (457), Expect = 8.099e-47
Identity = 158/574 (27.53%), Postives = 266/574 (46.34%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLII---YQLMAKHKFDREKEAFAYT------TITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIE-SNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN-INKFQISH-NGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPI 2059
            D NDN P + P  I+ +ISE A IG       A D D     +            F++             +++  S+DRE      L +   D    P  G G +T+ + DVNDN P F+   + + + E   + S++ +N +A D D G+   ++Y  S          FAINS  G + + + LD ++  + +YSF V A D G   L S+  V + I D ND  P     +   D+   +   +   ++ V+  D D G NG        H  + +L    L  +I+     +    K DRE+++  YT       ++  D+G+   TS  L+ + + D NDN P F+    S ++LE+ P+GT VT V A D+D G+NSQ++Y ++           F IE S G + + + ++R    E + V +  SD G P LS+  ++ ++++D+N+ PPVF    +  T+ E  +     V +      +  +D D   N  +T  I    +  F I+   G++++  VL+RE K+ Y L ++A D      + +   G++ + + D NDN+PI
Sbjct:  326 DANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIG-------RSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVI-VNATATDPDQGSNAAITYSMSYPG-------FAINSNTGSVTITRPLDRET--KQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDV--IDRTPVGTIVLAVNAEDRDVGNNG--------HVTYAILI---LPFIIVPDTGNINTSSKLDREQQSL-YTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGV------FSIEPSTGQIRLQKAINREAK-ENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQ------VNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARD---QGAVPYMDFGTIDVHVIDKNDNTPI 850          

HSP 2 Score: 169.088 bits (427), Expect = 3.866e-43
Identity = 176/677 (26.00%), Postives = 294/677 (43.43%), Query Frame = 2
Query:  377 DLNDNAPHW-PKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSP-PLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI-SHNGMLQSVAVLDREEKEEYKLT--LIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHR---------NFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDD 2356
            DLNDN P + P     ++ EN+ +GT      A D D  +            S      F           +++  ++DRE ND   L I  TD G P   T   I  ++ILD NDN P FS  +Y  S++EN      + +  S +  D         ++ ++ +DS++  FA+N   G I  R+      D     +Y+F V+A D       S   V+I+++D ND  P   +  S++  TI E  ++ + +  V+ +D D G+NG+   F   + G +  F+   SD ++         DRE +A     ++  D           +TV + DVNDN P F+ PA +  + E   +G+V+    A D D+G N+ + Y +S        +P F I SN G++ + + LDR    + +S  V   D G   L + + + + + D N+  P F    +        +D +   P    +  +   D D G N  +T AI   I  F I    G + + + LDRE++  Y L   ++ +  T     + T    + I + D NDN P F++         N P+ TKV+           +   D+DSG N+ +  S+  G     FSI+     ++L + +  E +  + + +   DRG P  SS  ++ + + D
Sbjct:  106 DLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGL---FRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQ--FAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRF-IPSSIQS-TISEAASIGQSVARVTANDPDSGLNGR--IFFSINSGSEGKFEIGRSDGVV---RVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS--------YPGFAINSNTGSVTITRPLDRETK-QAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQ-------TDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL--ILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTM----------VTARDEDSGINSQIMYSLTGG--DGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLD 738          

HSP 3 Score: 155.221 bits (391), Expect = 1.172e-38
Identity = 149/571 (26.09%), Postives = 255/571 (44.66%), Query Frame = 2
Query:  725 PTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRH--FAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIP-SLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGT---VVTKVRALDKDEGLNSQLIYHIS---------DPRT---TNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNI-NKFQISH-NGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPK 2377
            P F+   Y  +  E      +L   V A D D G  G + Y     N    + +  F ++   G I+  ++L+       SY+  + A DHG P+ S++T V I + D+ND  P+   N +    T+FEN+ +   ++DV+  D D G N  +  + +       LF+          +      DRE   F   TIT  D G+P S T+  +  V I+D NDN+P FS    + SI E+S  G    + + + A D+D   N+ + Y ++         +PRT   T ++ PP  ++           +R  +   ++  V+ +D       +  E+ I+++D N+  P F  S+   T+ E  S         +++  +  +D D G+N ++  +I      KF+I   +G+++    LDRE K  Y L + AIDG+   +  +   G+V + L D+NDN+P F +       VS    V   ++     D D G+NA +  S+      P F+I+ +  SV + R L  E +  +   V  +D G     S++ + + I D    SP+
Sbjct:    1 PVFTPASYNATFTEGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQ--TFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPV--FNPTNYSTTVFENSPVGTSLLDVTATDADSGQNA-YVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDH----------ERTTN---YTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAAS-------IGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGY---GTVTVTLQDVNDNTPKFTKP-AFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS----YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQ 536          

HSP 4 Score: 144.05 bits (362), Expect = 3.169e-35
Identity = 149/580 (25.69%), Postives = 257/580 (44.31%), Query Frame = 2
Query:  602 SIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDRE-KEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVI-----VVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQIS-HNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPP 2317
            S+D E        ++  D           + I +LD NDN P F       ++ E   +   +   V+A D DSG  G++ +  S+++    K  F I  ++G +R+  SLD ++  +  Y   V A D          TV + + DVND  P     K   ++ + E   +   IV+ +  D DQG N     + + + GF +    N   + I + +     DRE K+A+++T +   D G   L S+  + V I D NDN P F        +++ +P+GT+V  V A D+D G N  + Y I        + P  ++   GN+  +  LDR     +++++     + V+DHG    ++   + I++ D N+  P FNQS +  TV E+    +P+  K   +  +   D D G+N+Q+  ++      F I    G ++    ++RE KE Y +T+ A D GTP +    +    V + + D+NDN P+F       T           ++ +   D D   N  V  +I  G +   F+I+     ++    L  E +  + LIV+ +D+G  P
Sbjct:  291 SLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVA-RVTANDPDSGLNGRIFF--SINSGSEGK--FEIGRSDGVVRVSGSLDREA--KAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTP--KFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAI-TYSMSYPGFAI--NSNTGSVTITRPL-----DRETKQAYSFT-VHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI-------LILPFIIVPDTGNINTSSKLDREQQ-SLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLEN----MPVGTK---VTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVL----SSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALG-MFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVP 830          

HSP 5 Score: 124.405 bits (311), Expect = 5.169e-29
Identity = 164/680 (24.12%), Postives = 289/680 (42.50%), Query Frame = 2
Query:  587 LKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTV-IINIVDVNDELPIISLNKSLKDITIFENNNLNEPI-VDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKH-----------KFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAV----SDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLS--IKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLI-----VIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVD 2551
            +K   +++R+      L I   D G P  +    ++I + D+NDN P F+   Y  ++ EN  + + L ++V+A D DSG    ++Y  +  ++  + R     S +G I +  +LD +  N+  Y+  + A D G P   ++  + ++ I+D ND +P  S  +     +I EN+    P+ +  S+   D+ I              D+ ++ N SD I + +  +              D E+       +   D       S   + + ++D NDN P F   +   +I E + IG  V +V A D D GLN ++ + I+    +   F   +  S+G + V+  LDR     ++ + V   D           +T+ L D+N+  P F +  F+  V E  +           +G + V    +D D+G NA +T ++      F I+ N G +     LDRE K+ Y  T+ A DG     +   V  +V + + D NDNSP F       T V  +  V   ++A+  ED+D G N  V  +  I P II P      D  ++  + KL  E Q ++ L+     +   D G    +S   + I++ D           FN+++ + N+       A ++  + +G+ +T+V  +         I Y L   D
Sbjct:   66 IKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSL-LDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREV-NDF-YNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTG--SIQENSGPGVPVQMASSIMATDRDI----------ESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSIN--SGSEGKFE--IGRSDGVVRVSGSLDREAKA-VYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVA-----------VGSVIVNATATDPDQGSNAAITYSMS--YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG---GLESNV--AVNVEIGDENDNSPQFP-TVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILPFIIVP------DTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTD-----------FNDNQPQFNQSEYS---ATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGD 686          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 267.314 bits (682), Expect = 4.156e-74
Identity = 223/770 (28.96%), Postives = 354/770 (45.97%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD--------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL-AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY---KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                           +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    S + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP      TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L     +    +   Y L      D E        I   D G PSLTS+  + V + D NDN P FS      S  E++  G  VT V A D D G N+++ Y +    + N +F   +   +G++ VN +LDR    E +   V+  D G   L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA++ L   ++       +  G + S    DRE+K  Y   + A+DG        + T +V +F+ D NDN+P     FP+ +  +       VR  +  +   D D+G NA ++ SI  G     F ID     + L  KL+ +H G+H+L+V   D G+P +S++  + + ++++  LS   +V    ++                 ++K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  131 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPI-LQLKAADADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVSQL--RFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDS--SVNGIFS--IDSDSGDIRVNTNLDREQK-ERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSP-------VGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTV--TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNET--LSNSTIVETQVARSLSTSLNTNIAGDPNYDLSKQRLSIVIGVVSGIMTVILIILVVVMARYCRPKNK 877          

HSP 2 Score: 135.191 bits (339), Expect = 9.132e-32
Identity = 160/631 (25.36%), Postives = 266/631 (42.16%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDS------------VKRHF-------------AINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN-----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGS--VVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL------IALFVEDKDSGANAVVDL-----------SIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N ++             KR F               ++T+GE   +LI     D     SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE+ +    T+   D G P       + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E   N     L  +  LD     E ++V++V  D G P+L++   + + + D N+ PP+F+++    + PE+ +      P  R +  +  +D D G NA+++ ++  ++N  F I S +G ++    LDRE+KE Y+  +IA D     +  +T+ GS  VV+ ++D NDN P F ++        +  YV+  L        + V D D G NA + L             + G I    S DR             E +  +   V   D G PP+S++  + + + D    +P      N S
Sbjct:  129 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNP--RFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVG-DVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQE-YNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNA------PGER-VTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKD-----KGINTLQGSATVVVLVDDKNDNEPKFMQDV-------FTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDR-------------EQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSS 717          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 266.159 bits (679), Expect = 4.333e-74
Identity = 223/770 (28.96%), Postives = 354/770 (45.97%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD--------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL-AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY---KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                           +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    S + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP      TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L     +    +   Y L      D E        I   D G PSLTS+  + V + D NDN P FS      S  E++  G  VT V A D D G N+++ Y +    + N +F   +   +G++ VN +LDR    E +   V+  D G   L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA++ L   ++       +  G + S    DRE+K  Y   + A+DG        + T +V +F+ D NDN+P     FP+ +  +       VR  +  +   D D+G NA ++ SI  G     F ID     + L  KL+ +H G+H+L+V   D G+P +S++  + + ++++  LS   +V    ++                 ++K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  131 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPI-LQLKAADADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVSQL--RFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDS--SVNGIFS--IDSDSGDIRVNTNLDR-EQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSP-------VGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTV--TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNET--LSNSTIVETQVARSLSTSLNTNIAGDPNYDLSKQRLSIVIGVVSGIMTVILIILVVVMARYCRPKNK 877          

HSP 2 Score: 134.42 bits (337), Expect = 1.734e-31
Identity = 160/631 (25.36%), Postives = 266/631 (42.16%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDS------------VKRHF-------------AINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN-----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGS--VVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL------IALFVEDKDSGANAVVDL-----------SIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N ++             KR F               ++T+GE   +LI     D     SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE+ +    T+   D G P       + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E   N     L  +  LD     E ++V++V  D G P+L++   + + + D N+ PP+F+++    + PE+ +      P  R +  +  +D D G NA+++ ++  ++N  F I S +G ++    LDRE+KE Y+  +IA D     +  +T+ GS  VV+ ++D NDN P F ++        +  YV+  L        + V D D G NA + L             + G I    S DR             E +  +   V   D G PP+S++  + + + D    +P      N S
Sbjct:  129 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNP--RFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVG-DVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQE-YNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNA------PGER-VTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKD-----KGINTLQGSATVVVLVDDKNDNEPKFMQDV-------FTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDR-------------EQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSS 717          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 266.929 bits (681), Expect = 7.081e-74
Identity = 223/770 (28.96%), Postives = 354/770 (45.97%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD--------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL-AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY---KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                           +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    S + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP      TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L     +    +   Y L      D E        I   D G PSLTS+  + V + D NDN P FS      S  E++  G  VT V A D D G N+++ Y +    + N +F   +   +G++ VN +LDR    E +   V+  D G   L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA++ L   ++       +  G + S    DRE+K  Y   + A+DG        + T +V +F+ D NDN+P     FP+ +  +       VR  +  +   D D+G NA ++ SI  G     F ID     + L  KL+ +H G+H+L+V   D G+P +S++  + + ++++  LS   +V    ++                 ++K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  131 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPI-LQLKAADADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVSQL--RFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDS--SVNGIFS--IDSDSGDIRVNTNLDREQK-ERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSP-------VGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTV--TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNET--LSNSTIVETQVARSLSTSLNTNIAGDPNYDLSKQRLSIVIGVVSGIMTVILIILVVVMARYCRPKNK 877          

HSP 2 Score: 135.191 bits (339), Expect = 1.101e-31
Identity = 159/631 (25.20%), Postives = 268/631 (42.47%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDS------------VKRHF-------------AINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN-----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGS--VVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL------IALFVEDKDSGANAVVDL-----------SIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N ++             KR F               ++T+GE   +LI     D     SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE+ +    T+   D G P       + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E   N     L  +  LD     E ++V++V  D G P+L++   + + + D N+ PP+F+++    + PE+ +      P  R +  +  +D D G NA+++ ++  ++N  F I S +G ++    LDRE+KE Y+  +IA D     +  +T+ GS  VV+ ++D NDN P F ++        +  YV+  L        + V D D G NA + L             + G I    S DR++++              +   V   D G PP+S++  + + + D    +P      N S
Sbjct:  129 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNP--RFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVG-DVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQE-YNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNA------PGER-VTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKD-----KGINTLQGSATVVVLVDDKNDNEPKFMQDV-------FTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTT-------------YTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSS 717          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 266.929 bits (681), Expect = 7.354e-74
Identity = 223/770 (28.96%), Postives = 354/770 (45.97%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLD--------------------------RXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNK----SLKD--ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL---SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTL-AIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSY---KEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKE---------------KINKEMIVITIAVIISVLALGSFITIVIIK--CRKKAK 2515
            D+NDN P +P P+  LS+ EN  IGTL+ +P A D D                           +   K+   +   +SS F+L    T D  + P+L +K ++DRE  D  EL + + D G PP + + I+ + I DVNDN P F    Y   L EN    S + + + A D D G  G++ Y    + T+SV+R   ++ + G + ++  +D +  ++L   F V+A D GQP      TV++NI D ND +P I + K     LKD    + E+  ++ PI  V V D DQG NG   C ++G   F L     +    +   Y L      D E        I   D G PSLTS+  + V + D NDN P FS      S  E++  G  VT V A D D G N+++ Y +    + N +F   +   +G++ VN +LDR    E +   V+  D G   L     + + + D N+  P F Q  F F V E+   + P       +G + V D DKG NA++ L   ++       +  G + S    DRE+K  Y   + A+DG        + T +V +F+ D NDN+P     FP+ +  +       VR  +  +   D D+G NA ++ SI  G     F ID     + L  KL+ +H G+H+L+V   D G+P +S++  + + ++++  LS   +V    ++                 ++K+ + I I V+  ++ +   I +V++   CR K K
Sbjct:  135 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPI-LQLKAADADVGVNGQIEYVFGAA-TESVRRLLRLDESTGWLSVLHRIDREEVSQL--RFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDS--SVNGIFS--IDSDSGDIRVNTNLDREQK-ERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSP-------VGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGG---DPPRSATATVSLFVMDENDNAPTV--TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNET--LSNSTIVETQVARSLSTSLNTNIAGDPNYDLSKQRLSIVIGVVSGIMTVILIILVVVMARYCRPKNK 881          

HSP 2 Score: 135.191 bits (339), Expect = 1.113e-31
Identity = 160/631 (25.36%), Postives = 266/631 (42.16%), Query Frame = 2
Query:  701 ILDVNDNYPTFSTHKYIISLRENFQLNS--LLPINVSAVDCDSGNFGKLSYKHSVSNTDS------------VKRHF-------------AINSTNGEI--RLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFN-CFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATS--------FSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGN-----LLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINK-FQI-SHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGS--VVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHEL------IALFVEDKDSGANAVVDL-----------SIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNES 2401
            ILD+NDN P+F +    +S+ EN  + +  LLP   +A D D G  G   Y+    N ++             KR F               ++T+GE   +LI     D     SY   +   D G P  SS   + + I DVND  P     KS+ +  + EN++   PI+ +   D D G+NGQ    F    +    L + + S   +  L   H+ DRE+ +    T+   D G P       + + I D NDN+P   +             ++ E   + T +  V+  D+D+G N  +   +       Q+ P   +E   N     L  +  LD     E ++V++V  D G P+L++   + + + D N+ PP+F+++    + PE+ +      P  R +  +  +D D G NA+++ ++  ++N  F I S +G ++    LDRE+KE Y+  +IA D     +  +T+ GS  VV+ ++D NDN P F ++        +  YV+  L        + V D D G NA + L             + G I    S DR             E +  +   V   D G PP+S++  + + + D    +P      N S
Sbjct:  133 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLP---TATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNP--RFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVL---HRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVG-DVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQE-YNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNA------PGER-VTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKD-----KGINTLQGSATVVVLVDDKNDNEPKFMQDV-------FTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDR-------------EQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSS 721          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 245.743 bits (626), Expect = 2.524e-67
Identity = 213/693 (30.74%), Postives = 321/693 (46.32%), Query Frame = 2
Query:  377 DLNDNAPHWPKPI-ELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXX--XSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYK-HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDI------TIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTT--------------ITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHE-----LIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDS 2359
            D+NDN P +  PI  LSI EN   GTLF+IP AVD D                 +  F L      DE + P++ +  ++DRE  D  +L I + D G PP     ++ I + D NDN P F  ++Y   L EN      + + V A D D+G  G + Y  H  S  D+V+R   I+ + G I +   +D +  N L   F VVA D G  + SS   V I+I D ND  P I +      I       I E+  +  P+  V V D D+G N    C + G   F L            +  ++   DR+++ F  TT              I   D G P+L+S+  + V + D+NDN P+FS      +  E +  G  V  V A D D G+N++L+Y I +    +     F I SN G + V   LDR  D E +   V  +D G P+ +    + IN+ D N+  P F  S + F+V E   +  PL P    +G + VSD DKG N+Q+TL ++ +  KF I +  G + S    DRE++  Y   L A+D G P    R +  G V I + D NDN+P   +    P   SY            +  +  ED D+G NA +  +I  G     F I  +   +KL +    +H+G+H+L+V   D+G+PP+ ++  + + ++++
Sbjct:  143 DINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDE-KIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSV-LQVRANDADTGANGDIDYSLHQAS--DTVQRLLRIDRSTGIIYVKGLVDREEDNLL--KFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQL------------RPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASL----FEINSNTGEIRVRNQLDR-EDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNE---NMPPLNP----VGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPP---RSSYVG-VTINVLDENDNAPYVTK----PANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNET 797          

HSP 2 Score: 148.288 bits (373), Expect = 7.479e-36
Identity = 185/651 (28.42%), Postives = 281/651 (43.16%), Query Frame = 2
Query:  605 IDRET---------NDR--IELVILLTDS----GSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNG------EIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDL---LFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSF--------SILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEI---FSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPED--PSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDN--INKFQISHN-GMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIF---------HRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP-----------GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSP 2374
            IDRET         +D+  +E  + +TD     G  P   EGII  ++LD+NDN P FS+    +S+ EN    +L  I V AVD DSG+ G   Y  ++S      + F +           ++ +I +LD +  +  SY   +   D G+P  +SS  + I + D ND  P     K+  +  + EN+     ++ V  +D D G NG  +  L  H+  D    L + + S  IIY    K   DRE++      +   D G  S +S   +T+ I D NDN P   +             +I E  PIGT V  V+  D+DEG N+ ++  +       Q+ P     ++           LLD E    + + +V  D G PALS+   + + + DIN+  P F+ +       ED  P D +        I  +A +D D GVNA+L  +I ++   + F+I+ N G ++    LDRE+ E Y+  + A D G P      T T  VVI + D NDN P F         + N P    V            + V D D G N+ V L ++P           G I    S DR+++S    R LK+             D G PP+SS + + I + D    +P
Sbjct:   96 IDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGII--EVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPV-AVDRDSGSNGVAEY--ALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKD--SYDLNIRVVDGGKPPRASSALLRITVTDQNDNAP--KFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSL--HQASDTVQRLLRIDRSTGIIY---VKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENA-VVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKV--------IDVVA-TDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVP----SKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVG----------VVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFR-LKA------------VDAGDPPRSSYVGVTINVLDENDNAP 695          

HSP 3 Score: 135.576 bits (340), Expect = 6.032e-32
Identity = 137/511 (26.81%), Postives = 233/511 (45.60%), Query Frame = 2
Query:  593 LKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLN--SLLPIN-----VSAVDCDSGN--------FGKLSYK---HSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESN-GNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDIN-NCPPVFNQSTFHFTVPEDPSDHL-PLVPKPRNIGYIAVSDCDKGVNAQL--TLAIKDNINKFQISHN-GMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDN 2050
            +K  +DRE ++ ++  ++  D G    + +  +TI I D NDN P        + + +NF  N    +PI      V   D D G          G + ++    S S  D  +++F        ++    LDY+   +  Y   +VA D G PALSS+ ++ + + D+ND  P  S + +L ++   E+N   + ++DV   D D G+N +   + I       LF+ N +     ++  +++ DRE        +   D G+PS T + ++ + + D NDN P F +   SFS+ E+ P    V  V   D D+G NSQ+   + +P         F+I++  G +L +   DR  +   ++  +   D G P  S+ + +TIN++D N N P V   +   +T       HL P  P    +  +   D D GVNA+L  T+   +    FQISHN G ++       + K  ++L +   D G P    RHT T  V +++N+  +N
Sbjct:  324 VKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYF--------LQTTTLLDYERIKD--YRIEIVAVDSGNPALSSTNSLKVQVTDINDNTP--SFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAEL-VYSIIESSAASLFEINSN---TGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFV-EPDNGK-----FIIQNGTGTILSSISFDREKE-STYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYT-------HLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPP---RHT-TALVHVYVNETTNN 800          

HSP 4 Score: 127.102 bits (318), Expect = 2.933e-29
Identity = 128/478 (26.78%), Postives = 209/478 (43.72%), Query Frame = 2
Query: 1025 IINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLS---DLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFN--------QSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQI----------SHNGMLQSVAVLDREEKEEYKLTLIAID-GTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKE--YVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMV 2386
            II ++D+ND  P  S    +  ++I EN +           D D G NG     L      + LF   ++   D  I Q++     DREK+      I   D G P   SS L+ + + D NDN P F        + E+SP G  V +VRA D D G N  + Y +     T Q     +  S G + V   +DR  D  +    VV  D G  + S++ ++TI++ D N+  P              F   + ED       +P    +  + VSD D+G NA +T  +  ++  FQ+               LQ+  +LD E  ++Y++ ++A+D G P +    + T S+ + + D+NDN+P F    P   +V++ E      ++I +   D DSG NA +  SI     A  F I+ +   +++  +L  E    ++  V   D+G P K+ +  + I ++D     PK M+
Sbjct:  138 IIEVLDINDNTPQFS--SPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRL-LRIDRSTGIIYVKGLVDREED-NLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISED-------MPIGTPVALVQVSDRDEGENAVVTCVVAGDV-PFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPAL----SSTNSLKVQVTDINDNTPSFS---PALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFML 596          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000044242.1 (SMESG000044242.1)

HSP 1 Score: 1730.69 bits (4481), Expect = 0.000e+0
Identity = 890/895 (99.44%), Postives = 892/895 (99.66%), Query Frame = 2
Query:   77 MSIIDRDSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTLEYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEISDMDISMNFKVFNEENCMECQRIKTQNDLIQNHNKLCLSSVYDIKQPSVMPDNLISCFLSP 2761
            MSIIDRDSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTLEYCMTKLFIIINNVIVKVINIIINDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRTKKNKQITYKIKKQSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFA+TTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSV VVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREE EEYKLTLIAIDGTPDVQIRHTVTGSVVI LNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEISD+DISMNFKVFNEENCMECQRIKTQNDLIQNHNKLCLSSVYDIKQPSVMPDNLISCFLSP
Sbjct:    1 MSIIDRDSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTLEYCMTKLFIIINNVIVKVINIIINDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRTKKNKQITYKIKKQSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAHTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVTVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREENEEYKLTLIAIDGTPDVQIRHTVTGSVVISLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEISDIDISMNFKVFNEENCMECQRIKTQNDLIQNHNKLCLSSVYDIKQPSVMPDNLISCFLSP 895          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000070713.1 (SMESG000070713.1)

HSP 1 Score: 416.772 bits (1070), Expect = 4.416e-129
Identity = 301/878 (34.28%), Postives = 461/878 (52.51%), Query Frame = 2
Query:   80 SIIDRDSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTL--EYCMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKDITIF----ENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHR--NFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKP-GIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLS-PKNMVHF----NESKEKINKEMIVITIAVIISVLAL------GSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEISD-----MDISMNFKVFNEENCMEC 2638
            S  D   +T+SV+E  PV   +++L+N L +  N++  F+ L+   YFRL+  G I +   LD DND  LC  +   + C T   + + +  V  + I+INDLNDN P W     +SI+EN+ I    ++P A+D D      +    + K    F+L    + +    PKL +K+++DRE      L +   D   P  TG  ++ I+I D NDN P F    Y +S+ ENF +++ LPI+ +A+D DSG FG++SY  S++  + VK  F+I+  +G+I + K++DYDSG  L Y F++VA D G PA SS+ ++II I DVND+ P I++     +   F    ENN  N  +  ++V D D G  G+FNC L     F + F + L  + IYQL+    FDRE E+  +T I C D G P   S +LITV I D+NDN P FS     F   E +   + V +V   D D G NS++ Y I    +T+    PF I++ G +     +DR +    F   +V  D G P L++ +E+ I +IDIN+C P+FN++ + F + E+      L   P +IG +  +DCD G N ++T  + +  NKFQIS  G+L+ +  +DRE +  Y  T++AID  P    R+T T  V I ++D NDN P+F +  N   P KVSY+E +  E+  +  +D D G NA++   IK    +   F ID    S+ + ++L S HQG   L ++  D G P  SS +E++I IDDS P S P N   F    N+    I     V+  A++ISV+ L       S    V +   +    P+  +  +   K  +S  + +D     +++S NF + N +    C
Sbjct:   19 SQFDSTILTISVDENTPVGRKISNLRNELKLN-NTNVTFSPLN-SLYFRLAKHGDIFIQHSLDRDNDPILCADSGFPDTCSTTHVVWLGSTTVISLRILINDLNDNKPFWSAIPTVSIAENSPINIEVDLPLAIDKDTNTNGIERYELLTKNVVEFELKNQQSPN-GIIPKLIIKTNLDREKVSSYNLTLAAIDGSRPHHTGTVVLFIEIADQNDNSPIFEKSTYRVSIFENFTVSTYLPIHPNAIDADSGKFGEISYYFSIATPEDVKNIFSIDRISGKILVEKNIDYDSGKVL-YEFIIVAIDGGSPAFSSTASIIIEINDVNDQAPAIAITHISDETNSFLEFPENNLSNSLVTTITVSDSDTGDGGKFNCSLSLTNSFTMNFYKLLDQISIYQLITVRPFDRETESNIHTQILCQDKGNPVKYSKKLITVNISDINDNPPRFSQTKYRFQFKEENNPNSKVGEVFVTDNDIGNNSRIEYFIV---STDGAKVPFRIDNKGIINATVRIDREIHHNGFKFQIVAKDCGTPYLNDSVEVEIEIIDINDCVPIFNKTEYPFQIIENDGVKSSL---PLSIGLVDATDCDIGNNGKITFKLGEPSNKFQISEKGLLEQIDFVDRENQSFYSFTVLAIDSIPMSLRRNTGTTIVSIRVDDRNDNPPVFIQSINVSNPIKVSYEEEIGFEIHRVQTKDADVGLNAIITYKIKSNNYVNEIFVIDEKSGSITIAKRLTSSHQGEKTLHIVATDLGSPSLSSEMELKIIIDDSSPNSQPPNANRFLINNNKLIIIIVVIATVLVCAILISVICLMVNCKFSSHRNGVTMTYEEDGTKPIRGFPYQGYPKYDLSNGKFTDVNESLLNLSSNFYLINNQQSTNC 886          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000063589.1 (SMESG000063589.1)

HSP 1 Score: 345.895 bits (886), Expect = 5.016e-103
Identity = 266/867 (30.68%), Postives = 429/867 (49.48%), Query Frame = 2
Query:   65 FIFSMSIIDR-DSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNM-----LHVHSYFRLSSSGIISVARQLDCDNDSNLC-DKTLEY--CMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRX-XXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKD--------ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS------DPRTTNQMFPPFLIESNGNLLVNQHLDRL--LDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFH--RNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELE----NVDKKAVSM 2569
            FIF +S ++  + +++S+ E  P+N  V +L+  +     S   F       L  + YF ++ +  + V   +D D + +LC + T E+    T + +     ++  + I I D+NDN P W  PI + I EN   G   ++  A D D      ++      K SS F L   P       P+L + + +D E      L +   D   P  +G   I+I+ILD NDN P F    + +++ EN+ L   L +N++AVD DSG FG + Y  S S+     + F+IN+ +G I +I+++DYD G +L ++F+VVA D G P LSS   V I I DVND+ P I +N             ++I ENN++ + +  +S  D D   +   NC L     F L+F++N++ + IY+L+A   FDRE  +    T+ C D G P +TSS+ + +I+ DVNDN P F     S+ + E +   T++ K+RA D D G N +L Y+IS      DPR      P   +  NG ++  Q LDR   L G  F +I +  D G    S    + I+L DIN+C P F+  ++ F + ED    +  + +P+ +G I V+D D G N   +  I    + F+I  N  +++   +DRE ++ Y LT++A+DG  D +IRHT +  V I + D+NDN+P F+  +N  +P  VS  E        L   D D G NA V   I  G I   F I+     + +   ++S+ +    + ++ +D G P  SS++ I+I + D+  +  +     N +        I+I I V I+ +     ITI+ +  R        C  L     ++D++A +M
Sbjct:   12 FIFKLSSMNSINKLSVSIYENVPLNVSVVNLRPEIE---KSQKDFKYELLMGLSQNKYFYVNKNYDLIVLTNIDRDRNPDLCKEMTTEFLCVWTGVIMFEGYNVIISLRIEIKDVNDNIPFWNHPILIEIMENNPPGKTIDLTQAQDDDSPPNNVQRYELMSNKYSSIFRLTKEP-GPSGIIPRLTILTVLDHEKYKEFSLTLNAFDGAYPYHSGSVNISIKILDQNDNAPKFEKSHFSLTIPENYPLFKPLMLNLTAVDDDSGQFGSVIYYISESSPPDSLKKFSINN-HGIITVIRNIDYDIGEKL-FTFIVVAKDQGNPPLSSLAMVKITIKDVNDQPPTILINSYSTSGSKNNPSVLSIVENNSIGQAVARISATDSDSFESDFCNCTLTHFSDFQLVFERNVAKMTIYRLIANKVFDRETRSIIKVTVICSDTGYPPMTSSETLRIIVEDVNDNNPIFDKNVYSYVVAEENAPNTIIAKLRATDDDAGKNGKLTYNISPNSKFRDPR------PAIKVNENGEIIAVQPLDRESNLQGYKFQIIAI--DQGDNPRSGTTIVVIHLNDINDCKPKFSDDSYFFQLEEDSG--ISSIFRPKIVGSIKVTDADIGKNGISSFEILPKNSPFKIDENKYIKTTRFIDREHRKNYMLTVLAVDGLADSEIRHTTSTVVNITVTDVNDNAPQFYIPKNLSIPINVSLYEEPGFVFTNLQATDSDEGENARVTYHISGGNIFGLFEIESQTGRLSVRDHIQSKLKVPFTVTILARDHGTPSLSSTVVIRILLTDTPAIGTEINKLNNRTASSTQTNQILIMIIVTITCVICIGLITIICLMARGIVFRQRYCKTLSEKQMSMDERASTM 862          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000063589.1 (SMESG000063589.1)

HSP 1 Score: 341.273 bits (874), Expect = 1.510e-101
Identity = 262/856 (30.61%), Postives = 422/856 (49.30%), Query Frame = 2
Query:   95 DSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNM-----LHVHSYFRLSSSGIISVARQLDCDNDSNLC-DKTLEY--CMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDLDRX-XXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKSLKD--------ITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHIS------DPRTTNQMFPPFLIESNGNLLVNQHLDRL--LDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFH--RNFPLPTKVSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELE----NVDKKAVSM 2569
            + +++S+ E  P+N  V +L+  +     S   F       L  + YF ++ +  + V   +D D + +LC + T E+    T + +     ++  + I I D+NDN P W  PI + I EN   G   ++  A D D      ++      K SS F L   P       P+L + + +D E      L +   D   P  +G   I+I+ILD NDN P F    + +++ EN+ L   L +N++AVD DSG FG + Y  S S+     + F+IN+ +G I +I+++DYD G +L ++F+VVA D G P LSS   V I I DVND+ P I +N             ++I ENN++ + +  +S  D D   +   NC L     F L+F++N++ + IY+L+A   FDRE  +    T+ C D G P +TSS+ + +I+ DVNDN P F     S+ + E +   T++ K+RA D D G N +L Y+IS      DPR      P   +  NG ++  Q LDR   L G  F +I +  D G    S    + I+L DIN+C P F+  ++ F + ED    +  + +P+ +G I V+D D G N   +  I    + F+I  N  +++   +DRE ++ Y LT++A+DG  D +IRHT +  V I + D+NDN+P F+  +N  +P  VS  E        L   D D G NA V   I  G I   F I+     + +   ++S+ +    + ++ +D G P  SS++ I+I + D+  +  +     N +        I+I I V I+ +     ITI+ +  R        C  L     ++D++A +M
Sbjct:    5 NKLSVSIYENVPLNVSVVNLRPEIE---KSQKDFKYELLMGLSQNKYFYVNKNYDLIVLTNIDRDRNPDLCKEMTTEFLCVWTGVIMFEGYNVIISLRIEIKDVNDNIPFWNHPILIEIMENNPPGKTIDLTQAQDDDSPPNNVQRYELMSNKYSSIFRLTKEP-GPSGIIPRLTILTVLDHEKYKEFSLTLNAFDGAYPYHSGSVNISIKILDQNDNAPKFEKSHFSLTIPENYPLFKPLMLNLTAVDDDSGQFGSVIYYISESSPPDSLKKFSINN-HGIITVIRNIDYDIGEKL-FTFIVVAKDQGNPPLSSLAMVKITIKDVNDQPPTILINSYSTSGSKNNPSVLSIVENNSIGQAVARISATDSDSFESDFCNCTLTHFSDFQLVFERNVAKMTIYRLIANKVFDRETRSIIKVTVICSDTGYPPMTSSETLRIIVEDVNDNNPIFDKNVYSYVVAEENAPNTIIAKLRATDDDAGKNGKLTYNISPNSKFRDPR------PAIKVNENGEIIAVQPLDRESNLQGYKFQIIAI--DQGDNPRSGTTIVVIHLNDINDCKPKFSDDSYFFQLEEDSG--ISSIFRPKIVGSIKVTDADIGKNGISSFEILPKNSPFKIDENKYIKTTRFIDREHRKNYMLTVLAVDGLADSEIRHTTSTVVNITVTDVNDNAPQFYIPKNLSIPINVSLYEEPGFVFTNLQATDSDEGENARVTYHISGGNIFGLFEIESQTGRLSVRDHIQSKLKVPFTVTILARDHGTPSLSSTVVIRILLTDTPAIGTEINKLNNRTASSTQTNQILIMIIVTITCVICIGLITIICLMARGIVFRQRYCKTLSEKQMSMDERASTM 844          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000022902.1 (SMESG000022902.1)

HSP 1 Score: 307.375 bits (786), Expect = 8.750e-90
Identity = 253/865 (29.25%), Postives = 418/865 (48.32%), Query Frame = 2
Query:   71 FSMSII-DRDSITLSVEERFPVNYFVTDLKNILAIPLNSSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTLEY---CMTKLFXXXXXXXXXXXXXXXXDLNDNAPHWP-KPIELSISENAFIGTLFNIPPAVDLDRXXXXXXXXXXXXXXSSYFDLAFLPTDDEHQFPKLKLK--SSIDRETNDRIELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLNSLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKSLDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISL----NKSLKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIG--HKGFDLLFKQNLSDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVNDNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRTTNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIEITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCDKGVNAQLTLAIKDNIN-KFQI-SHNGMLQSVAVLDREEKE-EYKLTLIAIDGTPDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTK----VSYKEYVRHELIALFVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHKLIVIGKDRGRPPKSSSI-EIQITID-----------DSQPLSPKNMVHFNESKEKINKEMIVITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSM 2569
            +S+SI+ ++  I L ++E   +   + DL+  L      + +F+ L  + YF +  + ++     LD D D  LC  + E+   C     + + N    ++ I IND+NDN P W    I L ISEN   G     P A D D      Q        S ++      + +  + P+L L   S +DRE N    + ++  D G   L+G   ++I+ILD NDN P F +  Y + + E+    + LP+ + A D D+GNFGK++YK S+S    V   F+I+     I   KSL++ S  +  Y F +VA D G P  ++ T++ + IVD N   P I +    + + K+I + EN+ +N  +   +++D D GIN +FNC L G   K F+L   + L  L IY L  K  FDRE E+     I+C D G+P LT SQ I + + D+ND+ P F  P       E +   ++V  + A D D+G N++L Y I  P    Q   PF I+S G L     LDR  + + ++  V+  D+G P+ S    + I L D+N+CPP FN+  + F + ED  +    +   +++G +   D D   NA +   +   IN  F+I S +G + +  ++DRE     +    +A+D   ++  R T T  + + + D+NDN P F   FP  T+    +SY     H +  +   D+D+G NA +   I  G     FS++ D   + LN  LK  ++G   L +   D G+    +++ +I+I I            D +P +    +HF+  +      +I++ +  +IS + +G+   I ++  R+ A       E+E  D K +++
Sbjct:   15 YSISILQNQRQIFLDIDENIEIGTRIIDLQTKLLSNEEKNIKFS-LTSNPYFHIRENSVLYTKSFLDRDKDRELCHNS-EFPANCQWSRLLTLGNGGYYILKITINDVNDNPPKWEINHIHLKISENTQPGYKLEFPLATDDDFGINGIQYYTIFPISSVFY---VSDSGNGERSPRLVLSKGSKLDRELNSWHNMTLVAYDGGINKLSGTVPVSIEILDENDNGPVFQSSFYNVLIDEDIMPGTTLPLRIHAYDLDAGNFGKITYKFSLSTPQHVLEIFSISPNTANIITSKSLNFKSRRKF-YDFEIVAQDGGIPPKTAQTSIKVEIVDKNTHAPEIKVTPMPDPTSKNIIVPENSAINRIVASFTINDKDSGINSKFNCSLTGLNSKDFNLKHSKKLGKLEIYVLETKRSFDRELESLLTVCISCQDQGVPQLTGSQDILIEVEDINDHSPVFQHPEYRLRTTEGNAPNSLVYHILATDMDKGDNARLRYKIIWPDIETQSL-PFKIDSEGRLFAKYVLDREANPQGYTFQVMAFDYGDPSKSASTIVKIELEDLNDCPPKFNRDHYQFQIKEDYGN----IHIRQHVGDVYAEDLDLQENAIVFYRLSQEINVPFEIDSKSGSIYTSKLIDRESVSVPFSFLCMAVDNPFNLLYRKTATVEITVTIIDVNDNKPQFI--FPNETQQDINLSYYARKEHFVGKVIANDQDAGINAKIKYIITQGNALKLFSLNNDTGVINLNTDLKPSNKGYELLTIKAIDSGQFQIHTAVCQIRIKISNFQLITKPEYKDQKPSNESGFLHFDWWEPNKMIIIIILLVTALISCILIGA---ICVMAKRRNA-------EVEKNDIKMINL 856          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH19.774e-6929.46protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH71.824e-6830.45protocadherin 7 [Source:HGNC Symbol;Acc:HGNC:8659][more]
PCDH71.884e-6830.45protocadherin 7 [Source:HGNC Symbol;Acc:HGNC:8659][more]
PCDH12.086e-6829.46protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH91.074e-6531.00protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.685e-5128.10FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-17.578e-4628.45FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-12.933e-3927.86CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-14.150e-2928.09Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-14.150e-2928.09Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan7.677e-5729.15gene:FBgn0024836 transcript:FBtr0339463[more]
stan8.907e-5729.15gene:FBgn0024836 transcript:FBtr0303223[more]
stan8.907e-5729.15gene:FBgn0024836 transcript:FBtr0088214[more]
stan9.143e-5729.15gene:FBgn0024836 transcript:FBtr0304899[more]
stan9.143e-5729.15gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh115.789e-7029.61protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh118.346e-7029.61protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh7b2.745e-6929.34protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
pcdh7b3.128e-6929.34protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
pcdh7b3.734e-6929.34protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emc79.103e-7428.96ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc71.656e-7328.96ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc72.043e-7328.96ER membrane protein complex subunit 7 [Source:Xenb... [more]
emc72.462e-7328.96ER membrane protein complex subunit 7 [Source:Xenb... [more]
pcdh175.241e-6729.54protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh74.372e-7030.59protocadherin 7 [Source:MGI Symbol;Acc:MGI:1860487... [more]
Pcdh79.197e-7030.59protocadherin 7 [Source:MGI Symbol;Acc:MGI:1860487... [more]
Pcdh71.042e-6930.59protocadherin 7 [Source:MGI Symbol;Acc:MGI:1860487... [more]
Pcdh18.471e-6929.46protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh18.471e-6929.46protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN4.694e-6829.46Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|O60245|PCDH7_HUMAN8.760e-6830.45Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 P... [more]
sp|Q9HC56|PCDH9_HUMAN3.406e-6431.00Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q6KEQ9|PC11X_PIG1.944e-6330.00Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q9BZA7|PC11X_HUMAN3.214e-6328.17Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QIB05.373e-9530.40Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A4V3SCX51.341e-9230.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NT483.156e-9031.14Protocadherin delta 1 OS=Paragonimus westermani OX... [more]
A0A419QFC37.999e-9029.07Protocadherin-11 X-linked OS=Clonorchis sinensis O... [more]
A0A158REZ23.395e-8930.49Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.213e-6930.27protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.248e-6930.42protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.640e-6930.42protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh7b4.531e-6929.33protocadherin 7 [Source:NCBI gene;Acc:103034658][more]
pcdh7a1.553e-6828.37protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh112.846e-5727.15protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.12.390e-5027.71pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.15.657e-4725.40pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006996.11.832e-4527.34pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000004042.13.448e-4428.34pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.074e-5830.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354122.946e-5329.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.141e-5028.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482372.383e-4927.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348158.099e-4727.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh7b4.156e-7428.96protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b4.333e-7428.96protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b7.081e-7428.96protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b7.354e-7428.96protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh1b2.524e-6730.74protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044242.10.000e+099.44SMESG000044242.1[more]
SMESG000070713.14.416e-12934.28SMESG000070713.1[more]
SMESG000063589.15.016e-10330.68SMESG000063589.1[more]
SMESG000063589.11.510e-10130.61SMESG000063589.1[more]
SMESG000022902.18.750e-9029.25SMESG000022902.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024873 ID=SMED30024873|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=2961bp
CTGAATTTGGATATTACATGAATCGTTATCCATGCTCTGTTTATATTTAT
TACTTACAAGCCAATTTATATTTAGCATGAGCATCATCGACAGAGACTCA
ATTACCTTGTCTGTGGAGGAAAGATTTCCTGTAAACTATTTCGTTACAGA
CCTGAAAAACATTCTCGCAATTCCACTCAATTCATCCACAAGATTCAATA
TGCTCCATGTCCATTCGTATTTCCGGTTATCAAGCTCTGGGATTATTTCC
GTTGCCCGTCAACTCGACTGTGACAATGATTCAAATCTGTGCGACAAAAC
CTTAGAATACTGTATGACGAAATTGTTTATTATTATAAACAATGTCATCG
TCAAAGTCATAAATATAATCATCAATGATCTCAATGACAATGCTCCGCAC
TGGCCAAAACCCATCGAATTAAGCATATCCGAAAATGCGTTTATTGGGAC
ATTGTTTAACATTCCCCCAGCAGTTGATCTTGATAGAACTAAAAAAAATA
AACAGATTACCTATAAAATAAAAAAACAATCTTCATATTTTGATCTTGCA
TTTTTACCGACAGATGATGAGCATCAGTTTCCTAAGCTTAAATTGAAATC
GTCCATTGACAGGGAAACAAATGATCGAATTGAGCTTGTTATACTACTCA
CAGACTCTGGCAGTCCACCGTTGACCGGTGAAGGAATTATAACCATTCAA
ATCCTAGATGTCAATGATAATTATCCCACATTTTCCACTCACAAATATAT
CATTTCACTCCGGGAAAACTTTCAGTTGAATTCTCTTCTACCAATAAACG
TTTCAGCCGTTGATTGTGATTCCGGAAACTTTGGTAAACTTTCATACAAA
CATTCCGTATCAAACACAGACTCCGTCAAAAGACATTTCGCCATCAATTC
GACAAACGGTGAAATTCGATTGATAAAATCCCTAGATTATGACAGCGGAA
ATGAGTTGTCTTACTCTTTTGTCGTTGTCGCCCATGACCATGGTCAACCG
GCCTTATCCAGCTCGACCACTGTGATCATTAATATCGTCGATGTCAATGA
TGAGTTGCCAATCATTTCTTTGAATAAATCCCTGAAAGATATCACAATAT
TTGAAAATAACAATCTCAATGAACCGATTGTTGATGTTTCGGTGCACGAT
TTAGATCAGGGCATAAACGGCCAATTCAACTGTTTCTTAATTGGACACAA
AGGTTTTGATTTATTGTTCAAACAGAATTTATCAGACTTAATCATATATC
AGTTGATGGCAAAACATAAATTTGACAGGGAGAAAGAGGCATTTGCATAT
ACGACGATTACTTGTTGTGATTATGGGATTCCATCGTTGACTAGTTCGCA
ATTAATTACAGTGATTATAGTCGACGTCAACGATAATCTGCCAACATTTT
CCATGCCAGCCACTTCGTTTTCGATTTTGGAACATAGCCCAATCGGGACG
GTAGTAACAAAAGTTAGAGCACTTGATAAGGATGAAGGTCTTAATTCTCA
ACTCATTTATCACATTTCCGACCCCAGGACTACCAATCAGATGTTTCCTC
CATTCCTCATAGAATCTAATGGCAATTTACTAGTAAACCAACATCTTGAT
AGGCTCCTTGATGGCGAAATCTTTTCTGTCATTGTGGTAGTCAGTGACCA
TGGCAGACCGGCCCTAAGTAATCAGATAGAAATAACAATAAACCTTATAG
ACATTAACAACTGTCCACCAGTATTCAACCAATCAACTTTCCATTTCACC
GTTCCAGAAGATCCTTCAGATCATTTACCCTTGGTACCAAAACCTAGAAA
TATCGGTTATATTGCAGTTTCTGATTGTGATAAAGGGGTCAATGCTCAAC
TTACTCTTGCAATTAAAGACAATATCAACAAATTTCAGATAAGCCATAAT
GGAATGTTGCAATCTGTTGCTGTGCTCGACCGAGAGGAGAAAGAAGAATA
CAAATTGACACTGATTGCAATTGATGGGACCCCAGACGTCCAGATCCGTC
ACACGGTCACTGGCAGTGTGGTCATTTTTTTAAATGATCTCAATGATAAT
TCGCCAATTTTTCATAGAAATTTTCCCTTGCCTACAAAAGTTTCCTACAA
GGAATATGTCAGACACGAATTGATTGCCCTTTTCGTCGAAGACAAAGATT
CCGGTGCTAATGCAGTTGTCGATTTATCAATCAAACCCGGCATTATAGCT
CCGTATTTCTCGATTGATAGGGATCGACAAAGTGTAAAATTAAATAGGAA
ATTGAAGTCCGAACATCAGGGTATTCACAAATTGATAGTCATTGGAAAAG
ATAGAGGAAGACCCCCAAAATCATCAAGTATAGAGATTCAGATTACCATT
GATGATTCGCAGCCTTTATCGCCAAAGAATATGGTTCATTTTAATGAAAG
CAAAGAGAAAATAAATAAAGAAATGATAGTTATAACTATAGCAGTCATTA
TCAGCGTCTTAGCTTTGGGCAGTTTCATAACAATTGTCATCATCAAATGC
AGGAAAAAAGCTAAACCTCCTCTGATATGTTATGAACTAGAAAATGTTGA
CAAAAAGGCCGTCTCAATGCCAGAAATCAGCGACATGGACATTTCAATGA
ATTTCAAAGTATTCAATGAAGAGAACTGTATGGAGTGCCAACGTATAAAA
ACCCAAAACGATTTAATTCAAAACCACAATAAACTTTGTTTATCCTCCGT
CTATGACATTAAACAGCCATCTGTAATGCCAGACAATTTAATTTCGTGTT
TTCTATCCCCGAATCTGATTTCTACGACAATGGCTGAACCAACGGCCACC
TCCAGCCTCCTACCCTTCTACACATGTTGCCAACATACAGACGACCAATT
CAATCAAAAACAAAAATTCGACAGCTCAAATTATTTGAATGAAAACTGTA
TTTCATTATCGCACTTTTTGTACTAGATATATATGTGAGAGAAAAAAATT
GCAAATAAATG
back to top

protein sequence of SMED30024873-orf-1

>SMED30024873-orf-1 ID=SMED30024873-orf-1|Name=SMED30024873-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=965bp
MLCLYLLLTSQFIFSMSIIDRDSITLSVEERFPVNYFVTDLKNILAIPLN
SSTRFNMLHVHSYFRLSSSGIISVARQLDCDNDSNLCDKTLEYCMTKLFI
IINNVIVKVINIIINDLNDNAPHWPKPIELSISENAFIGTLFNIPPAVDL
DRTKKNKQITYKIKKQSSYFDLAFLPTDDEHQFPKLKLKSSIDRETNDRI
ELVILLTDSGSPPLTGEGIITIQILDVNDNYPTFSTHKYIISLRENFQLN
SLLPINVSAVDCDSGNFGKLSYKHSVSNTDSVKRHFAINSTNGEIRLIKS
LDYDSGNELSYSFVVVAHDHGQPALSSSTTVIINIVDVNDELPIISLNKS
LKDITIFENNNLNEPIVDVSVHDLDQGINGQFNCFLIGHKGFDLLFKQNL
SDLIIYQLMAKHKFDREKEAFAYTTITCCDYGIPSLTSSQLITVIIVDVN
DNLPTFSMPATSFSILEHSPIGTVVTKVRALDKDEGLNSQLIYHISDPRT
TNQMFPPFLIESNGNLLVNQHLDRLLDGEIFSVIVVVSDHGRPALSNQIE
ITINLIDINNCPPVFNQSTFHFTVPEDPSDHLPLVPKPRNIGYIAVSDCD
KGVNAQLTLAIKDNINKFQISHNGMLQSVAVLDREEKEEYKLTLIAIDGT
PDVQIRHTVTGSVVIFLNDLNDNSPIFHRNFPLPTKVSYKEYVRHELIAL
FVEDKDSGANAVVDLSIKPGIIAPYFSIDRDRQSVKLNRKLKSEHQGIHK
LIVIGKDRGRPPKSSSIEIQITIDDSQPLSPKNMVHFNESKEKINKEMIV
ITIAVIISVLALGSFITIVIIKCRKKAKPPLICYELENVDKKAVSMPEIS
DMDISMNFKVFNEENCMECQRIKTQNDLIQNHNKLCLSSVYDIKQPSVMP
DNLISCFLSPNLISTTMAEPTATSSLLPFYTCCQHTDDQFNQKQKFDSSN
YLNENCISLSHFLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane