Intermediate filament protein

Overview
NameIntermediate filament protein
Smed IDSMED30024865
Uniprot Best hit60 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1 (E=2.24113e-73)
Length (bp)2214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intermediate filament protein (SMED30024865) t-SNE clustered cells

Violin plots show distribution of expression levels for Intermediate filament protein (SMED30024865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intermediate filament protein (SMED30024865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intermediate filament protein (SMED30024865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Intermediate filament protein ( vim-3 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 5 cell, epidermis and integumental system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30024865

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30024865SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024865SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
non-ciliated epidermisSMED30024865SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
Category 4 cellSMED30024865SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
epidermal cellSMED30024865SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024865SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
Category 4 cellSMED30024865SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
epidermisSMED30024865SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
epidermal cellSMED30024865SMESG000030598.1 dd_Smed_v4_503_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
epidermisSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:26457503whole organismasexual adultcolorimetric in situ hybridization evidence
non-ciliated epidermisSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Category 5 cellSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
parenchymaSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:26457503whole organismasexual adultcolorimetric in situ hybridization evidence
gutSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:26457503whole organismasexual adultcolorimetric in situ hybridization evidence
non-ciliated epidermisSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
Category 5 cellSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
non-ciliated epidermisSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
Category 5 cellSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Category 5 cellSMED30024865SMESG000030598.1 SMED30024865smed_20140614PMID:29357350whole organismasexual adultfluorescence in situ hybridization evidence
epidermisSMED30024865SMESG000030598.1 dd_Smed_v6_503_0_1dd_Smed_v6PMID:30399335whole organismasexual adultcolorimetric in situ hybridization evidence
epidermisSMED30024865SMESG000030598.1 DN315702ncbi_smed_estsPMID:30399335whole organismasexual adultcolorimetric in situ hybridization evidence
neuronSMED30024865SMESG000030598.1 SMESG000030596.1 DN309670ncbi_smed_estsPMID:30399335whole organismasexual adultcolorimetric in situ hybridization evidence
epidermisSMED30024865SMESG000030598.1 SMESG000030596.1 DN309670ncbi_smed_estsPMID:30399335whole organismasexual adultcolorimetric in situ hybridization evidence
epidermisSMED30024865SMESG000030598.1 dd_Smed_v6_503_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
epidermisSMED30024865SMESG000030596.1 SMESG000030598.1 SMESG000030599.1 dd_Smed_v6_364_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Homology
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 125.176 bits (313), Expect = 5.817e-30
Identity = 135/439 (30.75%), Postives = 223/439 (50.80%), Query Frame = 1
Query:  307 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            +TSRS Y   S P           G  Y+ +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   47 STSRSLYA--SSP-----------GGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 125.176 bits (313), Expect = 9.761e-30
Identity = 135/439 (30.75%), Postives = 223/439 (50.80%), Query Frame = 1
Query:  307 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            +TSRS Y   S P           G  Y+ +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   47 STSRSLYA--SSP-----------GGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 125.176 bits (313), Expect = 9.761e-30
Identity = 135/439 (30.75%), Postives = 223/439 (50.80%), Query Frame = 1
Query:  307 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            +TSRS Y   S P           G  Y+ +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   47 STSRSLYA--SSP-----------GGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 114.39 bits (285), Expect = 6.617e-26
Identity = 148/580 (25.52%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  439 RGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLR--------------KRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2097
            R  + A  + ++  +  R QEK DLQ+LN+R A YI++ R LE +N  L   I + +    ++ S IK  YE E+   R  ++   K +A L+ ++  +  E  +L+               RL  LE + +  ++ +     +    EGEL +LR       A + + K   K L+D++  LR+         +  E+ LQ++KE L+F+K I+  E++E      R  T+   +       ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK---KQLQDEM--LRR---------VDAENRLQTMKEELDFQKNIYSEELRE---TKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 115.161 bits (287), Expect = 6.811e-26
Identity = 148/580 (25.52%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  439 RGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLR--------------KRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2097
            R  + A  + ++  +  R QEK DLQ+LN+R A YI++ R LE +N  L   I + +    ++ S IK  YE E+   R  ++   K +A L+ ++  +  E  +L+               RL  LE + +  ++ +     +    EGEL +LR       A + + K   K L+D++  LR+         +  E+ LQ++KE L+F+K I+  E++E      R  T+   +       ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK---KQLQDEM--LRR---------VDAENRLQTMKEELDFQKNIYSEELRE---TKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 234.187 bits (596), Expect = 9.683e-68
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.802 bits (595), Expect = 1.342e-67
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.417 bits (594), Expect = 1.396e-67
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.417 bits (594), Expect = 1.396e-67
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.417 bits (594), Expect = 1.396e-67
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0087512)

HSP 1 Score: 117.087 bits (292), Expect = 6.071e-27
Identity = 150/566 (26.50%), Postives = 263/566 (46.47%), Query Frame = 1
Query:  451 VALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRL--MMLEDINSQYKSTIDKQR-KDISG-FEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELAT---VAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVA-LTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTE-RETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2121
            V   S  +  +  R QEK +LQ LN+R A YI++ R LE +N +L  E+   +    ++ S +K +YE E+   R L++E+ K KA LE  +  L  E DDL+ RL     E   ++  + + + R  +++G +   L + ++F+  Q  ++  E E ++   DDL+K     E E LA + LE++ QSL+E L F+ Q+H  E+ E  +   +   +        +++++ ++L++++ +YE ++   ++E+E  Y  ++Q ++ +  R    +    EE   ++++I  + +++ +LE  NA     +  +  N  +T+R    Q +   E      ++     L E Q L+D K+ L+LEIAAY KLL  EE R+N    G  T    +S   S     A    G     G    + G    S +         +E R  ++Y           KG++ I E D+ G  I L N GT+  +L G  + R+    E    F+   KV   A   I     G        + +    W V N++ + L +++  E  A Y  V A
Sbjct:   30 VGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFED-QAKELALENERLRRQLDDLRK---QLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELE-NLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEY-----SVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNL-VMKKKWPVANSMRSVLANAD-KEDVASYDRVRA 583          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0333166)

HSP 1 Score: 113.62 bits (283), Expect = 8.237e-26
Identity = 146/553 (26.40%), Postives = 257/553 (46.47%), Query Frame = 1
Query:  451 VALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRL--MMLEDINSQYKSTIDKQR-KDISG-FEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELAT---VAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVA-LTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTE-RETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSE 2082
            V   S  +  +  R QEK +LQ LN+R A YI++ R LE +N +L  E+   +    ++ S +K +YE E+   R L++E+ K KA LE  +  L  E DDL+ RL     E   ++  + + + R  +++G +   L + ++F+  Q  ++  E E    LR  L  LR+  E E LA + LE++ QSL+E L F+ Q+H  E+ E  +   +   +        +++++ ++L++++ +YE ++   ++E+E  Y  ++Q ++ +  R    +    EE   ++++I  + +++ +LE  NA     +  +  N  +T+R    Q +   E      ++     L E Q L+D K+ L+LEIAAY KLL  EE R+N    G  T    +S   S     A    G     G    + G    S +         +E R  ++Y           KG++ I E D+ G  I L N GT+  +L G  + R+    E    F+   KV   A   I     G        + +    W V N++ + L +++
Sbjct:   30 VGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFED-QAKELALENER---LRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELE-NLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEY-----SVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNL-VMKKKWPVANSMRSVLANAD 571          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 112.079 bits (279), Expect = 2.859e-25
Identity = 136/567 (23.99%), Postives = 262/567 (46.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2085
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R L++++ + +A  E  +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 112.079 bits (279), Expect = 2.859e-25
Identity = 136/567 (23.99%), Postives = 262/567 (46.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2085
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R L++++ + +A  E  +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 112.079 bits (279), Expect = 2.859e-25
Identity = 136/567 (23.99%), Postives = 262/567 (46.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2085
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R L++++ + +A  E  +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: viml (vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-1743])

HSP 1 Score: 116.316 bits (290), Expect = 4.242e-27
Identity = 123/419 (29.36%), Postives = 204/419 (48.69%), Query Frame = 1
Query:  373 TSGMSYSAQSNSQQGLSNIPLIRGDSVALQ---SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVN--ESEKSKAPLEAQVDSLEYEIDDLRKRLM--MLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSF 1608
            +S + Y+++S   +  + +P +  +++      +  T  K  R  EK  +Q LN+RFASYIEK RFLE QNK L+ E+E+L+G   Q +S+I ++YE E+  LR  V+   +EK++A  E   D+L  +++ L+++L   ML             QR+D                                 + +K  RQD +  ALA + LE +++SL++ L F K +HD E+ EL T       +  M   + ++  ALRD++ +YEN  +   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L   N   E  +  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       A L  F SF
Sbjct:   39 SSPVIYASKSAKVRSSAAMPRLTSETLDFNLSDALNTEFKANRLNEKAQMQSLNDRFASYIEKVRFLEQQNKILSAELEQLRG---QRSSRIADLYEEEMRDLRRQVDLLTTEKTRA--EVMRDNLAEDVERLKEKLQDEML-------------QREDAE-------------------------------NSMKSFRQDVDNAALARVDLERKVESLQDELAFLKNLHDEELAELQTQIQGQQVQVEMDMAKPDLTAALRDVRLQYENLASKNIQESEDWYKSKFADLTEAANRNNEALRLAKQETNEYRRQVQAITCELDALRGTNESLERQMREMEENFSMESSGFQNTIGRLEEDIGNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI------AAPLPNFSSF 402          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: vim (vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3])

HSP 1 Score: 110.538 bits (275), Expect = 3.390e-25
Identity = 114/396 (28.79%), Postives = 191/396 (48.23%), Query Frame = 1
Query:  421 SNIPLIRGDSVALQSGV-----TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLM--MLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            S  PL R  +  L  G+     T  K  R  EK ++Q LN+RFASYI+K RFLE QNK L  E+E+L+G      S++ ++YE E+ +LR  V++    K+ +E   D+L  +I+ L++RL   ML             QR+D                                 + L+  RQD +  +LA L LE +++SL+E + F K++HD E+ E+         + +M   + ++  AL+D++ +YE   +   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  +  +  ++       +  +  L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   63 SGAPLPRLATDTLDFGLAEAINTEFKANRTNEKAEMQHLNDRFASYIDKVRFLEQQNKILIAELEQLRGKGA---SRVGDLYEDEMRELRRQVDQLTGEKSKVEVDRDNLGEDIERLKERLQEEML-------------QREDAE-------------------------------NSLRSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEELAEMQIQMQEQHLQIDMEVAKPDLTAALKDVRQQYETLASRNLQESEDWYKSKFADLSEAAARNNETIRLAKQEANDYRRQLQALTCDLEALKGTNESLERQMRELEDSFSMEASGYQDTIGRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITSPFPNFSS 411          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 108.227 bits (269), Expect = 2.802e-24
Identity = 111/377 (29.44%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQN-------AEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFASYIEK RFLE QN  L  EIE+L+G   ++ ++I E+YE E+ +LR  V      ++ +E + D+L   +DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++ L E + F ++IH+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E  + + Q+QS    I  L+  N       +E E  L      Y++T       +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++      ++LS
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIEGLHEEIAFLRKIHEEEIRELQNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDT-------IARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISLPVQSFSSLS 421          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 107.842 bits (268), Expect = 2.891e-24
Identity = 111/377 (29.44%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQN-------AEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFASYIEK RFLE QN  L  EIE+L+G   ++ ++I E+YE E+ +LR  V      ++ +E + D+L   +DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++ L E + F ++IH+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E  + + Q+QS    I  L+  N       +E E  L      Y++T       +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++      ++LS
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIEGLHEEIAFLRKIHEEEIRELQNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDT-------IARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISLPVQSFSSLS 421          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 98.9821 bits (245), Expect = 2.156e-21
Identity = 105/370 (28.38%), Postives = 181/370 (48.92%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFA+YIEK R LE QN+ L  E+E+L+G   ++ ++I ++YE E+ +LR  V      ++ +E + D+L    DDL+K +L + E+I     +  ++   ++S F               ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  + +++N      K E    + QIQS    I  L+  N      + ++   +     +L+  +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +T+S
Sbjct:  106 RTNEKAELQHLNDRFANYIEKVRMLEQQNQVLGVEVERLRG---REPTRIADLYEDEMRELRREVEVVTNHRSRVEVERDNL---ADDLQKLKLRLQEEI-----ALREEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQAQMQETQVQIQMDMSKPDLTAALRDIRAQYEGIAAKNIAEAEDWYKSKVSDLNQAVSKNNEALKQSKLETMEYRHQIQSYTCEIDSLKGSNESLMRQMRDMEDRHGREAGALQDTIARLEAEIANMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRIVMPMQSYSTIS 428          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 117.087 bits (292), Expect = 3.235e-27
Identity = 108/372 (29.03%), Postives = 192/372 (51.61%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK L  E+E+LKG GT    S+I ++YE E+ +LR  +++   +K  +E   D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:   93 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 418          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 116.701 bits (291), Expect = 4.701e-27
Identity = 108/372 (29.03%), Postives = 192/372 (51.61%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK L  E+E+LKG GT    S+I ++YE E+ +LR  +++   +K  +E   D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:   97 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 422          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 116.701 bits (291), Expect = 4.986e-27
Identity = 108/372 (29.03%), Postives = 192/372 (51.61%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK L  E+E+LKG GT    S+I ++YE E+ +LR  +++   +K  +E   D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:   99 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 424          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 117.472 bits (293), Expect = 6.934e-27
Identity = 144/583 (24.70%), Postives = 273/583 (46.83%), Query Frame = 1
Query:  439 RGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK--------------RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRR--FKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYR---DPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQ-NA------EYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISL-CAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAA 2100
            RG S  L    +  +  R QEK +L+ LN+R A YI++ R LE +N +L  +I + +  T ++ S IK +YE E+   R +++E+ + +A L+ ++     ++D+L K              R+  LE +  + ++ +     +    E E+ +LR    K      V K++ E +TL      +R D+          E+ +QSL+E ++F K I++ E +E      R   +  + +   + S++ +AL +++ +++ ++   K+ELE +Y  ++  I+ S   ++      +EE +  + +I+++  +++ L+ Q NA      E E  L++ R  Y +   S E ++  +++Q+          LTE Q LLD KL L++EI AY KLLE EE R+  S    + ++                                    +    S+  +  ++R+ T +    +  + +  G+ISI E DL G  + L+N   K +SL    +KR + G E +I +  + K  L AG+ + +  A   +      I +  + ++WG G+N+ T L ++E  E A 
Sbjct:   19 RGTSTPL----SPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETL------MRVDF----------ENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQ-------LTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVT--------------------------------VSRATSSSSSATRTSRSKRKRTGFTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKI-GEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAV 541          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: timm13 (translocase of inner mitochondrial membrane 13 homolog [Source:NCBI gene;Acc:734099])

HSP 1 Score: 114.005 bits (284), Expect = 1.127e-25
Identity = 146/587 (24.87%), Postives = 272/587 (46.34%), Query Frame = 1
Query:  439 RGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK--------------RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRR--FKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYR---DPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQ-NA------EYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKG----NISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISL-CAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAA 2100
            RG S  L    +  +  R QEK +L+ LN+R A YI++ R LE +N +L  +I + +  T ++ S IK +YE E+   R +++E+ + +A L+ ++     ++D+L K              R+  LE +  + ++ +     +    E E+ +LR    K      V K++ E +TL      +R D+          E+ +QSL+E ++F K I++ E +E      R   +  + +   + S++ +AL +++ +++ ++   K+ELE +Y  ++  I+ S   ++      +EE +  + +I+++  +++ L+ Q NA      E E  L++ R  Y +   S E ++  +++Q+          LTE Q LLD KL L++EI AY KLLE EE R+  S    + ++                      +       +      R+       G + R  T  Q    +F  + +     +ISI E DL G  + L+N   K +SL    +KR + G E +I +  + K  L AG+ + +  A   +      I +  + ++WG G+N+ T L ++E  E A 
Sbjct:   17 RGTSTPL----SPTRISRLQEKEELRHLNDRLAVYIDRVRSLELENDRLMVKISEKEEVTTREVSGIKNLYESELADARKVLDETARERARLQIELGKFRSDLDELTKNYKKKDADLSTAQGRIRDLEALFHRSEAELGTALGEKRSLEAEVADLRAQLSKAEDAHAVAKKQLEKETL------MRVDF----------ENRIQSLQEEMDFRKNIYEEESRETRKRHERRIVEVDRGHQCDYDSKLAQALDELRKQHDEQVKMYKEELEQTYQAKLDNIKRSSDHNDKAANTAREELTEARMRIETLSYQLSGLQKQANAAEDRIRELEQLLSSDRDKYRKLLDSKEKEMAEMRDQMQQQ-------LTEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPQSRVT-----------------VSRATSSSSSATRTSRSKRKRVEEEYEEGGGSSRTVTSGQGSSTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSDKDQSLGNWRLKRKI-GEEEEIVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSTWGTGSNIRTYLVNTEEEEVAV 558          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 125.946 bits (315), Expect = 1.673e-30
Identity = 132/436 (30.28%), Postives = 223/436 (51.15%), Query Frame = 1
Query:  304 ITTSRSYYKPIS--QPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            +TTS   Y   S  +P  +      + G +Y  +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE ++    L+  RQD +  +LA L LE +++SL+E + F K++HD E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR++  
Sbjct:   31 VTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAEST---LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 126.331 bits (316), Expect = 2.707e-30
Identity = 132/436 (30.28%), Postives = 223/436 (51.15%), Query Frame = 1
Query:  304 ITTSRSYYKPIS--QPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            +TTS   Y   S  +P  +      + G +Y  +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE ++    L+  RQD +  +LA L LE +++SL+E + F K++HD E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR++  
Sbjct:   31 VTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAEST---LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 103.219 bits (256), Expect = 6.368e-23
Identity = 103/372 (27.69%), Postives = 184/372 (49.46%), Query Frame = 1
Query:  454 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK LA E+ +L+    ++ +K+ ++Y+ E+ +LR  +++   + A LE + D+   ++  LR++L   ++ N + ++            E  L   R           +E +E    R DL++                 +++SL+E ++F ++I++ EV+EL     +      M   + ++  ALR+I+T+YE   T   QE E  Y  +  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++E+   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   54 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQ--DETNLRLEA------------ENNLAAYR-----------QEADEATLARVDLER-----------------KVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 102.449 bits (254), Expect = 1.145e-22
Identity = 103/372 (27.69%), Postives = 184/372 (49.46%), Query Frame = 1
Query:  454 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK LA E+ +L+    ++ +K+ ++Y+ E+ +LR  +++   + A LE + D+   ++  LR++L   ++ N + ++            E  L   R           +E +E    R DL++                 +++SL+E ++F ++I++ EV+EL     +      M   + ++  ALR+I+T+YE   T   QE E  Y  +  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++E+   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   54 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQ--DETNLRLEA------------ENNLAAYR-----------QEADEATLARVDLER-----------------KVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Des (desmin [Source:MGI Symbol;Acc:MGI:94885])

HSP 1 Score: 102.064 bits (253), Expect = 2.388e-22
Identity = 106/360 (29.44%), Postives = 174/360 (48.33%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            R  EK +LQ+LN+RFA+YIEK RFLE QN  LA E+ +LKG   ++ +++ E+YE E+ +LR  V      +A ++ + D+L   IDDL++    L+                      E ++LR              EE +   ++L   R D +   LA + LE  ++SL E + F K++H+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E    + QIQS    I  L+  N      +  +   +       +  +  L+E++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+N  
Sbjct:  104 RTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKG---REPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNL---IDDLQRLKAKLQ----------------------EEIQLR--------------EEAE---NNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLP 418          
BLAST of Intermediate filament protein vs. UniProt
Match: sp|Q01240|NF60_DORPE (60 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 2.241e-73
Identity = 157/369 (42.55%), Postives = 240/369 (65.04%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1560
            +GV  +K  R +EK+D++DLNERFA+YIEK RFLEAQNK+LA E+E+LK    ++ S IKE+YE E+ + R L++ + K K  L+ +V  L   ID L ++   LE+  + +   +  I +Q + ++  EGE+  LRR   +   +  ++   +  + D+++K+R D   E + HL  E+  Q+L+E LEF+K +H  E+KELA +AYRD T EN  +W++E+ +A+RDIQ EY+ K   ++ ++EA Y L++QE RT  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + E+   L ELQ L+D KL LELEIAAY KLLE EESRV
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRV 449          
BLAST of Intermediate filament protein vs. UniProt
Match: sp|Q01241|NF70_DORPE (70 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.389e-72
Identity = 157/369 (42.55%), Postives = 240/369 (65.04%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1560
            +GV  +K  R +EK+D++DLNERFA+YIEK RFLEAQNK+LA E+E+LK    ++ S IKE+YE E+ + R L++ + K K  L+ +V  L   ID L ++   LE+  + +   +  I +Q + ++  EGE+  LRR   +   +  ++   +  + D+++K+R D   E + HL  E+  Q+L+E LEF+K +H  E+KELA +AYRD T EN  +W++E+ +A+RDIQ EY+ K   ++ ++EA Y L++QE RT  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + E+   L ELQ L+D KL LELEIAAY KLLE EESRV
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRV 449          

HSP 2 Score: 53.5286 bits (127), Expect = 5.434e-6
Identity = 40/113 (35.40%), Postives = 65/113 (57.52%), Query Frame = 1
Query: 1780 FRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKI-SFTISGKVNLNAGEKISLCAKG-KITGKGRE-IEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2109
            ++RT+KG++SI E D  G  I LE    K E+L G  I R VD  +NK+ ++ I   V L  G  + + +K  +   +G + +  ++ +WG G+NVVT L + +G +KA + Q
Sbjct:  503 YQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVD--DNKVYTYEIPNLV-LKTGTVVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQ 610          
BLAST of Intermediate filament protein vs. UniProt
Match: sp|P90901|IFA1_CAEEL (Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.707e-66
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament protein vs. UniProt
Match: sp|P90900|IFA4_CAEEL (Intermediate filament protein ifa-4 OS=Caenorhabditis elegans OX=6239 GN=ifa-4 PE=1 SV=3)

HSP 1 Score: 216.853 bits (551), Expect = 2.177e-60
Identity = 161/553 (29.11%), Postives = 286/553 (51.72%), Query Frame = 1
Query:  466 GVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
              +++++ R +EK+++ +LN+R ASYIEK RFLEAQN+++  ++  L+G    D++ +K +YE E+   + L+ +S+K +A LE Q+  L  E+++ R +L   E      +  +D     +   E E+  L+R        +   K E   + D L   R   E+E L  +  ++++Q+L E  +F ++IHD+E+ +L  +A RD T EN  Y+++E+  A+R+I++EY++     + ++E+ Y L++QEI T  +R+ +E  + +EE  R+++ +  MR ++ADLE +N   E  + ++    EE  RS E  L      +   + E  + + ELQ L+D K  L+ EI  Y K+L+ EE+R        A L Q +                               +            + + ETT + S    + R+ KGNI+I E +  G  I+LENI  + E++    ++R + G + +I FT   +  L A + + + A+G+      +  + D   S+G GN+VVTTL + EG ++A+H Q  S
Sbjct:   59 AASAIRESRTREKKEMSELNDRLASYIEKVRFLEAQNRKMEKDLNLLRGKWGHDSTSVKVMYETELRSAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELLKRRISLMEESIGHLKRENHRMIDSLHHARNAVEQETLNRIDYQNQVQTLLEECDFIRRIHDSEIHDLLAMASRDTTVENREYFKNELSSAIREIRSEYDHVSNTTRTDIESWYKLKVQEIHTQNSRNCLEQNYAREEVKRLRTTLGDMRGKMADLEGRNLLLEKQIEDLNYQMEEDMRSYEQSLNDKDTSINKLRDESKILMVELQMLIDTKQTLDAEIVIYRKMLDGEENR--------AGLRQLV-------------------------EQVVKTTSIHQTKEIESLRVLKGETTSHSS----YSRSAKGNIAIQEAEPSGKYIVLENISRRDENIGDWKLRRKIAG-KREIVFTFPREFTLRAQKSVKIFARGQGVHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASHSQRAS 573          
BLAST of Intermediate filament protein vs. UniProt
Match: sp|O02365|IFA2_CAEEL (Intermediate filament protein ifa-2 OS=Caenorhabditis elegans OX=6239 GN=mua-6 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.018e-56
Identity = 165/556 (29.68%), Postives = 289/556 (51.98%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ +LN+R ASYIEK RFL+AQN++L  +++ L+G   +    +K +YE+EI     +V ++ K     E ++  L+ ++D+LRK+    +   ++ +  ID     +S  E E+  L+R       +V + K+E   L  +L+++R + ++E L  +  +++++++ E ++F K+  +TE+KEL   A RD T EN  Y+++E+  A+RDI+ EY+  + G + ++E+ Y L++QEI T   R N E  + KEE  R+++Q   +R +++DLE +N   E  + ++    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ E+  Y ++LE      N  G+G   L + +  TS+                                        T R      S R  ++R+ KGN++I ET   G  +ILEN    K E L    +KR +DG + +I FT      L+  + + + A+G+      E+ I   D ++GVG NV T L +++G E+A H Q  S
Sbjct:   58 QNAASTIRDNREREKKEIMELNDRLASYIEKVRFLDAQNRKLDADLKMLQGRFGKSTGSVKVMYEMEITTATNVVKQTGKDHGETEKEIRKLQDQLDELRKKFEEAQRGRAEDRLKIDDLLVTLSNLEAEINLLKRRIALLEEEVARLKKENFRLTSELQRVRIELDQETLLRIDNQNKVKTILEEIDFMKRGFETELKELQAQAARDTTSENREYFKNELANAMRDIRAEYDQIMNGNRNDMESWYQLRVQEINTQSNRQNAENNYQKEEVKRLRNQTSELRQKLSDLESRNLLLEKQIEDLNYQLEDDQRSYEAALNDKDAQIRKLREECQALMVELQMLLDTKQTLDGELKVYRQMLEG-----NSEGNGLRQLVEKVVRTSAINEEADTE--------------------------------TMRVVKGEHSSRTSYQRSAKGNVAIKETSPEGKFVILENTHRAKEEPLGDWKLKRKIDG-KREIVFTFPSDYILHPFQSVKIFARGQGIANPPEVLIFEGDETFGVGANVQTILYNNKGEERATHIQRQS 575          
BLAST of Intermediate filament protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18213119 (tr|A0A267FSC2|A0A267FSC2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010052g3 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 9.787e-102
Identity = 226/554 (40.79%), Postives = 335/554 (60.47%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAG--EKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2115
            V +M  GR +EK+D+Q+LNERFA+YIEK RFLEAQNK+L+NE+++LK    ++  ++K+ YE E+ QLR L+++SEK KA  E ++ SLE ++++L+   ++L++ N Q+   + TIDK  + ++ ++GE+  LRR   T   + +++++E+K LRD++ +LR D + E L H+  E+E QSL+E LEF KQIH++E+KELA +AYRD T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G          G  S                  T YQ       RT KGN+SI E    G  I+LEN G K E + G  + R +D     I FT+   V L  G  + I + A+G       ++E  ++SWGVG N+ T+L ++EG E+A H Q+ 
Sbjct:   72 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDRKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQNKQQMSLIKGEMSAK----------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKT 599          
BLAST of Intermediate filament protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15787754 (tr|W0GAA8|W0GAA8_9PLAT Intermediate filament b-like protein OS=Macrostomum lignano OX=282301 GN=if1 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.432e-101
Identity = 226/554 (40.79%), Postives = 335/554 (60.47%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAG--EKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2115
            V +M  GR +EK+D+Q+LNERFA+YIEK RFLEAQNK+L+NE+++LK    ++  ++K+ YE E+ QLR L+++SEK KA  E ++ SLE ++++L+   ++L++ N Q+   + TIDK  + ++ ++GE+  LRR   T   + +++++E+K LRD++ +LR D + E L H+  E+E QSL+E LEF KQIH++E+KELA +AYRD T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G          G  S                  T YQ       RT KGN+SI E    G  I+LEN G K E + G  + R +D     I FT+   V L  G  + I + A+G       ++E  ++SWGVG N+ T+L ++EG E+A H Q+ 
Sbjct:   72 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQNKQQMSLIKGEMSAK----------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKT 599          
BLAST of Intermediate filament protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18197935 (tr|A0A267GC02|A0A267GC02_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015143g3 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.477e-95
Identity = 215/554 (38.81%), Postives = 324/554 (58.48%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK--ISLCAKG-KITGKGR-EIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2109
            V+SM  GR +EKRD+Q+LNER A YIEK RFLEAQNK+L+NE+++LK    ++  KIK  YE E+ QLR L+ ++EK KA  E ++ SLE ++++L+   ++L++ N  +   + TIDK  + ++ ++GE+  LRR       +  +++ E+K LRDD+ +LR D + E L H+  E+  QSL+E L+F KQ+H++E+KELA +AYRD T EN  +W++EM +AL DIQ EYE KL  ++ E+EA Y +++QE RT+ TRDN+E  H +EE+ RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E+    L+  L  +   L   + ELQ L+DAKL LELEI AY KLLE EE  V  +     T++Q  S    +          +  A        G                         S +  ++RT KGN+SI E    G  ++LEN G K E + G  + R +D +   + +T+     L+ G++  + + A+G +  G G  ++E  + SWGVG N+VT+L + EG E+A H Q
Sbjct:   92 VSSMLTGREKEKRDMQELNERLAGYIEKVRFLEAQNKKLSNELQQLKDRWGKETEKIKLTYETELQQLRKLLEDAEKHKAEAEVRISSLEDQLNELQ---VLLDEANRLHQVDRETIDKLNQQMADYDGEISLLRRRVAAFDEERARDQREIKRLRDDVSRLRTDLDTETLNHINAENAAQSLREELDFLKQVHESELKELAILAYRDTTNENREFWRNEMSQALHDIQREYEVKLDSMRSEIEAQYSVKVQEARTTNTRDNLELAHLREESKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMTKSQLRADLASSNATLEEYMRELQVLMDAKLSLELEIHAYRKLLEGEE--VRINQRAQETITQRSSTVEKTSVSVEQQQLPSPAAAQQMNLVKGEM-----------------------SAKTTYQRTAKGNVSIQECSPDGKFVLLENTGKKKEDIGGWKLSRNIDNNRQTVRYTVPMGTVLDDGQRKTVKIWARGHRPLGSGSGDLEAGEPSWGVGANIVTSLYNMEGEERATHNQ 617          
BLAST of Intermediate filament protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18339072 (tr|A0A267EDW2|A0A267EDW2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015143g2 PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.921e-95
Identity = 215/554 (38.81%), Postives = 323/554 (58.30%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK--ISLCAKG-KITGKGR-EIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2109
            V+SM  GR +EKRD+Q+LNER A YIEK RFLEAQNK+L+NE+++LK    ++  KIK  YE E+ QLR L+ ++EK KA  E ++ SLE ++++L+   ++L++ N  +   + TIDK  + ++ ++GE+  LRR       +  +++ E K LRDD+ +LR D + E L H+  E+  QSL+E L+F KQ+H++E+KELA +AYRD T EN  +W++EM +AL DIQ EYE KL  ++ E+EA Y +++QE RT+ TRDN+E  H +EE+ RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E+    L+  L  +   L   + ELQ L+DAKL LELEI AY KLLE EE  V  +     T++Q  S    +          +  A        G                         S +  ++RT KGN+SI E    G  ++LEN G K E + G  + R +D +   + +T+     L+ G++  + + A+G +  G G  ++E  + SWGVG N+VT+L + EG E+A H Q
Sbjct:   92 VSSMLTGREKEKRDMQELNERLAGYIEKVRFLEAQNKKLSNELQQLKDRWGKETEKIKLTYETELQQLRKLLEDAEKHKAEAEVRISSLEDQLNELQ---VLLDEANRMHQVDRETIDKLNQQMADYDGEISLLRRRVAAFDEERARDQRETKRLRDDVSRLRTDLDTETLNHINAENAAQSLREELDFLKQVHESELKELAILAYRDTTNENREFWRNEMSQALHDIQREYEVKLDSMRSEIEAQYSVKVQEARTTNTRDNLELAHLREESKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMTKSQLRADLASSNATLEEYMRELQVLMDAKLSLELEIHAYRKLLEGEE--VRINQRAQETITQRSSTVEKTSVSVEQQQLPSPAAAQQMNLVKGEM-----------------------SAKTTYQRTAKGNVSIQECSPDGKFVLLENTGKKKEDIGGWKLSRNIDNNRQTVRYTVPMGTVLDDGQRKTVKIWARGHRPLGSGSGDLEAGETSWGVGANIVTSLYNMEGEERATHNQ 617          
BLAST of Intermediate filament protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20021306 (tr|O97339|O97339_9ANNE Cytoplasmic intermediate filament protein OS=Phascolion strombus OX=74861 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.507e-89
Identity = 202/559 (36.14%), Postives = 315/559 (56.35%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-------NFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKG-REIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2115
            +GV S+K  R +EK+D+QDLNERFA+YIEK RFLEAQN++LA E+++LK    ++ + +K +Y+ E+++ R L++++EK KA LE +  SLE +ID++R  L      N + +  +++Q + IS +  E+  L +      +D +++K+E+  L+D L K R D + E L H+  E+  Q+L+E LEF K +H+ E+KELA +AYRD T EN  +W+SEM  ALR+IQ  Y+ ++  ++ ELE+ Y +++QE RT  +R N+ET H KE   +++ Q+ +++SR+++LE +NA  E    ++R   EE +R  E + + L   L   Q EL   L ELQ L+D KLGLELEIAAY KLLE EE+RV       N    G+ + ++++S                                S          M+ + T         ++R+ KG I+I E    G  I +EN G + E L+G  I R VDG  +K  F  +   +L    +  + AKG     G  +IE +  SWG+G N+ T L +  G ++A H Q+ 
Sbjct:   80 TGVASIKTSRDREKKDMQDLNERFANYIEKVRFLEAQNRKLAQELDQLKQKWGKETAAVKAMYQAELDEARKLLDDAEKEKARLEIRTASLEEQIDEIRASLDDANAQNDEMRDRLERQNQQISEYVSEISVLTKRMQQLESDRDRDKKEIGRLQDSLNKARHDLDNETLGHIDAENRRQTLEEELEFLKNVHEQELKELAALAYRDTTVENREFWKSEMSSALREIQETYDEEMDAMRGELESYYNMKIQEFRTGASRQNMETVHAKETTKKMRDQLSALQSRLSELEARNASLEAENASLRQQLEEREREWEEERMELTNNLNKLQAELEAVLKELQDLIDTKLGLELEIAAYRKLLEGEENRVGLKQIVLNLVSGGHVSTTEYVSH----------------------------DERSGGQSQVVKGEMSAKTT---------YQRSAKGPITICEMQCCGKYICVENTGRRNEQLDGWKIARTVDGRTDK-RFCHTSWFHLCTRPQGKIWAKGSAQNPGPNDIESNQNSWGIGANITTKLVNLSGEDRATHVQKT 600          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: vim (vimentin [Source:NCBI gene;Acc:103044141])

HSP 1 Score: 116.701 bits (291), Expect = 2.436e-27
Identity = 122/409 (29.83%), Postives = 202/409 (49.39%), Query Frame = 1
Query:  370 KTSGMSYSAQSNS-------QQGLSNIPLIRGDSVALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            +++ M+YSA S            L + P  R D  AL   + T  K  R  EK ++Q LN+RFASYIEK RFLE QNK L+ E+E L+G GT    S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L   E+I          QR+D                                 ++L   RQD +  +LA L LE +L+SL+E + F K++HD E+ EL    +    + +M   + ++  ALRD++++YE   T   QE E  Y  +  ++  +  R +      K++ +  + Q+ ++   +  L+  N   E  +  +  ++       +  ++ L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+ F 
Sbjct:   38 RSTRMTYSASSAPAIVSVSRSSRLRSAPSPRLD-FALSDAINTEFKANRTNEKAEMQHLNDRFASYIEKVRFLEQQNKSLSAELELLRGKGT----SRVGDLYEEEMRELRLQVDQLIGDKARVEVERDNLGEDIQRLREKLQ--EEI---------IQREDAE-------------------------------NNLHGFRQDVDNASLARLDLERKLESLQEEIIFLKKLHDEEIAELQAQIHDQHVQIDMDVAKPDLTAALRDVRSQYETLATKNIQEAEDWYKSKFTDLSDAAARSSEAIRLAKQDANEYRRQVHALTCEVDALKGTNESLERQMRELEDSFGMESSGYQDTIVRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRLCFP 399          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: vim (vimentin [Source:NCBI gene;Acc:103044141])

HSP 1 Score: 114.775 bits (286), Expect = 1.133e-26
Identity = 121/406 (29.80%), Postives = 201/406 (49.51%), Query Frame = 1
Query:  370 KTSGMSYSAQSNS-------QQGLSNIPLIRGDSVALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1560
            +++ M+YSA S            L + P  R D  AL   + T  K  R  EK ++Q LN+RFASYIEK RFLE QNK L+ E+E L+G GT    S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L   E+I          QR+D                                 ++L   RQD +  +LA L LE +L+SL+E + F K++HD E+ EL    +    + +M   + ++  ALRD++++YE   T   QE E  Y  +  ++  +  R +      K++ +  + Q+ ++   +  L+  N   E  +  +  ++       +  ++ L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+
Sbjct:   38 RSTRMTYSASSAPAIVSVSRSSRLRSAPSPRLD-FALSDAINTEFKANRTNEKAEMQHLNDRFASYIEKVRFLEQQNKSLSAELELLRGKGT----SRVGDLYEEEMRELRLQVDQLIGDKARVEVERDNLGEDIQRLREKLQ--EEI---------IQREDAE-------------------------------NNLHGFRQDVDNASLARLDLERKLESLQEEIIFLKKLHDEEIAELQAQIHDQHVQIDMDVAKPDLTAALRDVRSQYETLATKNIQEAEDWYKSKFTDLSDAAARSSEAIRLAKQDANEYRRQVHALTCEVDALKGTNESLERQMRELEDSFGMESSGYQDTIVRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI 396          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:103035120])

HSP 1 Score: 107.457 bits (267), Expect = 2.990e-24
Identity = 107/373 (28.69%), Postives = 183/373 (49.06%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQF 1599
            ++ R  EK ++  LN+RFASYIEK RFLE QNK L  E+ +L+G   ++ S++ +IY+ E+ +LR  V+     KA LE + D+L  ++  L++RL                  +D +               Q AD N            L   RQD ++ A+  + LE ++++L++ + F K++H+ E+KEL           ++   + ++  ALRDI+ +YE   +   QE E  Y  +  ++  +  R+       K+E +  + QIQ++   +  L   N   E  L  +   +     + +  ++ L++++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+       A L QF
Sbjct:   76 RETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLRG---KEPSRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLAADLVTLKQRL------------------QDETALR------------QEADNN------------LNGFRQDVDEAAMNRVQLERKIEALQDEINFLKKVHEEEMKELQEQLMAQQVHVDLDVSKPDLTAALRDIRVQYEAMASSNMQETEEWYRSKFADLTDAANRNAESLRQAKQEANDYRRQIQALTCDLESLRGTNESLERQLREMEERFSIETAAYQDTVVRLEDEIQTLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITVPVQSFANL-QF 402          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:103035120])

HSP 1 Score: 107.071 bits (266), Expect = 3.352e-24
Identity = 107/376 (28.46%), Postives = 184/376 (48.94%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSF 1608
            ++ R  EK ++  LN+RFASYIEK RFLE QNK L  E+ +L+G   ++ S++ +IY+ E+ +LR  V+     KA LE + D+L  ++  L++RL                  +D +               Q AD N            L   RQD ++ A+  + LE ++++L++ + F K++H+ E+KEL           ++   + ++  ALRDI+ +YE   +   QE E  Y  +  ++  +  R+       K+E +  + QIQ++   +  L   N   E  L  +   +     + +  ++ L++++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+       A L QF  +
Sbjct:   76 RETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLRG---KEPSRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLAADLVTLKQRL------------------QDETALR------------QEADNN------------LNGFRQDVDEAAMNRVQLERKIEALQDEINFLKKVHEEEMKELQEQLMAQQVHVDLDVSKPDLTAALRDIRVQYEAMASSNMQETEEWYRSKFADLTDAANRNAESLRQAKQEANDYRRQIQALTCDLESLRGTNESLERQLREMEERFSIETAAYQDTVVRLEDEIQTLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITVPVQSFANL-QFRDY 405          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: desmb (desmin [Source:NCBI gene;Acc:103039642])

HSP 1 Score: 106.686 bits (265), Expect = 5.590e-24
Identity = 108/369 (29.27%), Postives = 178/369 (48.24%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFASYIEK RFLE QN+ L  E+E+L+G   ++ ++I ++YE E+ +LR  V      ++ +E + D+L    DDL+K  M L++  +Q +             E  L   R       ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL         +  M   + ++  ALRDI+++YE        E E  Y  ++ ++  + T++N      K E    + QIQS    I  L+  N      + ++   +       +  +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +T+S
Sbjct:  108 RTNEKAELQHLNDRFASYIEKVRFLEQQNQALVVEVERLRG---REPTRIADLYEEEMRELRRQVEVVTNQRSRVEVERDNL---ADDLQKLKMRLQEEIAQREEA-----------ENSLAAFR-------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQAQMQETQVQIQMDMSKPDLTGALRDIRSQYEAIAAKNIAEAEDWYKSKVSDLNQAVTKNNEALKQAKLETMEFRHQIQSYTCEIDSLKGTNESLMRQMRDMEDRHGREASGFQDTITRLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESRITLPMQSYSTIS 430          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 95.5153 bits (236), Expect = 1.074e-20
Identity = 140/585 (23.93%), Postives = 263/585 (44.96%), Query Frame = 1
Query:  451 VALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSK----------IKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKL-------RQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVY---------WQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXX-------XXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEI---DDASWGVGNNVVTTLCDSEGAEKA 2097
            + ++S ++  +  R QEK  L +LN+R A+YIE+ R LE    +L   +   +    +   K          ++  Y+ E+ ++R  ++++  +KA LE Q+   + E D+ R R        S+Y+   +     I   E +L        T   D    + EV  LR+ + +L       +Q  E+E LA + LE+ + +L+E LEF K+IH+ E+ E  +       +E  V          ++ ++  AL +++ ++E ++   +QEL+       Q +R +K   ++ T   +  +  I+  ++   SR+  L  Q +  +H+L  ++    E + +L  +    + +L          ++ +   L E + LLD KL L++EIAAY KLLE EESR+N S +     S   + TS+S +              G   S                  ++R  + + S          G+I I E D+ G ++ + N   K + L G  +KR ++  + +I++  S +  L AG+ +++ A           ++     +SWG G+++ T+L +S+G E A
Sbjct:    3 IEMKSLLSPTRVTRLQEKESLVELNDRLAAYIERVRSLEVDKARLLARVSMWEEEEEEQRQKSERQREATGGLRAAYDAELAEVRRALDDALGAKAALEIQLRLAQVERDEGRSRC-------SKYEQEWNVALGRIRDMEVQLCAKEASLSTASGDKEYLETEVDDLRNQVNQLEGVLVSSKQQLEEETLARVDLENRMLTLQEELEFTKRIHEQEIHESRS------KRETHVLEIDGGQQQAFEYKLSEALTELRQQHEEQVQLYRQELD-------QTMR-AKLEKSILTPEKQSLDISIREDLREATSRVGTLSSQLSAAQHDLALLQGRVRELEETLSHERDQSKRRLDESDRELAELREVMDEQLIEYEQLLDIKLALDMEIAAYRKLLEGEESRLNLSPEKGVQSSVVQTSTSASHSIRTMPGKRKRVQLEGFVDSMAQ---------------SQRSVSQHAS--------ASGSIGIKEVDMEGKSVTMVNNSEKDQPLGGWVLKRQIE-DQAEIAYKFSSRYVLKAGQTVTIWAANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVA 542          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 81.6481 bits (200), Expect = 1.067e-16
Identity = 109/398 (27.39%), Postives = 184/398 (46.23%), Query Frame = 1
Query:  400 SNSQQGLSNIPLIRGDSV--ALQSGVTS-MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTK-ENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1560
            ++S  G S +  + G SV  +L   + +  +  R  EK +LQ+LN+RFA+YI+K R+LE QNK L  E+  LKG   ++ +++  +YE E+ +LRA V      KA  + +  +L  E+  L++RL        + +  +   R+D+                         ++    R DL++                 +++SL+E + F K+IHD E++E+           E  V  + ++  ALRDI+ EYE        E E  Y  +  ++  +  R+N      K+E    + Q+Q+ +  I         LE Q  E E   +   ANY++T       +  L++ +   + E+   L + Q LL  K+ L++EIA Y KLLE EE+RV
Sbjct:   52 ASSLYGRSYVKAMPGQSVDFSLAEALNADYRTTRTNEKVELQELNDRFANYIDKVRYLEQQNKALLAELALLKG---REPTRVGPLYEQELRELRAQVERLTGEKARGDVERANLLDELQRLQQRLQEETAAREEAEKNLQAFRQDV-------------------------DDATLARVDLER-----------------KVESLQEEIAFLKKIHDEELREVQVQVQEQTVHVEYDVGTKPDLTAALRDIRAEYEGIAAKNVAEAEEWYKSKFLDLSEAAVRNNEALRAAKQELMDYRRQVQAQQCDIDSLKGANESLERQIREMEERFSVESANYQDT-------ITRLEDDIGNLKDEMARHLRDYQELLHVKMALDIEIATYRKLLEGEETRV 397          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010102.1 (pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 gene:ENSPMAG00000009106.1 transcript:ENSPMAT00000010102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.395e-16
Identity = 97/358 (27.09%), Postives = 168/358 (46.93%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKT--LRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESR 1557
            R QEK  ++ LN+RFA++I+K RFLE QNK L  +   L+  T   +S I E++E  IN LR  ++     K  L   +  ++  ++D R          ++Y++ I+ +    +  EGE V ++  K   GA ++K + E +   L D++  LR  +                 +E  E E QI  T V  L  +        N+     ++   + D++ +YE      + E +A Y  + Q + +   R++ E    + E + +  Q+Q  R+ +  L+ Q A+ E  +       E   R  +  +  L+E++   +QE+   + E Q L++ KL L++EI  Y KLLE EESR
Sbjct:  137 RTQEKEAIKHLNDRFANFIDKVRFLEQQNKVLEAQWYALQEKTTTGSS-IDEMFEAYINGLRRQLDGLGHDKGQLNGNLGQMQAVVEDFR----------AKYEAEINNR----NAAEGEFVVVK--KDVDGAYLSKVELETRLQGLVDEINFLRSIFT----------------QELSELEAQIKHTNV--LVEI----DNSRNL-----DVDGIIADVRQQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRMTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESR 450          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: zgc:136930 (zgc:136930 [Source:ZFIN;Acc:ZDB-GENE-060312-16])

HSP 1 Score: 78.1814 bits (191), Expect = 2.126e-15
Identity = 99/375 (26.40%), Postives = 164/375 (43.73%), Query Frame = 1
Query:  466 GVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGT-VQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVEL-RRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIR--TSKTRDNV-----ETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 1563
            G       R  EK  LQ LN+RF  Y+EK R L+ +N  L  ++  + GG  +  +  +   YEV+I +LR  +      K  LE ++D++    ++L+ +      +  Q +S I   +KDI       V L  R+                 L D+L  L++ YE                +E   F+ ++  TEV    ++   D  K        ++   L  I++EYE   T  + E EA Y  +++EI+  TSKT + +     E     ++     S++Q++ S+   +E   A YE   ++  A+Y+ +  SLE+ +   +  L          L   QSLLD KL L+ EI+ Y  LLE E +R +
Sbjct:  175 GTIPPMASREAEKSTLQFLNDRFGGYVEKVRLLQRENAALEAQLASITGGAPLSPDGGVTVNYEVQITELRTTIETLILDKVNLEIELDNIRATAEELKAKFEFEAGVRYQLESDISLMKKDIEFATDTRVNLTTRYTA---------------LTDELTFLKKTYE----------------EEFATFQTRLGTTEVSS-GSIIEVDTIK------SFDLMSTLSQIRSEYEVVATRNRAEAEAYYHSRIEEIQAVTSKTTEAINFAKTEIVSVTKDIQMHYSELQTLLSQSYSMEQAVASYEARASSEVASYQSSVASLEVAIETARMDLQRQ-------LLAYQSLLDVKLQLDAEISTYRNLLEGEAARCS 504          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010061.1 (pep scaffold:Pmarinus_7.0:GL478364:48285:55057:1 gene:ENSPMAG00000009104.1 transcript:ENSPMAT00000010061.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 2.326e-14
Identity = 101/369 (27.37%), Postives = 170/369 (46.07%), Query Frame = 1
Query:  475 SMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYE----IDDLRKRLMMLEDINSQYKSTID--KQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKT--LRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESR 1557
            S+   R QEK  ++ LN+RFA++I+K RFLE QNK L  +   L+  T    S + E++E  IN LR               Q+D L +E      DL +   ++ED  ++Y++ I    +R+D      E V  +  K   GA ++K + E K   L++D+  +R  +                 +E  E E QI  T V  L  +        N+     ++   + D++ +YE      + E +A Y  + Q + +   R++ E    + E + +  Q+Q  R+ +  L+ Q A+ E  +       E   R  +  +  L+E++   +QE+   + E Q L++ KL L++EI  Y KLLE EESR
Sbjct:  130 SVLPTRTQEKEAIKHLNDRFANFIDKVRFLEQQNKVLEAQWYALQEKTTT-GSSVDEMFEAYINGLR--------------RQLDGLGHENGRANGDLGQMQAVVEDFRAKYEAEISLRTERED------EFVFAK--KDVDGAYLSKVELEAKLDGLQEDINFMRSIFA----------------QELSELEAQIKHTNV--LVEI----DNSRNL-----DVDGIIADVRHQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRVTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESR 448          
BLAST of Intermediate filament protein vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 97.4413 bits (241), Expect = 4.351e-21
Identity = 103/396 (26.01%), Postives = 197/396 (49.75%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRF---KGTQGADVNKE-----------KEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATL 1590
            S   S K  RAQEK +LQ LN+R A+YI++ + LE +N +L +E+   +    ++   +K +YE E+   R L++E+ K KA  + Q++S +   D              ++K+  DK+       E EL ++R+    K  Q    N+E           + E + L+D LK  +   E+E L  + LE+  QSL+E   F+KQ++D E+ ++ +      TK  +V       ++  M   L++++ +Y++     K+E E  Y  + +E+R  + RD+      +EEN  +   +  + S++  LE +N      +++++    + +   + ++L  + ++   +  +  AL + + L+  K+ L++EI AY KLLE EE+R+  +   +  L
Sbjct:   28 SPPGSAKFTRAQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKA--KQQIESSKNSND------------AQEFKNKFDKEAAARKKAEKELNDVRKLLHDKENQLTRRNQEALNLESVLRELQGECEELKDALKAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYKDKYEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELRTSIDDALRDYEDLMGVKVALDMEITAYRKLLESEETRLEITPPASPVL 409          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: viml (vimentin [Source:NCBI gene;Acc:101163931])

HSP 1 Score: 117.857 bits (294), Expect = 9.442e-28
Identity = 121/403 (30.02%), Postives = 201/403 (49.88%), Query Frame = 1
Query:  373 TSGMSYSAQSNSQQGLSNIPLIRGDSV--ALQSGVTS-MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL--ATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 1563
            +S   Y+ ++   +  + +P +  +S+  +L   V S     R  EK  +Q LN+RFASYIEK RFLE QNK L  E+E+L+G GT    S+I ++YE E+ +LR  V++    KA +E   D+L  +I+ LR++L                 R +IS                      ++EE +     ++  RQD +  ALA L LE +++SL+E + F K++HD E+ E        +   + +M   + ++  ALRD++ +YEN  T   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  L  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++
Sbjct:   45 SSAPVYAVKTQRLRSSAAMPRLASESLDFSLHDAVNSEFLTNRTNEKAQMQSLNDRFASYIEKVRFLEQQNKILLAELEQLRGKGT----SRIGDLYEDEMRELRRQVDQLTNEKARVEVHRDNLADDIERLREKL-----------------RDEIS----------------------QREEAEAT---MQSFRQDVDSAALARLDLERKIESLQEEINFLKKLHDEEMLEFQSQVQQQQQHVQVDMDVAKPDLTAALRDVRLQYENLATKNIQESEEWYKSKFADLTEAAARNNEALRMAKQEANDYRRQVQALTCEVDALKGTNESLERQLREMEENFSLESNGYQDTIGRLEEDMHNIKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 401          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: viml (vimentin [Source:NCBI gene;Acc:101163931])

HSP 1 Score: 116.316 bits (290), Expect = 2.554e-27
Identity = 121/401 (30.17%), Postives = 199/401 (49.63%), Query Frame = 1
Query:  373 TSGMSYSAQSNSQQGLSNIPLIRGDSV--ALQSGVTS-MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL--ATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESR 1557
            +S   Y+ ++   +  + +P +  +S+  +L   V S     R  EK  +Q LN+RFASYIEK RFLE QNK L  E+E+L+G GT    S+I ++YE E+ +LR  V++    KA +E   D+L  +I+ LR++L                 R +IS                      ++EE +     ++  RQD +  ALA L LE +++SL+E + F K++HD E+ E        +   + +M   + ++  ALRD++ +YEN  T   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  L  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR
Sbjct:   45 SSAPVYAVKTQRLRSSAAMPRLASESLDFSLHDAVNSEFLTNRTNEKAQMQSLNDRFASYIEKVRFLEQQNKILLAELEQLRGKGT----SRIGDLYEDEMRELRRQVDQLTNEKARVEVHRDNLADDIERLREKL-----------------RDEIS----------------------QREEAEAT---MQSFRQDVDSAALARLDLERKIESLQEEINFLKKLHDEEMLEFQSQVQQQQQHVQVDMDVAKPDLTAALRDVRLQYENLATKNIQESEEWYKSKFADLTEAAARNNEALRMAKQEANDYRRQVQALTCEVDALKGTNESLERQLREMEENFSLESNGYQDTIGRLEEDMHNIKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR 399          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: desmb (desmin [Source:NCBI gene;Acc:101174730])

HSP 1 Score: 106.686 bits (265), Expect = 6.973e-24
Identity = 107/369 (29.00%), Postives = 182/369 (49.32%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFASYIEK RFLE QN+ L+ E+E+L+G   ++ ++I ++YE E+ +LR  V      ++ +E + D+L  ++D L+ RL   E+I          Q++D    E  L   R       ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL T       +  M   + ++  ALRDI+T+YE        + E  Y  ++ ++  + +++N      ++E    + QIQ+    I  L+  N      +  +   +       +  +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +TL+
Sbjct:  104 RTNEKAELQHLNDRFASYIEKVRFLEQQNQALSVEVERLRG---REPTRIADLYEEEMRELRRQVEILTNQRSRVEVERDNLAEDLDKLKLRLQ--EEI---------LQKEDA---ENNLAAFR-------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQTQMQETQVQIQMDMSKPDLTAALRDIRTQYEGIAAKNIADAEDWYKSKVSDLNQAVSKNNEALKQARQETMEFRHQIQAYTCEIDSLKGTNESLMRQMRELEDRHGCEAARFQDTIARLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESRITMPVQSYSTLT 426          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 105.145 bits (261), Expect = 1.444e-23
Identity = 109/370 (29.46%), Postives = 181/370 (48.92%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQ-------SMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            K+ R  EK ++  LN+RFASYIEK R LE QNK L  E+ +L+G   ++ S++ +IY+ E+ +LR  V+     KA LE + D+L  ++  L++RL                                     Q   V +++ E     ++L   RQD ++ +L+ + LE +++SL++ + F K+IH+ E++E            ++   + ++  ALRDI+ +YEN  T   QE E  Y  +  ++  +  R+       K+E +  + QIQ       ++R     LE Q  E E       A Y++T       +  L+E++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+   
Sbjct:   80 KETRTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLRG---KEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNLAADLATLKQRL-------------------------------------QDEIVQRQEAE-----NNLNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDLDVSKPDLTAALRDIRLQYENLATSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANEYRRQIQVLTCDLDALRGTNESLERQLREMEDRCAMETAGYQDT-------VSRLEEEIQALKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITIP 397          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 105.145 bits (261), Expect = 1.655e-23
Identity = 111/370 (30.00%), Postives = 182/370 (49.19%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQ-------SMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            K+ R  EK ++  LN+RFASYIEK R LE QNK L  E+ +L+G   ++ S++ +IY+ E+ +LR  V+     KA LE + D+L  ++  L++RL                        + E+V+       Q A+ N            L   RQD ++ +L+ + LE +++SL++ + F K+IH+ E++E            ++   + ++  ALRDI+ +YEN  T   QE E  Y  +  ++  +  R+       K+E +  + QIQ       ++R     LE Q  E E       A Y++T       +  L+E++   ++E+   L E Q LL+ KL L++EIA Y KLLE EESR+   
Sbjct:   80 KETRTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLRG---KEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNLAADLATLKQRL------------------------QDEIVQ------RQEAENN------------LNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDLDVSKPDLTAALRDIRLQYENLATSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANEYRRQIQVLTCDLDALRGTNESLERQLREMEDRCAMETAGYQDT-------VSRLEEEIQALKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITIP 397          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 1064.68 bits (2752), Expect = 0.000e+0
Identity = 672/695 (96.69%), Postives = 673/695 (96.83%), Query Frame = 1
Query:   37 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2121
            MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQ FGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQG SNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS DGNATLSQFMSFT                +G GG G SGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA
Sbjct:    1 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQVFGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMSFT--------------SSSGAGGAGGSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 681          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 1056.59 bits (2731), Expect = 0.000e+0
Identity = 672/695 (96.69%), Postives = 673/695 (96.83%), Query Frame = 1
Query:   37 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2121
            MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQ FGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQG SNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS DGNATLSQFMS               +    GGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA
Sbjct:    1 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQVFGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMS-------------FTSSSGAGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 682          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 670/690 (97.10%), Postives = 671/690 (97.25%), Query Frame = 1
Query:   52 METSKKIAVKTTKQEVSGSGSSGGLNEQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2121
            METSKKIAVKTTKQEVSGSGSSGGLNEQQ FGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQG SNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS DGNATLSQFMS               + GAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA
Sbjct:    1 METSKKIAVKTTKQEVSGSGSSGGLNEQQVFGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQFMS------------FTSSSGAGGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 678          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030596.1 (SMESG000030596.1)

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 365/433 (84.30%), Postives = 391/433 (90.30%), Query Frame = 1
Query:  304 ITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFM 1602
            +TT+ SY KPISQPRN+L+DLQKT+        NSQ       LIRGDSVALQSGVTSMKKGRAQEKR+LQ+LNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQR DI+ FEGELVEL+RFKGTQGADV  EKEEVK+L+D LKKLRQDYE+EALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV+WQSEMGRALRDIQ EYENKLTGIKQEL++SYG QMQEI+TSKTRDNVETTHYKEENSR+KSQIQSMR RIA+LE QNAEYE NL NIR NYEETQR+L+ QL  +Q+QL+GTQQELT A TELQSLLDAKLGLELEIAAYA+LLE EE RV  S D  + +SQFM
Sbjct:   49 VTTNHSYIKPISQPRNSLRDLQKTT-------ENSQN-----MLIRGDSVALQSGVTSMKKGRAQEKRNLQELNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRNDIAAFEGELVELKRFKGTQGADVTLEKEEVKSLKDSLKKLRQDYEREALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVFWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQMQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRMRIAELERQNAEYEINLKNIRDNYEETQRNLQSQLFSMQDQLSGTQQELTAASTELQSLLDAKLGLELEIAAYARLLEIEEERVLSSADQRSVMSQFM 469          

HSP 2 Score: 134.806 bits (338), Expect = 1.281e-32
Identity = 67/120 (55.83%), Postives = 92/120 (76.67%), Query Frame = 1
Query: 1762 QSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2121
             SK+M  RRTT GNISIAE+D  G  I+LEN+G++ +SL GM IKR +DG  N ++++I  K++L+AGE+I++C  GK TGKG+E+EI++ SWG G NV+T LCD+ G EKAA YQE+ A
Sbjct:  533 HSKKMSSRRTTTGNISIAESDESGLFIVLENMGSQTQSLSGMMIKRNIDGVANFVTYSIPKKIDLSAGERITICGHGKKTGKGKELEIEEDSWGFGENVITALCDANGEEKAALYQEIVA 652          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030599.1 (SMESG000030599.1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 346/434 (79.72%), Postives = 394/434 (90.78%), Query Frame = 1
Query:  304 ITTSRSYYKPISQPRNNLKDLQKTSG-MSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFM 1602
            ++T+RS YKPISQ RNN KDLQ+ +  +SYS QS +QQ  S +PLIRGDSVALQ+G+ S+KKGRAQEK+DLQ+LNERFASYIEKARFLE QNKQL  EIE+LKGGT+QD SK+KEIYEVEINQLR+L+NESEKS+APLE QV+SLEYEI DL+KRL++LEDI +QY++TIDKQR+++  FEGE+VEL+RFK T+  D  KEK+E   LRD++KKLRQ+YEKEALAH+TLEH+LQSL+E +EFEKQIH TEVKELATVAY++PTKENMVYWQSEMGRALRDIQTEYENKL+GIKQELEASY LQMQEIRTSKTRDNVETT YKEENSRIKSQIQSMRSRI DLEMQNAEYEHNLNNIRANYEETQRSLELQLL LQEQLTGTQQ+LT+ LTELQSLLDAKLGLELEIAAY+KLLEFEE+RVNFS DGN   SQF+
Sbjct:  103 VSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLSGIKQELEASYSLQMQEIRTSKTRDNVETTQYKEENSRIKSQIQSMRSRITDLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT--SQFI 534          

HSP 2 Score: 146.362 bits (368), Expect = 3.498e-36
Identity = 75/127 (59.06%), Postives = 102/127 (80.31%), Query Frame = 1
Query: 1735 MTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2115
            ++  E  +YQ KRMKFRRTTKGNISIAE D+ G  I+LEN GTK ESL GMTIKR +DG+E+ +SFTI  + +L++GEK+++ AKGK TGKG+E+EI++  WG+G+ +VT+L ++EG EKA HYQE+
Sbjct:  626 LSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAKGKKTGKGKELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEI 752          
The following BLAST results are available for this feature:
BLAST of Intermediate filament protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIM5.817e-3030.75vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM9.761e-3030.75vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM9.761e-3030.75vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
LMNA6.617e-2625.52lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA6.811e-2625.52lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifa-19.683e-6831.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.342e-6731.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.396e-6731.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.396e-6731.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.396e-6731.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LamC6.071e-2726.50gene:FBgn0010397 transcript:FBtr0087512[more]
LamC8.237e-2626.40gene:FBgn0010397 transcript:FBtr0333166[more]
Lam2.859e-2523.99gene:FBgn0002525 transcript:FBtr0346460[more]
Lam2.859e-2523.99gene:FBgn0002525 transcript:FBtr0307059[more]
Lam2.859e-2523.99gene:FBgn0002525 transcript:FBtr0307058[more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
viml4.242e-2729.36vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-174... [more]
vim3.390e-2528.79vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3][more]
desma2.802e-2429.44desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
desma2.891e-2429.44desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
desmb2.156e-2128.38desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vim3.235e-2729.03vimentin [Source:NCBI gene;Acc:496727][more]
vim4.701e-2729.03vimentin [Source:NCBI gene;Acc:496727][more]
vim4.986e-2729.03vimentin [Source:NCBI gene;Acc:496727][more]
timm136.934e-2724.70translocase of inner mitochondrial membrane 13 hom... [more]
timm131.127e-2524.87translocase of inner mitochondrial membrane 13 hom... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vim1.673e-3030.28vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Vim2.707e-3030.28vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Gfap6.368e-2327.69glial fibrillary acidic protein [Source:MGI Symbol... [more]
Gfap1.145e-2227.69glial fibrillary acidic protein [Source:MGI Symbol... [more]
Des2.388e-2229.44desmin [Source:MGI Symbol;Acc:MGI:94885][more]
back to top
BLAST of Intermediate filament protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01240|NF60_DORPE2.241e-7342.5560 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|Q01241|NF70_DORPE2.389e-7242.5570 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|P90901|IFA1_CAEEL1.707e-6631.12Intermediate filament protein ifa-1 OS=Caenorhabdi... [more]
sp|P90900|IFA4_CAEEL2.177e-6029.11Intermediate filament protein ifa-4 OS=Caenorhabdi... [more]
sp|O02365|IFA2_CAEEL1.018e-5629.68Intermediate filament protein ifa-2 OS=Caenorhabdi... [more]
back to top
BLAST of Intermediate filament protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182131199.787e-10240.79tr|A0A267FSC2|A0A267FSC2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157877541.432e-10140.79tr|W0GAA8|W0GAA8_9PLAT Intermediate filament b-lik... [more]
gnl|BL_ORD_ID|181979351.477e-9538.81tr|A0A267GC02|A0A267GC02_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183390721.921e-9538.81tr|A0A267EDW2|A0A267EDW2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|200213062.507e-8936.14tr|O97339|O97339_9ANNE Cytoplasmic intermediate fi... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vim2.436e-2729.83vimentin [Source:NCBI gene;Acc:103044141][more]
vim1.133e-2629.80vimentin [Source:NCBI gene;Acc:103044141][more]
gfap2.990e-2428.69glial fibrillary acidic protein [Source:NCBI gene;... [more]
gfap3.352e-2428.46glial fibrillary acidic protein [Source:NCBI gene;... [more]
desmb5.590e-2429.27desmin [Source:NCBI gene;Acc:103039642][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb21.074e-2023.93lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
desmb1.067e-1627.39desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
ENSPMAT00000010102.11.395e-1627.09pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 g... [more]
zgc:1369302.126e-1526.40zgc:136930 [Source:ZFIN;Acc:ZDB-GENE-060312-16][more]
ENSPMAT00000010061.12.326e-1427.37pep scaffold:Pmarinus_7.0:GL478364:48285:55057:1 g... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intermediate filament protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372254.351e-2126.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
viml9.442e-2830.02vimentin [Source:NCBI gene;Acc:101163931][more]
viml2.554e-2730.17vimentin [Source:NCBI gene;Acc:101163931][more]
desmb6.973e-2429.00desmin [Source:NCBI gene;Acc:101174730][more]
gfap1.444e-2329.46glial fibrillary acidic protein [Source:NCBI gene;... [more]
gfap1.655e-2330.00glial fibrillary acidic protein [Source:NCBI gene;... [more]
back to top
BLAST of Intermediate filament protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030598.10.000e+096.69SMESG000030598.1[more]
SMESG000030598.10.000e+096.69SMESG000030598.1[more]
SMESG000030598.10.000e+097.10SMESG000030598.1[more]
SMESG000030596.11.281e-3284.30SMESG000030596.1[more]
SMESG000030599.13.498e-3679.72SMESG000030599.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024865 ID=SMED30024865|Name=Intermediate filament protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2214bp
GATCTTATAAATACAACATTAATTGTATAGTGAACTATGTTAGCCATTGA
AATGGAGACAAGTAAAAAAATCGCAGTCAAAACTACGAAACAAGAAGTAA
GTGGAAGTGGAAGCTCTGGTGGACTAAATGAACAACAAGCTTTTGGAAGT
GGTAGCTTTCGAACCGGGTCTGGAGGTGTACAGATAAGTGCTAGTGGAGC
AATTGGATCTAGCAGTTCAGGCGGAGTTAGTGGCACTGGCGGAGTTGGTA
GCATTGGTGGAGGCAGTGGTGCTGGTGGTGAAGGAACAGGAGCTAGCACA
GTTATCACTACAAGCAGATCTTATTATAAGCCTATCAGTCAACCTAGAAA
TAATTTAAAAGACTTACAAAAAACTTCTGGTATGAGTTACAGTGCACAAT
CAAACTCCCAGCAAGGTTTAAGTAATATTCCATTGATTAGGGGAGACAGT
GTTGCTCTACAATCTGGAGTAACTTCAATGAAAAAAGGACGAGCTCAAGA
GAAAAGAGATCTTCAGGATCTGAATGAAAGATTCGCTAGTTACATTGAAA
AAGCTCGATTTCTAGAGGCGCAAAATAAACAGCTAGCCAATGAGATTGAA
AAGTTAAAAGGTGGAACCGTCCAGGACAACTCAAAGATCAAAGAAATCTA
TGAAGTCGAAATCAATCAACTTCGAGCTTTGGTAAATGAATCGGAAAAAA
GCAAAGCTCCTTTAGAAGCTCAAGTTGATTCTCTTGAATACGAAATTGAT
GATTTGAGAAAACGATTAATGATGCTGGAAGACATCAACTCTCAGTACAA
ATCCACCATCGATAAGCAACGCAAAGACATTTCTGGATTTGAAGGGGAAT
TGGTGGAGCTAAGAAGATTCAAAGGCACCCAAGGTGCTGATGTAAATAAA
GAAAAGGAAGAAGTAAAAACACTAAGAGACGATTTGAAAAAATTGAGACA
AGATTATGAGAAAGAAGCTCTAGCTCATCTCACCCTTGAACATGAATTAC
AAAGCTTGAAAGAAGCATTAGAATTCGAGAAACAAATACATGACACAGAA
GTAAAAGAGCTGGCAACCGTTGCATATCGAGACCCAACGAAAGAAAATAT
GGTTTACTGGCAAAGCGAAATGGGACGCGCGTTACGAGACATTCAAACTG
AATATGAAAACAAGCTTACAGGAATCAAACAAGAATTGGAGGCTTCTTAT
GGTTTACAAATGCAGGAAATACGAACAAGTAAAACCAGAGACAATGTGGA
AACGACCCATTACAAAGAAGAGAACAGCCGAATAAAATCTCAAATCCAAA
GCATGAGATCGAGAATCGCTGATCTTGAGATGCAGAATGCTGAATACGAA
CACAACTTGAATAATATTCGTGCTAATTACGAAGAAACTCAAAGAAGTCT
TGAATTGCAGTTGTTGTATTTGCAAGAGCAATTGACAGGAACTCAACAAG
AATTGACAGTCGCTTTGACCGAACTCCAAAGCTTATTGGACGCGAAGTTG
GGACTGGAATTAGAAATCGCAGCCTATGCAAAACTATTAGAATTCGAAGA
GAGTCGTGTCAATTTCTCTGGTGATGGCAACGCTACTTTATCTCAATTTA
TGAGTTTCACATCAAGTAGCGGAGCTGGAGGTGCTGGAGGGGCTGGAGGT
GCTGGTGGTGCTGGAGGAGGAGGAGGAGGAAGCAGTGGGTTCGGATCAGG
AAGTAGAATTGGAGGGTCAAGTGGTTTCAGCGGAATGACAGAAAGAGAAA
CAACTGACTATCAGTCAAAACGAATGAAATTTAGACGAACGACAAAGGGA
AACATTTCCATTGCAGAGACTGACCTTATAGGTTCAACAATTATTCTGGA
AAATATTGGGACCAAAGTGGAATCACTCGAAGGTATGACTATTAAAAGAG
TAGTCGACGGCAGCGAAAATAAAATCTCATTTACCATTTCCGGAAAAGTT
AACTTAAATGCTGGTGAAAAGATTTCTCTTTGTGCCAAAGGGAAAATAAC
CGGCAAAGGACGAGAAATCGAAATTGATGATGCTTCATGGGGGGTTGGTA
ACAATGTCGTAACAACACTTTGTGATTCAGAAGGAGCGGAAAAGGCAGCT
CACTATCAAGAGGTTTCGGCCTAGAAACCTTGCTAAATATTAAACTGAAT
TTGTATGAACATAACAAAATTTTTAGTAATTTAATAAAAGTTTATTATTT
TATAAATCCAAAAA
back to top

protein sequence of SMED30024865-orf-1

>SMED30024865-orf-1 ID=SMED30024865-orf-1|Name=SMED30024865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=696bp
MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAFGSGSFRTGSGGVQI
SASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPI
SQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKK
GRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSK
IKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDI
NSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDL
KKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDP
TKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKT
RDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEE
TQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKL
LEFEESRVNFSGDGNATLSQFMSFTSSSGAGGAGGAGGAGGAGGGGGGSS
GFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGS
TIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCA
KGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA*
back to top
Aliases
The feature 'Intermediate filament protein' has the following synonyms
Synonym
vim-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002142parenchyma
PLANA:0000022Category 5 cell
PLANA:0000034epidermis
PLANA:0004529integumental system
Vocabulary: INTERPRO
TermDefinition
IPR001664IF
IPR016451Intermed_filament_ifa/ifb
IPR001322Lamin_tail_dom
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000008Stage 8
PLANA:0000007Stage 7