Intermediate filament b-like protein

Overview
NameIntermediate filament b-like protein
Smed IDSMED30024865
Uniprot Best hit60 kDa neurofilament protein OS=Doryteuthis pealeii PE=2 SV=1 (E=2.66344e-72)
Length (bp)2214
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intermediate filament b-like protein (SMED30024865) t-SNE clustered cells

Violin plots show distribution of expression levels for Intermediate filament b-like protein (SMED30024865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intermediate filament b-like protein (SMED30024865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intermediate filament b-like protein (SMED30024865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Intermediate filament b-like protein ( vim-3 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 5 cell, integumental system and definitive epidermis

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Intermediate filament b-like protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 125.176 bits (313), Expect = 7.496e-30
Identity = 135/439 (30.75%), Postives = 223/439 (50.80%), Query Frame = 1
Query:  307 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            +TSRS Y   S P           G  Y+ +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   47 STSRSLYA--SSP-----------GGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament b-like protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 125.176 bits (313), Expect = 1.043e-29
Identity = 135/439 (30.75%), Postives = 223/439 (50.80%), Query Frame = 1
Query:  307 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            +TSRS Y   S P           G  Y+ +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   47 STSRSLYA--SSP-----------GGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament b-like protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 125.176 bits (313), Expect = 1.043e-29
Identity = 135/439 (30.75%), Postives = 223/439 (50.80%), Query Frame = 1
Query:  307 TTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            +TSRS Y   S P           G  Y+ +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   47 STSRSLYA--SSP-----------GGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament b-like protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 114.39 bits (285), Expect = 6.574e-26
Identity = 148/580 (25.52%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  439 RGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLR--------------KRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2097
            R  + A  + ++  +  R QEK DLQ+LN+R A YI++ R LE +N  L   I + +    ++ S IK  YE E+   R  ++   K +A L+ ++  +  E  +L+               RL  LE + +  ++ +     +    EGEL +LR       A + + K   K L+D++  LR+         +  E+ LQ++KE L+F+K I+  E++E      R  T+   +       ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK---KQLQDEM--LRR---------VDAENRLQTMKEELDFQKNIYSEELRE---TKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament b-like protein vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 115.161 bits (287), Expect = 6.717e-26
Identity = 148/580 (25.52%), Postives = 265/580 (45.69%), Query Frame = 1
Query:  439 RGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLR--------------KRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDN--VETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEID-----DASWGVGNNVVTTLCDSEGAEKA 2097
            R  + A  + ++  +  R QEK DLQ+LN+R A YI++ R LE +N  L   I + +    ++ S IK  YE E+   R  ++   K +A L+ ++  +  E  +L+               RL  LE + +  ++ +     +    EGEL +LR       A + + K   K L+D++  LR+         +  E+ LQ++KE L+F+K I+  E++E      R  T+   +       ++S +  AL++++ ++E+++   K+ELE +Y  ++   R S  R++  V   H + + SRI+  I S+ ++++ L+ Q A  E  L ++  +    + +    L   + ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S    +  S+  + + SS   G G                                    E+T+ +S   +  RT+ G +++ E D  G  + L N   + +S+    IKR  +G +  +++    K  L AG+ +++ A G   G       D       +WG GN++ T L +S G E A
Sbjct:   11 RSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK---KQLQDEM--LRR---------VDAENRLQTMKEELDFQKNIYSEELRE---TKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIR--IDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKL----------------------------ESTESRSSFSQHARTS-GRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKR-QNGDDPLLTYRFPPKFTLKAGQVVTIWAAG--AGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament b-like protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 234.187 bits (596), Expect = 7.446e-67
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament b-like protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.802 bits (595), Expect = 1.024e-66
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament b-like protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.802 bits (595), Expect = 1.024e-66
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament b-like protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.417 bits (594), Expect = 1.076e-66
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament b-like protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 233.417 bits (594), Expect = 1.076e-66
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 565          
BLAST of Intermediate filament b-like protein vs. Ensembl Fly
Match: LamC (Lamin C [Source:FlyBase gene name;Acc:FBgn0010397])

HSP 1 Score: 117.087 bits (292), Expect = 6.672e-27
Identity = 150/566 (26.50%), Postives = 263/566 (46.47%), Query Frame = 1
Query:  451 VALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRL--MMLEDINSQYKSTIDKQR-KDISG-FEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELAT---VAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVA-LTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTE-RETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA 2121
            V   S  +  +  R QEK +LQ LN+R A YI++ R LE +N +L  E+   +    ++ S +K +YE E+   R L++E+ K KA LE  +  L  E DDL+ RL     E   ++  + + + R  +++G +   L + ++F+  Q  ++  E E ++   DDL+K     E E LA + LE++ QSL+E L F+ Q+H  E+ E  +   +   +        +++++ ++L++++ +YE ++   ++E+E  Y  ++Q ++ +  R    +    EE   ++++I  + +++ +LE  NA     +  +  N  +T+R    Q +   E      ++     L E Q L+D K+ L+LEIAAY KLL  EE R+N    G  T    +S   S     A    G     G    + G    S +         +E R  ++Y           KG++ I E D+ G  I L N GT+  +L G  + R+    E    F+   KV   A   I     G        + +    W V N++ + L +++  E  A Y  V A
Sbjct:   30 VGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFED-QAKELALENERLRRQLDDLRK---QLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELE-NLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEY-----SVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNL-VMKKKWPVANSMRSVLANAD-KEDVASYDRVRA 583          
BLAST of Intermediate filament b-like protein vs. Ensembl Fly
Match: LamC (Lamin C [Source:FlyBase gene name;Acc:FBgn0010397])

HSP 1 Score: 113.62 bits (283), Expect = 8.873e-26
Identity = 146/553 (26.40%), Postives = 257/553 (46.47%), Query Frame = 1
Query:  451 VALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRL--MMLEDINSQYKSTIDKQR-KDISG-FEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELAT---VAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVA-LTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTE-RETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSE 2082
            V   S  +  +  R QEK +LQ LN+R A YI++ R LE +N +L  E+   +    ++ S +K +YE E+   R L++E+ K KA LE  +  L  E DDL+ RL     E   ++  + + + R  +++G +   L + ++F+  Q  ++  E E    LR  L  LR+  E E LA + LE++ QSL+E L F+ Q+H  E+ E  +   +   +        +++++ ++L++++ +YE ++   ++E+E  Y  ++Q ++ +  R    +    EE   ++++I  + +++ +LE  NA     +  +  N  +T+R    Q +   E      ++     L E Q L+D K+ L+LEIAAY KLL  EE R+N    G  T    +S   S     A    G     G    + G    S +         +E R  ++Y           KG++ I E D+ G  I L N GT+  +L G  + R+    E    F+   KV   A   I     G        + +    W V N++ + L +++
Sbjct:   30 VGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFED-QAKELALENER---LRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELE-NLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEY-----SVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIAGDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNL-VMKKKWPVANSMRSVLANAD 571          
BLAST of Intermediate filament b-like protein vs. Ensembl Fly
Match: Lam (Lamin [Source:FlyBase gene name;Acc:FBgn0002525])

HSP 1 Score: 112.079 bits (279), Expect = 3.082e-25
Identity = 136/567 (23.99%), Postives = 262/567 (46.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2085
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R L++++ + +A  E  +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament b-like protein vs. Ensembl Fly
Match: Lam (Lamin [Source:FlyBase gene name;Acc:FBgn0002525])

HSP 1 Score: 112.079 bits (279), Expect = 3.082e-25
Identity = 136/567 (23.99%), Postives = 262/567 (46.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2085
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R L++++ + +A  E  +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament b-like protein vs. Ensembl Fly
Match: Lam (Lamin [Source:FlyBase gene name;Acc:FBgn0002525])

HSP 1 Score: 112.079 bits (279), Expect = 3.082e-25
Identity = 136/567 (23.99%), Postives = 262/567 (46.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVD--GSENKISFTISGKVNLN-------AGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEG 2085
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R L++++ + +A  E  +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+++ Y  ++Q ++ +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++E+T  L E Q L+D K+ L+LEIAAY KLL  EE+R+N +   N    Q  SF+ S              +       +                    E+ D+         + KGN+ I E D  G  + L N G++  ++ G  ++R+++  G      F  S ++  N       A  K S      +  K ++       W   +N  T L +SEG
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ--SFSQSLRNSTRATPSRRTPSAAVKRKRAVVD-----------------ESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQK-------WVSADNTRTILLNSEG 568          
BLAST of Intermediate filament b-like protein vs. Ensembl Zebrafish
Match: viml (vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-1743])

HSP 1 Score: 116.316 bits (290), Expect = 3.909e-27
Identity = 123/419 (29.36%), Postives = 204/419 (48.69%), Query Frame = 1
Query:  373 TSGMSYSAQSNSQQGLSNIPLIRGDSVALQ---SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVN--ESEKSKAPLEAQVDSLEYEIDDLRKRLM--MLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSF 1608
            +S + Y+++S   +  + +P +  +++      +  T  K  R  EK  +Q LN+RFASYIEK RFLE QNK L+ E+E+L+G   Q +S+I ++YE E+  LR  V+   +EK++A  E   D+L  +++ L+++L   ML             QR+D                                 + +K  RQD +  ALA + LE +++SL++ L F K +HD E+ EL T       +  M   + ++  ALRD++ +YEN  +   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L   N   E  +  +  N+       +  +  L+E +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       A L  F SF
Sbjct:   39 SSPVIYASKSAKVRSSAAMPRLTSETLDFNLSDALNTEFKANRLNEKAQMQSLNDRFASYIEKVRFLEQQNKILSAELEQLRG---QRSSRIADLYEEEMRDLRRQVDLLTTEKTRA--EVMRDNLAEDVERLKEKLQDEML-------------QREDAE-------------------------------NSMKSFRQDVDNAALARVDLERKVESLQDELAFLKNLHDEELAELQTQIQGQQVQVEMDMAKPDLTAALRDVRLQYENLASKNIQESEDWYKSKFADLTEAANRNNEALRLAKQETNEYRRQVQAITCELDALRGTNESLERQMREMEENFSMESSGFQNTIGRLEEDIGNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI------AAPLPNFSSF 402          
BLAST of Intermediate filament b-like protein vs. Ensembl Zebrafish
Match: vim (vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3])

HSP 1 Score: 110.538 bits (275), Expect = 2.871e-25
Identity = 114/396 (28.79%), Postives = 191/396 (48.23%), Query Frame = 1
Query:  421 SNIPLIRGDSVALQSGV-----TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLM--MLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSG 1572
            S  PL R  +  L  G+     T  K  R  EK ++Q LN+RFASYI+K RFLE QNK L  E+E+L+G      S++ ++YE E+ +LR  V++    K+ +E   D+L  +I+ L++RL   ML             QR+D                                 + L+  RQD +  +LA L LE +++SL+E + F K++HD E+ E+         + +M   + ++  AL+D++ +YE   +   QE E  Y  +  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  +  +  ++       +  +  L++ +   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+     NFS 
Sbjct:   63 SGAPLPRLATDTLDFGLAEAINTEFKANRTNEKAEMQHLNDRFASYIDKVRFLEQQNKILIAELEQLRGKGA---SRVGDLYEDEMRELRRQVDQLTGEKSKVEVDRDNLGEDIERLKERLQEEML-------------QREDAE-------------------------------NSLRSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEELAEMQIQMQEQHLQIDMEVAKPDLTAALKDVRQQYETLASRNLQESEDWYKSKFADLSEAAARNNETIRLAKQEANDYRRQLQALTCDLEALKGTNESLERQMRELEDSFSMEASGYQDTIGRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITSPFPNFSS 411          
BLAST of Intermediate filament b-like protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 108.227 bits (269), Expect = 2.392e-24
Identity = 111/377 (29.44%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQN-------AEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFASYIEK RFLE QN  L  EIE+L+G   ++ ++I E+YE E+ +LR  V      ++ +E + D+L   +DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++ L E + F ++IH+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E  + + Q+QS    I  L+  N       +E E  L      Y++T       +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++      ++LS
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIEGLHEEIAFLRKIHEEEIRELQNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDT-------IARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISLPVQSFSSLS 421          
BLAST of Intermediate filament b-like protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 107.842 bits (268), Expect = 2.434e-24
Identity = 111/377 (29.44%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQN-------AEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFASYIEK RFLE QN  L  EIE+L+G   ++ ++I E+YE E+ +LR  V      ++ +E + D+L   +DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++ L E + F ++IH+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E  + + Q+QS    I  L+  N       +E E  L      Y++T       +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR++      ++LS
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIEGLHEEIAFLRKIHEEEIRELQNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDT-------IARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISLPVQSFSSLS 421          
BLAST of Intermediate filament b-like protein vs. Ensembl Zebrafish
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 98.9821 bits (245), Expect = 1.902e-21
Identity = 105/370 (28.38%), Postives = 181/370 (48.92%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ LN+RFA+YIEK R LE QN+ L  E+E+L+G   ++ ++I ++YE E+ +LR  V      ++ +E + D+L    DDL+K +L + E+I     +  ++   ++S F               ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  + +++N      K E    + QIQS    I  L+  N      + ++   +     +L+  +  L+ ++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +T+S
Sbjct:  106 RTNEKAELQHLNDRFANYIEKVRMLEQQNQVLGVEVERLRG---REPTRIADLYEDEMRELRREVEVVTNHRSRVEVERDNL---ADDLQKLKLRLQEEI-----ALREEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQAQMQETQVQIQMDMSKPDLTAALRDIRAQYEGIAAKNIAEAEDWYKSKVSDLNQAVSKNNEALKQSKLETMEYRHQIQSYTCEIDSLKGSNESLMRQMRDMEDRHGREAGALQDTIARLEAEIANMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRIVMPMQSYSTIS 428          
BLAST of Intermediate filament b-like protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:Xenbase;Acc:XB-GENE-493024])

HSP 1 Score: 117.472 bits (293), Expect = 1.216e-27
Identity = 108/372 (29.03%), Postives = 192/372 (51.61%), Query Frame = 1
Query:  481 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKG-GTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK L  E+E+LKG GT    S+I ++YE E+ +LR  +++   +K  +E   D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + E  Y  +  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       +++S
Sbjct:  117 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSSMS 442          
BLAST of Intermediate filament b-like protein vs. Ensembl Xenopus
Match: lmnb1 (lamin B1 [Source:Xenbase;Acc:XB-GENE-489658])

HSP 1 Score: 101.293 bits (251), Expect = 3.667e-22
Identity = 102/392 (26.02%), Postives = 207/392 (52.81%), Query Frame = 1
Query:  430 PLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLR----KRLMMLEDINSQYKST---IDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL-----ATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            P   G   ++ + ++  +  R QEK DLQ+LN+R A YI+K R LE++N  L  ++ + +    ++ S IKE+YE E+   R  ++++ + +A L+ ++  +  E +DLR    K+   LE   ++++ T   ++ +   ++  + E       K  QG +V   K E+  L   L   ++  E+E L  + LE+  QSL E L+F K +++ E+KE        +   D  K+  + ++ ++ +AL D++ ++++++T  K+ELE +Y  +++  R S   ++      +EE    + +I S+ S++++L+ ++  +   +  +     + + +    L   + ++   + ++   L + + LLD KL L++EI+AY KLLE EE R+  S
Sbjct:    9 PRSSGRRSSMNTPLSPTRISRLQEKVDLQELNDRLAVYIDKVRSLESENSLLHVQVTEREEVRSREVSGIKELYETELADARRSLDDTARERARLQLELSKISVEHEDLRASFSKKESELESAQARFRETEALLNSKNAALATTQSE------NKSLQG-EVEDLKAEIGQLESALALAKKQLEEEILIKVDLENRCQSLIEELDFRKNVYEEEIKETRRRHETRLVEVDSGKQ--IEYEHKLSQALADMREQHDSQVTLYKEELEHTYQSKLENARLSSEMNSSAVNSTREELMESRYRIDSLTSQLSELQKESRAWHDRMQELEDMLAKEKDNSRKMLAEREREMADIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLS 391          
BLAST of Intermediate filament b-like protein vs. Ensembl Xenopus
Match: lmnb1 (lamin B1 [Source:Xenbase;Acc:XB-GENE-489658])

HSP 1 Score: 101.293 bits (251), Expect = 3.744e-22
Identity = 102/392 (26.02%), Postives = 207/392 (52.81%), Query Frame = 1
Query:  430 PLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLR----KRLMMLEDINSQYKST---IDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL-----ATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            P   G   ++ + ++  +  R QEK DLQ+LN+R A YI+K R LE++N  L  ++ + +    ++ S IKE+YE E+   R  ++++ + +A L+ ++  +  E +DLR    K+   LE   ++++ T   ++ +   ++  + E       K  QG +V   K E+  L   L   ++  E+E L  + LE+  QSL E L+F K +++ E+KE        +   D  K+  + ++ ++ +AL D++ ++++++T  K+ELE +Y  +++  R S   ++      +EE    + +I S+ S++++L+ ++  +   +  +     + + +    L   + ++   + ++   L + + LLD KL L++EI+AY KLLE EE R+  S
Sbjct:    9 PRSSGRRSSMNTPLSPTRISRLQEKVDLQELNDRLAVYIDKVRSLESENSLLHVQVTEREEVRSREVSGIKELYETELADARRSLDDTARERARLQLELSKISVEHEDLRASFSKKESELESAQARFRETEALLNSKNAALATTQSE------NKSLQG-EVEDLKAEIGQLESALALAKKQLEEEILIKVDLENRCQSLIEELDFRKNVYEEEIKETRRRHETRLVEVDSGKQ--IEYEHKLSQALADMREQHDSQVTLYKEELEHTYQSKLENARLSSEMNSSAVNSTREELMESRYRIDSLTSQLSELQKESRAWHDRMQELEDMLAKEKDNSRKMLAEREREMADIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLS 391          
BLAST of Intermediate filament b-like protein vs. Ensembl Xenopus
Match: des.1 (desmin, gene 1 [Source:Xenbase;Acc:XB-GENE-494931])

HSP 1 Score: 98.9821 bits (245), Expect = 1.099e-21
Identity = 109/370 (29.46%), Postives = 183/370 (49.46%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLS 1593
            R  EK +LQ+LN+RF +YIEK R+LE QN+ L  E+ KLKG   ++ +++ E+YE E+ +LR  V+ +   ++ +E + D+L   +DDL+K +L + E+I          Q K+ +  E  L   R       ADV+       TL R DL++                  ++SL+E + F K+IH+ E++EL         +  +   + ++  ALRDI+ +YEN       E E  Y  ++ ++  +  ++N      K+E    + QIQS    I  L+  N      + ++   +       +  +  L+E++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+       + LS
Sbjct:   93 RTNEKVELQELNDRFVNYIEKVRYLEQQNQILVAEVNKLKG---KEPTRVNELYEEEMRELRRQVDLATNQRSRVEVERDNL---VDDLQKLKLRLQEEI----------QLKEDA--ENNLAAFR-------ADVD-----AATLARIDLER-----------------RIESLQEEIAFLKKIHEEEIRELQAQMQEQQLQVEIDVSKPDLTAALRDIRAQYENIAAKNVSEAEEWYKSKVSDLNQAAQKNNDSLRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRDLEERFSGEAAGYQDSIGRLEEEIRNMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRITLPIQTYSALS 415          
BLAST of Intermediate filament b-like protein vs. Ensembl Xenopus
Match: lmna (lamin A/C [Source:Xenbase;Acc:XB-GENE-920722])

HSP 1 Score: 99.7525 bits (247), Expect = 1.663e-21
Identity = 106/379 (27.97%), Postives = 187/379 (49.34%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKS---TIDKQRKDI--------SGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV--------YWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            R QEK DLQ+LN+R A YI+K R LE++N  L   I + +    ++ S IK  YE E+   R  ++   K +A L+ ++  +  E  +L+ R       N++ +S   T   + KD+        +     L E R  +     ++ + K  +  L   L   ++  + E L  +  E+  Q+LKE LEF+K I + E++E      R  T+  MV         ++S++  AL+D++ ++E ++   K+ELE +Y  +++  + S  R++      +EE  + + +I S+ ++++ L+ Q A  E  L ++   Y   + S    +     ++   +  +   L E Q LLD KL L++EI AY KLLE EE R+  S
Sbjct:   24 RLQEKEDLQELNDRLAVYIDKVRSLESENAGLRLRITESEEVVSREVSGIKGAYEAELADARKTLDSVAKERARLQLELSKIREEHKELKAR-------NAKKESDLLTAQARLKDLEALLNSKDAALTTALGEKRNLEN----EIRELKAHIAKLEASLADTKKQLQDEMLRRVDTENRNQTLKEELEFQKNISNEEMRE---TKRRHETR--MVEMDNGRQREFESKLADALQDLRAQHEGQVGLYKEELEKTYNAKLENAKQSAERNSSLVGEAQEEIQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDAYARERDSNRRLMSDKDREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLS 386          
BLAST of Intermediate filament b-like protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 125.946 bits (315), Expect = 2.165e-30
Identity = 132/436 (30.28%), Postives = 223/436 (51.15%), Query Frame = 1
Query:  304 ITTSRSYYKPIS--QPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            +TTS   Y   S  +P  +      + G +Y  +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE ++    L+  RQD +  +LA L LE +++SL+E + F K++HD E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR++  
Sbjct:   31 VTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAEST---LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament b-like protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 126.331 bits (316), Expect = 2.835e-30
Identity = 132/436 (30.28%), Postives = 223/436 (51.15%), Query Frame = 1
Query:  304 ITTSRSYYKPIS--QPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRI-------ADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            +TTS   Y   S  +P  +      + G +Y  +S++ +  S++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L  E+E+LKG   Q  S++ ++YE E+ +LR  V++    KA +E + D+L  +I  LR++L                        + E+++               +EE ++    L+  RQD +  +LA L LE +++SL+E + F K++HD E++EL         + ++   + ++  ALRD++ +YE+      QE E  Y  +  ++  +  R+N      K+E++  + Q+QS+   +         LE Q  E E N     ANY++T       +  LQ+++   ++E+   L E Q LL+ K+ L++EIA Y KLLE EESR++  
Sbjct:   31 VTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAEST---LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDT-------IGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament b-like protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 103.219 bits (256), Expect = 5.582e-23
Identity = 103/372 (27.69%), Postives = 184/372 (49.46%), Query Frame = 1
Query:  454 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK LA E+ +L+    ++ +K+ ++Y+ E+ +LR  +++   + A LE + D+   ++  LR++L   ++ N + ++            E  L   R           +E +E    R DL++                 +++SL+E ++F ++I++ EV+EL     +      M   + ++  ALR+I+T+YE   T   QE E  Y  +  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++E+   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   54 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQ--DETNLRLEA------------ENNLAAYR-----------QEADEATLARVDLER-----------------KVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament b-like protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 102.449 bits (254), Expect = 9.999e-23
Identity = 103/372 (27.69%), Postives = 184/372 (49.46%), Query Frame = 1
Query:  454 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK LA E+ +L+    ++ +K+ ++Y+ E+ +LR  +++   + A LE + D+   ++  LR++L   ++ N + ++            E  L   R           +E +E    R DL++                 +++SL+E ++F ++I++ EV+EL     +      M   + ++  ALR+I+T+YE   T   QE E  Y  +  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++E+   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   54 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQ--DETNLRLEA------------ENNLAAYR-----------QEADEATLARVDLER-----------------KVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament b-like protein vs. Ensembl Mouse
Match: Des (desmin [Source:MGI Symbol;Acc:MGI:94885])

HSP 1 Score: 102.064 bits (253), Expect = 2.142e-22
Identity = 106/360 (29.44%), Postives = 174/360 (48.33%), Query Frame = 1
Query:  490 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFS 1569
            R  EK +LQ+LN+RFA+YIEK RFLE QN  LA E+ +LKG   ++ +++ E+YE E+ +LR  V      +A ++ + D+L   IDDL++    L+                      E ++LR              EE +   ++L   R D +   LA + LE  ++SL E + F K++H+ E++EL         +  M   + ++  ALRDI+ +YE        E E  Y  ++ ++  +  ++N      K+E    + QIQS    I  L+  N      +  +   +       +  +  L+E++   + E+   L E Q LL+ K+ L++EIA Y KLLE EESR+N  
Sbjct:  104 RTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKG---REPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNL---IDDLQRLKAKLQ----------------------EEIQLR--------------EEAE---NNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLP 418          
BLAST of Intermediate filament b-like protein vs. UniProt
Match: sp|Q01240|NF60_DORPE (60 kDa neurofilament protein OS=Doryteuthis pealeii PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 2.663e-72
Identity = 157/369 (42.55%), Postives = 240/369 (65.04%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1560
            +GV  +K  R +EK+D++DLNERFA+YIEK RFLEAQNK+LA E+E+LK    ++ S IKE+YE E+ + R L++ + K K  L+ +V  L   ID L ++   LE+  + +   +  I +Q + ++  EGE+  LRR   +   +  ++   +  + D+++K+R D   E + HL  E+  Q+L+E LEF+K +H  E+KELA +AYRD T EN  +W++E+ +A+RDIQ EY+ K   ++ ++EA Y L++QE RT  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + E+   L ELQ L+D KL LELEIAAY KLLE EESRV
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRV 449          
BLAST of Intermediate filament b-like protein vs. UniProt
Match: sp|Q01241|NF70_DORPE (70 kDa neurofilament protein OS=Doryteuthis pealeii PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.423e-71
Identity = 157/369 (42.55%), Postives = 240/369 (65.04%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV 1560
            +GV  +K  R +EK+D++DLNERFA+YIEK RFLEAQNK+LA E+E+LK    ++ S IKE+YE E+ + R L++ + K K  L+ +V  L   ID L ++   LE+  + +   +  I +Q + ++  EGE+  LRR   +   +  ++   +  + D+++K+R D   E + HL  E+  Q+L+E LEF+K +H  E+KELA +AYRD T EN  +W++E+ +A+RDIQ EY+ K   ++ ++EA Y L++QE RT  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + E+   L ELQ L+D KL LELEIAAY KLLE EESRV
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRV 449          

HSP 2 Score: 53.5286 bits (127), Expect = 5.319e-6
Identity = 40/113 (35.40%), Postives = 65/113 (57.52%), Query Frame = 1
Query: 1780 FRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKI-SFTISGKVNLNAGEKISLCAKG-KITGKGRE-IEIDDASWGVGNNVVTTLCDSEGAEKAAHYQ 2109
            ++RT+KG++SI E D  G  I LE    K E+L G  I R VD  +NK+ ++ I   V L  G  + + +K  +   +G + +  ++ +WG G+NVVT L + +G +KA + Q
Sbjct:  503 YQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVD--DNKVYTYEIPNLV-LKTGTVVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQ 610          
BLAST of Intermediate filament b-like protein vs. UniProt
Match: sp|P90901|IFA1_CAEEL (Intermediate filament protein ifa-1 OS=Caenorhabditis elegans GN=ifa-1 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.397e-65
Identity = 173/556 (31.12%), Postives = 296/556 (53.24%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++LA +++ L+    +D   I+ +YE E+   + L++E+ K +  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + ++E+ Y L++QEI+T   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ EIA Y K+LE EE+R        A L Q +                                       +    + + ET   QS    F+R+ KGN+SI E    G  I+L+N    K E++    +KR +DG    + +T+     L AG+ + + A+ +      +  + DA  S+G GNNV T L + EG E+A H Q  S
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR--------AGLKQLVE-------------------------QVVKTHAITQETDTETMRVVKGETASRQS----FQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQS 573          
BLAST of Intermediate filament b-like protein vs. UniProt
Match: sp|P90900|IFA4_CAEEL (Intermediate filament protein ifa-4 OS=Caenorhabditis elegans GN=ifa-4 PE=1 SV=3)

HSP 1 Score: 216.853 bits (551), Expect = 1.227e-59
Identity = 161/553 (29.11%), Postives = 286/553 (51.72%), Query Frame = 1
Query:  466 GVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDA--SWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
              +++++ R +EK+++ +LN+R ASYIEK RFLEAQN+++  ++  L+G    D++ +K +YE E+   + L+ +S+K +A LE Q+  L  E+++ R +L   E      +  +D     +   E E+  L+R        +   K E   + D L   R   E+E L  +  ++++Q+L E  +F ++IHD+E+ +L  +A RD T EN  Y+++E+  A+R+I++EY++     + ++E+ Y L++QEI T  +R+ +E  + +EE  R+++ +  MR ++ADLE +N   E  + ++    EE  RS E  L      +   + E  + + ELQ L+D K  L+ EI  Y K+L+ EE+R        A L Q +                               +            + + ETT + S    + R+ KGNI+I E +  G  I+LENI  + E++    ++R + G + +I FT   +  L A + + + A+G+      +  + D   S+G GN+VVTTL + EG ++A+H Q  S
Sbjct:   59 AASAIRESRTREKKEMSELNDRLASYIEKVRFLEAQNRKMEKDLNLLRGKWGHDSTSVKVMYETELRSAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELLKRRISLMEESIGHLKRENHRMIDSLHHARNAVEQETLNRIDYQNQVQTLLEECDFIRRIHDSEIHDLLAMASRDTTVENREYFKNELSSAIREIRSEYDHVSNTTRTDIESWYKLKVQEIHTQNSRNCLEQNYAREEVKRLRTTLGDMRGKMADLEGRNLLLEKQIEDLNYQMEEDMRSYEQSLNDKDTSINKLRDESKILMVELQMLIDTKQTLDAEIVIYRKMLDGEENR--------AGLRQLV-------------------------EQVVKTTSIHQTKEIESLRVLKGETTSHSS----YSRSAKGNIAIQEAEPSGKYIVLENISRRDENIGDWKLRRKIAG-KREIVFTFPREFTLRAQKSVKIFARGQGVHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASHSQRAS 573          
BLAST of Intermediate filament b-like protein vs. UniProt
Match: sp|O02365|IFA2_CAEEL (Intermediate filament protein ifa-2 OS=Caenorhabditis elegans GN=ifa-2 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 4.210e-56
Identity = 165/556 (29.68%), Postives = 289/556 (51.98%), Query Frame = 1
Query:  460 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIG-TKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEI--DDASWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            Q+  ++++  R +EK+++ +LN+R ASYIEK RFL+AQN++L  +++ L+G   +    +K +YE+EI     +V ++ K     E ++  L+ ++D+LRK+    +   ++ +  ID     +S  E E+  L+R       +V + K+E   L  +L+++R + ++E L  +  +++++++ E ++F K+  +TE+KEL   A RD T EN  Y+++E+  A+RDI+ EY+  + G + ++E+ Y L++QEI T   R N E  + KEE  R+++Q   +R +++DLE +N   E  + ++    E+ QRS E  L     Q+   ++E    + ELQ LLD K  L+ E+  Y ++LE      N  G+G   L + +  TS+                                        T R      S R  ++R+ KGN++I ET   G  +ILEN    K E L    +KR +DG + +I FT      L+  + + + A+G+      E+ I   D ++GVG NV T L +++G E+A H Q  S
Sbjct:   58 QNAASTIRDNREREKKEIMELNDRLASYIEKVRFLDAQNRKLDADLKMLQGRFGKSTGSVKVMYEMEITTATNVVKQTGKDHGETEKEIRKLQDQLDELRKKFEEAQRGRAEDRLKIDDLLVTLSNLEAEINLLKRRIALLEEEVARLKKENFRLTSELQRVRIELDQETLLRIDNQNKVKTILEEIDFMKRGFETELKELQAQAARDTTSENREYFKNELANAMRDIRAEYDQIMNGNRNDMESWYQLRVQEINTQSNRQNAENNYQKEEVKRLRNQTSELRQKLSDLESRNLLLEKQIEDLNYQLEDDQRSYEAALNDKDAQIRKLREECQALMVELQMLLDTKQTLDGELKVYRQMLEG-----NSEGNGLRQLVEKVVRTSAINEEADTE--------------------------------TMRVVKGEHSSRTSYQRSAKGNVAIKETSPEGKFVILENTHRAKEEPLGDWKLKRKIDG-KREIVFTFPSDYILHPFQSVKIFARGQGIANPPEVLIFEGDETFGVGANVQTILYNNKGEERATHIQRQS 575          
BLAST of Intermediate filament b-like protein vs. TrEMBL
Match: tr|W0GAA8|W0GAA8_9PLAT (Intermediate filament b-like protein OS=Macrostomum lignano GN=if1 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.453e-100
Identity = 226/554 (40.79%), Postives = 335/554 (60.47%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAG--EKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2115
            V +M  GR +EK+D+Q+LNERFA+YIEK RFLEAQNK+L+NE+++LK    ++  ++K+ YE E+ QLR L+++SEK KA  E ++ SLE ++++L+   ++L++ N Q+   + TIDK  + ++ ++GE+  LRR   T   + +++++E+K LRD++ +LR D + E L H+  E+E QSL+E LEF KQIH++E+KELA +AYRD T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G          G  S                  T YQ       RT KGN+SI E    G  I+LEN G K E + G  + R +D     I FT+   V L  G  + I + A+G       ++E  ++SWGVG N+ T+L ++EG E+A H Q+ 
Sbjct:   72 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQNKQQMSLIKGEMSAK----------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATHTQKT 599          
BLAST of Intermediate filament b-like protein vs. TrEMBL
Match: tr|O97339|O97339_9ANNE (Cytoplasmic intermediate filament protein OS=Phascolion strombus PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.962e-88
Identity = 202/559 (36.14%), Postives = 315/559 (56.35%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-------NFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKG-REIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 2115
            +GV S+K  R +EK+D+QDLNERFA+YIEK RFLEAQN++LA E+++LK    ++ + +K +Y+ E+++ R L++++EK KA LE +  SLE +ID++R  L      N + +  +++Q + IS +  E+  L +      +D +++K+E+  L+D L K R D + E L H+  E+  Q+L+E LEF K +H+ E+KELA +AYRD T EN  +W+SEM  ALR+IQ  Y+ ++  ++ ELE+ Y +++QE RT  +R N+ET H KE   +++ Q+ +++SR+++LE +NA  E    ++R   EE +R  E + + L   L   Q EL   L ELQ L+D KLGLELEIAAY KLLE EE+RV       N    G+ + ++++S                                S          M+ + T         ++R+ KG I+I E    G  I +EN G + E L+G  I R VDG  +K  F  +   +L    +  + AKG     G  +IE +  SWG+G N+ T L +  G ++A H Q+ 
Sbjct:   80 TGVASIKTSRDREKKDMQDLNERFANYIEKVRFLEAQNRKLAQELDQLKQKWGKETAAVKAMYQAELDEARKLLDDAEKEKARLEIRTASLEEQIDEIRASLDDANAQNDEMRDRLERQNQQISEYVSEISVLTKRMQQLESDRDRDKKEIGRLQDSLNKARHDLDNETLGHIDAENRRQTLEEELEFLKNVHEQELKELAALAYRDTTVENREFWKSEMSSALREIQETYDEEMDAMRGELESYYNMKIQEFRTGASRQNMETVHAKETTKKMRDQLSALQSRLSELEARNASLEAENASLRQQLEEREREWEEERMELTNNLNKLQAELEAVLKELQDLIDTKLGLELEIAAYRKLLEGEENRVGLKQIVLNLVSGGHVSTTEYVSH----------------------------DERSGGQSQVVKGEMSAKTT---------YQRSAKGPITICEMQCCGKYICVENTGRRNEQLDGWKIARTVDGRTDK-RFCHTSWFHLCTRPQGKIWAKGSAQNPGPNDIESNQNSWGIGANITTKLVNLSGEDRATHVQKT 600          
BLAST of Intermediate filament b-like protein vs. TrEMBL
Match: tr|A0A1I8JG08|A0A1I8JG08_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.850e-87
Identity = 208/504 (41.27%), Postives = 304/504 (60.32%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKV--ESLEGMTIKRVVDGSENKISFTISGKVNLNAG 1965
            V +M  GR +EK+D+Q+LNERFA+YIEK RFLEAQNK+L+NE+++LK    ++  ++K+ YE E+ QLR L+++SEK KA  E ++ SLE ++++L+   ++L++ N Q+   + TIDK  + ++ ++GE+  LRR   T   + +++++E+K LRD++ +LR D + E L H+  E+E QSL+E LEF KQIH++E+KELA +AYRD T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G      G  S                      T YQ       RT KGN+SI E    G  I+LEN G K   E + G  + R +D     I FT+   V L  G
Sbjct:   98 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQMSLIKGEMSAK--------------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKASKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDG 571          
BLAST of Intermediate filament b-like protein vs. TrEMBL
Match: tr|A0A1I8GR35|A0A1I8GR35_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 4.536e-87
Identity = 208/504 (41.27%), Postives = 304/504 (60.32%), Query Frame = 1
Query:  469 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSGDGNATLSQFMSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKV--ESLEGMTIKRVVDGSENKISFTISGKVNLNAG 1965
            V +M  GR +EK+D+Q+LNERFA+YIEK RFLEAQNK+L+NE+++LK    ++  ++K+ YE E+ QLR L+++SEK KA  E ++ SLE ++++L+   ++L++ N Q+   + TIDK  + ++ ++GE+  LRR   T   + +++++E+K LRD++ +LR D + E L H+  E+E QSL+E LEF KQIH++E+KELA +AYRD T EN  +W++EM +AL +IQ EY+NK+  ++ E+E+ Y +++QE RT+ TRDN+E +H +EEN RIK Q+   R+RI +LE +NA+ E  L  +R   EE +R  E++   L+  L  TQ  L   L ELQ+L+D KL LELEIAAY KLLE EE+R+N        +SQ  S   S        A   G      G  S                      T YQ       RT KGN+SI E    G  I+LEN G K   E + G  + R +D     I FT+   V L  G
Sbjct:   98 VNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQ---VLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFAVEQQAMHQGQMSLIKGEMSAK--------------------TTYQ-------RTAKGNVSIQECSADGKYILLENTGKKASKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDG 571          
BLAST of Intermediate filament b-like protein vs. TrEMBL
Match: tr|A0A1I8JCN5|A0A1I8JCN5_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 3.372e-84
Identity = 165/367 (44.96%), Postives = 254/367 (69.21%), Query Frame = 1
Query:  463 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSXXXXXXXXXXXXXXXXXXXXVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVN 1563
            +G+ +M  GR +EK+D+++LNERFASYIEK RFLEAQN++L+ E++KL+    ++  K++ +YE E+ QLR L+ ++++ KA +E +V +LE +++++ + L     +++  + TIDK  + ++ ++GE+  LRR   +   +  +++ E+K LR D+ +LR D + E L H+  E+  QSL+E LEF + +HD+E+KEL+ +AYRD T EN  +W++EM +AL +IQ EY++KL  ++ E+E+ Y +++QE RTS TRDN+E TH KEEN RIKSQI   R+RI +LE +NA+ E  + ++R   EET RS EL+   LQ  L+     L   L ELQ+L+DAKL LELEI AY KLLE EE R+N
Sbjct:   95 AGLNNMLTGREKEKKDMRELNERFASYIEKVRFLEAQNRKLSEELQKLRDSWGKETEKVRSLYETELAQLRKLLEDADQYKATMEVRVTTLEDQLNEMEQLLEEANRVHANDRDTIDKLNQQMADYDGEISLLRRRVASFDDERARDQAEIKRLRQDVARLRGDLDTETLNHINAENSAQSLREELEFLRALHDSELKELSALAYRDTTSENREFWKNEMAQALHEIQREYDSKLDVVRSEMESQYSIKVQEARTSNTRDNMELTHLKEENRRIKSQIGDARNRIPELEARNAQLEREIEDLRRELEETMRSSELEKNQLQADLSSCNATLAEYLRELQTLMDAKLSLELEIHAYRKLLEGEEIRIN 461          

HSP 2 Score: 80.8777 bits (198), Expect = 2.165e-12
Identity = 41/112 (36.61%), Postives = 68/112 (60.71%), Query Frame = 1
Query: 1786 RTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEK-ISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVS 2118
            RT+KG+I+I E D  G  + LE  G K E L   T+ R VD  +  + +T      +++G K I + AKG+     +++E++D SWG+G+++VT L +++G EKA H Q+ +
Sbjct:  522 RTSKGSITIQECDSEGKFVTLEFTGKKKEDLSDWTLVRNVDNEKLIVKYTFPKDTVMDSGNKTIKIWAKGQRPADSKDLEMNDQSWGMGSHIVTMLSNADGEEKATHTQKTT 633          
The following BLAST results are available for this feature:
BLAST of Intermediate filament b-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
VIM7.496e-3030.75vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM1.043e-2930.75vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM1.043e-2930.75vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
LMNA6.574e-2625.52lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA6.717e-2625.52lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
back to top
BLAST of Intermediate filament b-like protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
ifa-17.446e-6731.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.024e-6631.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.024e-6631.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.076e-6631.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.076e-6631.12Intermediate filament protein ifa-1 [Source:UniPr... [more]
back to top
BLAST of Intermediate filament b-like protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
LamC6.672e-2726.50Lamin C [Source:FlyBase gene name;Acc:FBgn0010397][more]
LamC8.873e-2626.40Lamin C [Source:FlyBase gene name;Acc:FBgn0010397][more]
Lam3.082e-2523.99Lamin [Source:FlyBase gene name;Acc:FBgn0002525][more]
Lam3.082e-2523.99Lamin [Source:FlyBase gene name;Acc:FBgn0002525][more]
Lam3.082e-2523.99Lamin [Source:FlyBase gene name;Acc:FBgn0002525][more]
back to top
BLAST of Intermediate filament b-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
viml3.909e-2729.36vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-174... [more]
vim2.871e-2528.79vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3][more]
desma2.392e-2429.44desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
desma2.434e-2429.44desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
desmb1.902e-2128.38desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
back to top
BLAST of Intermediate filament b-like protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
vim1.216e-2729.03vimentin [Source:Xenbase;Acc:XB-GENE-493024][more]
lmnb13.667e-2226.02lamin B1 [Source:Xenbase;Acc:XB-GENE-489658][more]
lmnb13.744e-2226.02lamin B1 [Source:Xenbase;Acc:XB-GENE-489658][more]
des.11.099e-2129.46desmin, gene 1 [Source:Xenbase;Acc:XB-GENE-494931][more]
lmna1.663e-2127.97lamin A/C [Source:Xenbase;Acc:XB-GENE-920722][more]
back to top
BLAST of Intermediate filament b-like protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Vim2.165e-3030.28vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Vim2.835e-3030.28vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Gfap5.582e-2327.69glial fibrillary acidic protein [Source:MGI Symbol... [more]
Gfap9.999e-2327.69glial fibrillary acidic protein [Source:MGI Symbol... [more]
Des2.142e-2229.44desmin [Source:MGI Symbol;Acc:MGI:94885][more]
back to top
BLAST of Intermediate filament b-like protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01240|NF60_DORPE2.663e-7242.5560 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|Q01241|NF70_DORPE2.423e-7142.5570 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|P90901|IFA1_CAEEL1.397e-6531.12Intermediate filament protein ifa-1 OS=Caenorhabdi... [more]
sp|P90900|IFA4_CAEEL1.227e-5929.11Intermediate filament protein ifa-4 OS=Caenorhabdi... [more]
sp|O02365|IFA2_CAEEL4.210e-5629.68Intermediate filament protein ifa-2 OS=Caenorhabdi... [more]
back to top
BLAST of Intermediate filament b-like protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|W0GAA8|W0GAA8_9PLAT1.453e-10040.79Intermediate filament b-like protein OS=Macrostomu... [more]
tr|O97339|O97339_9ANNE1.962e-8836.14Cytoplasmic intermediate filament protein OS=Phasc... [more]
tr|A0A1I8JG08|A0A1I8JG08_9PLAT3.850e-8741.27Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A1I8GR35|A0A1I8GR35_9PLAT4.536e-8741.27Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A1I8JCN5|A0A1I8JCN5_9PLAT3.372e-8444.96Uncharacterized protein OS=Macrostomum lignano PE=... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..10
score: 0.559
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..10
score: 0.46
NoneNo IPR availableTMHMMTMhelixcoord: 10..29
NoneNo IPR availableCOILSCoilCoilcoord: 414..455
NoneNo IPR availableCOILSCoilCoilcoord: 153..194
NoneNo IPR availableCOILSCoilCoilcoord: 203..258
NoneNo IPR availableCOILSCoilCoilcoord: 287..314
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 428..508
e-value: 2.6E-13
score: 49.8
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 155..190
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 438..508
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
IPR001664Intermediate filament proteinSMARTSM01391Filament_2coord: 155..508
e-value: 1.4E-32
score: 124.3
IPR001664Intermediate filament proteinPFAMPF00038Filamentcoord: 155..508
e-value: 1.9E-51
score: 175.3
IPR016451Intermediate filament, ifa/ifbPIRSFPIRSF005546Ifb-2coord: 78..696
e-value: 2.0E-158
score: 526.2
IPR001322Lamin Tail DomainGENE3DG3DSA:2.60.40.1260coord: 569..692
e-value: 5.5E-20
score: 71.2
IPR001322Lamin Tail DomainSUPERFAMILYSSF74853Lamin A/C globular tail domaincoord: 562..692

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001664IF
IPR016451Intermed_filament_ifa/ifb
IPR001322Lamin_tail_dom
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000022Category 5 cell
PLANA:0004529integumental system
PLANA:0000034definitive epidermis
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000007Stage 7
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024865 ID=SMED30024865|Name=Intermediate filament b-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2214bp
GATCTTATAAATACAACATTAATTGTATAGTGAACTATGTTAGCCATTGA
AATGGAGACAAGTAAAAAAATCGCAGTCAAAACTACGAAACAAGAAGTAA
GTGGAAGTGGAAGCTCTGGTGGACTAAATGAACAACAAGCTTTTGGAAGT
GGTAGCTTTCGAACCGGGTCTGGAGGTGTACAGATAAGTGCTAGTGGAGC
AATTGGATCTAGCAGTTCAGGCGGAGTTAGTGGCACTGGCGGAGTTGGTA
GCATTGGTGGAGGCAGTGGTGCTGGTGGTGAAGGAACAGGAGCTAGCACA
GTTATCACTACAAGCAGATCTTATTATAAGCCTATCAGTCAACCTAGAAA
TAATTTAAAAGACTTACAAAAAACTTCTGGTATGAGTTACAGTGCACAAT
CAAACTCCCAGCAAGGTTTAAGTAATATTCCATTGATTAGGGGAGACAGT
GTTGCTCTACAATCTGGAGTAACTTCAATGAAAAAAGGACGAGCTCAAGA
GAAAAGAGATCTTCAGGATCTGAATGAAAGATTCGCTAGTTACATTGAAA
AAGCTCGATTTCTAGAGGCGCAAAATAAACAGCTAGCCAATGAGATTGAA
AAGTTAAAAGGTGGAACCGTCCAGGACAACTCAAAGATCAAAGAAATCTA
TGAAGTCGAAATCAATCAACTTCGAGCTTTGGTAAATGAATCGGAAAAAA
GCAAAGCTCCTTTAGAAGCTCAAGTTGATTCTCTTGAATACGAAATTGAT
GATTTGAGAAAACGATTAATGATGCTGGAAGACATCAACTCTCAGTACAA
ATCCACCATCGATAAGCAACGCAAAGACATTTCTGGATTTGAAGGGGAAT
TGGTGGAGCTAAGAAGATTCAAAGGCACCCAAGGTGCTGATGTAAATAAA
GAAAAGGAAGAAGTAAAAACACTAAGAGACGATTTGAAAAAATTGAGACA
AGATTATGAGAAAGAAGCTCTAGCTCATCTCACCCTTGAACATGAATTAC
AAAGCTTGAAAGAAGCATTAGAATTCGAGAAACAAATACATGACACAGAA
GTAAAAGAGCTGGCAACCGTTGCATATCGAGACCCAACGAAAGAAAATAT
GGTTTACTGGCAAAGCGAAATGGGACGCGCGTTACGAGACATTCAAACTG
AATATGAAAACAAGCTTACAGGAATCAAACAAGAATTGGAGGCTTCTTAT
GGTTTACAAATGCAGGAAATACGAACAAGTAAAACCAGAGACAATGTGGA
AACGACCCATTACAAAGAAGAGAACAGCCGAATAAAATCTCAAATCCAAA
GCATGAGATCGAGAATCGCTGATCTTGAGATGCAGAATGCTGAATACGAA
CACAACTTGAATAATATTCGTGCTAATTACGAAGAAACTCAAAGAAGTCT
TGAATTGCAGTTGTTGTATTTGCAAGAGCAATTGACAGGAACTCAACAAG
AATTGACAGTCGCTTTGACCGAACTCCAAAGCTTATTGGACGCGAAGTTG
GGACTGGAATTAGAAATCGCAGCCTATGCAAAACTATTAGAATTCGAAGA
GAGTCGTGTCAATTTCTCTGGTGATGGCAACGCTACTTTATCTCAATTTA
TGAGTTTCACATCAAGTAGCGGAGCTGGAGGTGCTGGAGGGGCTGGAGGT
GCTGGTGGTGCTGGAGGAGGAGGAGGAGGAAGCAGTGGGTTCGGATCAGG
AAGTAGAATTGGAGGGTCAAGTGGTTTCAGCGGAATGACAGAAAGAGAAA
CAACTGACTATCAGTCAAAACGAATGAAATTTAGACGAACGACAAAGGGA
AACATTTCCATTGCAGAGACTGACCTTATAGGTTCAACAATTATTCTGGA
AAATATTGGGACCAAAGTGGAATCACTCGAAGGTATGACTATTAAAAGAG
TAGTCGACGGCAGCGAAAATAAAATCTCATTTACCATTTCCGGAAAAGTT
AACTTAAATGCTGGTGAAAAGATTTCTCTTTGTGCCAAAGGGAAAATAAC
CGGCAAAGGACGAGAAATCGAAATTGATGATGCTTCATGGGGGGTTGGTA
ACAATGTCGTAACAACACTTTGTGATTCAGAAGGAGCGGAAAAGGCAGCT
CACTATCAAGAGGTTTCGGCCTAGAAACCTTGCTAAATATTAAACTGAAT
TTGTATGAACATAACAAAATTTTTAGTAATTTAATAAAAGTTTATTATTT
TATAAATCCAAAAA
back to top

protein sequence of SMED30024865-orf-1

>SMED30024865-orf-1 ID=SMED30024865-orf-1|Name=SMED30024865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=696bp
MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAFGSGSFRTGSGGVQI
SASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPI
SQPRNNLKDLQKTSGMSYSAQSNSQQGLSNIPLIRGDSVALQSGVTSMKK
GRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSK
IKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDI
NSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDL
KKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDP
TKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKT
RDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEE
TQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKL
LEFEESRVNFSGDGNATLSQFMSFTSSSGAGGAGGAGGAGGAGGGGGGSS
GFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGS
TIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCA
KGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEVSA*
back to top
Aliases
The feature 'Intermediate filament b-like protein' has the following synonyms
Synonym
vim-3