Transcription activator BRG1

Overview
NameTranscription activator BRG1
Smed IDSMED30024863
Length (bp)4604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription activator BRG1 (SMED30024863) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription activator BRG1 (SMED30024863) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription activator BRG1 (SMED30024863) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription activator BRG1 (SMED30024863) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024863

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024863SMESG000076666.1 SmedASXL_011257SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024863SMESG000076666.1 SmedASXL_011257SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30024863SMESG000076666.1 dd_Smed_v4_4141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024863SMESG000076666.1 dd_Smed_v4_4141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024863SMESG000076666.1 SMU15030580SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30024863SMESG000076666.1 SMU15030580SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024863SMESG000076666.1 dd_Smed_v4_4141_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 512/837 (61.17%), Postives = 640/837 (76.46%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEGSS-----------EDESSK------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR  + GSS           +DES K      PPA                     +P    L K+M+ +++ VI Y+D  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1531          

HSP 2 Score: 169.474 bits (428), Expect = 1.868e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 512/837 (61.17%), Postives = 640/837 (76.46%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEGSS-----------EDESSK------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR  + GSS           +DES K      PPA                     +P    L K+M+ +++ VI Y+D  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1531          

HSP 2 Score: 169.474 bits (428), Expect = 1.868e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 512/838 (61.10%), Postives = 640/838 (76.37%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEGSS-----------EDESSK------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR  + GSS           +DES K      PPA                     +P    L K+M+ +++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1532          

HSP 2 Score: 169.474 bits (428), Expect = 1.869e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 512/838 (61.10%), Postives = 640/838 (76.37%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEGSS-----------EDESSK------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR  + GSS           +DES K      PPA                     +P    L K+M+ +++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1532          

HSP 2 Score: 169.474 bits (428), Expect = 1.869e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 512/838 (61.10%), Postives = 640/838 (76.37%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEGSS-----------EDESSK------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR  + GSS           +DES K      PPA                     +P    L K+M+ +++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1532          

HSP 2 Score: 169.474 bits (428), Expect = 1.869e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 448/825 (54.30%), Postives = 589/825 (71.39%), Query Frame = 3
Query: 1620 KSHIQSYYALAHSHHEEIKEQASILINGT----LKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENI-----DYH--DSLDEEVQQVQDDYIG-KRNRKEVDY-SDALMEHEFLKAIXXXXXXXXXXNQX-XXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            K  +  YYA AH   E++ +Q + +  G     LK YQ+KGLEW+VSLYNNNLNGILADEMGLGKTIQTI L+TYLME K+ NGP+L+IVPLST+SNW  EF KW PSV  I+YKG+   R+ ++ Q++   FNVL+TTYEY+IK+K+ L K++WKYMIIDEGHR+KNH+CKLT +LN F+ A +RLLLTGTPLQNKLPELWALLNFLLP+IF S  TFEQWFNAPFA++GEKVELNQEET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+K EYVIKC+ SALQ+ +Y ++Q K  +L +    K     R   N ++ LRK+CNHP++FP   IE +   + K++            E++G DL R +GK ELLDRILPKLK   HR+LMF QMT +M++ E +L +R + YLRLDG+TK ++RGDLL  FN PNS+ F+FMLSTRAGGLGLNLQ+ADTVIIFDSDWNPHQD+QAQDRAHRIGQ+ EVRVLRLI  NS+EEKILAAAR+KLNVDEKVIQAG FDQ+ST  +RK  L+ ++  D  E++E+E PDDET+NQM+ARSEEEF I+Q MDI+R   E N+   K RLL   EIP++I     DY   +   EE ++V D     +R R+EVDY SD L + +F+K +   E  ED +NQ    + K++++   G  E++ S                   +          +L +++  +L+++++Y+++DG ++++ F  LP+RK+LPDYY +I KPMDF RI ++++  +Y  +++L  D+ +L  NAQTYN +GS I+  S  +  +W    +K 
Sbjct:  500 KKQMADYYATAHKIKEKVVKQHTTMGGGDPNLLLKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNNGPYLVIVPLSTLSNWQNEFAKWAPSVTTIIYKGTKDARRRVEGQIRKGAFNVLMTTYEYVIKEKALLGKIRWKYMIIDEGHRLKNHNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQ-KGLLLDA----KMSSGARSLMNTVVHLRKLCNHPFLFP--NIEDSCRAYWKVN------------EVNGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYKLNVDEKVIQAGKFDQRSTGAERKQMLEQIIQADGEEEEEEEVPDDETVNQMVARSEEEFNIFQSMDIDRRREEANQLHRKPRLLEEHEIPDDILKLSFDYEEMERAREEGREVVDQTPNQRRRRREVDYSSDLLSDEQFMKQV---EEVEDENNQAVAERKKQRKRKMAGLDENDDS---------------MDDVVLQHKKKKTDPELAEKINEMLDVILEYKNEDGELIADVFQTLPTRKELPDYYQVISKPMDFDRINKKIETGRYTVMEELNDDMNLLVNNAQTYNEEGSEIYVSSETIGKLWKEQYDKF 1287          

HSP 2 Score: 144.436 bits (363), Expect = 3.174e-34
Identity = 100/188 (53.19%), Postives = 136/188 (72.34%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            R+  L N  A + +   +  +IEL+ALRL+ LQ  +R E++  +K+DT+LETALN  AYRR K+Q+LREAR TEKLEKQ K EQE++RRQKH + + A++ H KEF+E+HRN   K  K  + +M Y  N ER+++K++ R E+ RM++LM EDEEGYR L+DEKKD RL YLLQQTDE++  L  LV
Sbjct:  193 RMKLLNNLPADIPDHMKLKAEIELRALRLVNLQTQVRSEVMACLKRDTTLETALNPYAYRRTKRQSLREARVTEKLEKQQKMEQERKRRQKHTDLMQAIIQHGKEFKEYHRNNLLKMAKSRKAVMTYHQNNERERKKDEIRNEKLRMQKLMQEDEEGYRALLDEKKDQRLVYLLQQTDEYVDSLCSLV 380          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: pqn-15 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:P91094])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 382/659 (57.97%), Postives = 488/659 (74.05%), Query Frame = 3
Query: 1620 KSHIQSYYALAHSHHEEIKEQASILINGT----LKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRT-ERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIER---ELAEKNKAVHKNRLLVADEIPENI----DYHDSLDEEVQQVQDDYI-----GKRNRKEVDYS-DALMEHEFLKAI 3542
            K +I+ YY  AH   EEIKEQ  ++  G     LK YQ+KGLEW+VSL+NNNLNGILADEMGLGKTIQTI  ITYLME KK +GPFL+IVPLST+ NW  EF+KW  +V  I YKG  + RK  +  +K+ KFNVLLTT+EY+I++K+ L K++WKYMIIDEGHR+KN HCKLT++LNT +    RLL+TGTPLQNKLPELWALLNFLLP+IF S +TFEQWFNAPFA++GEKVEL QEET+LIIRRLHKVLRPFLLRRLKKEVE++LP+K+E+V++C+MSALQ+ +Y ++Q      K +  D K  T  +   N ++ LRK+CNHP++F  VE E  ++ +               + I   DLYR SGK ELL RILPKL+   HRVLMF QMT +M ++E +L     +YLRLDG+TK ++RG LL  FN PNSE+F+FMLSTRAGGLGLNLQ+ADTVIIFDSDWNPHQD+QAQDRAHRIGQ+ EVRV RLI  NS+EEKILAAAR+KLNVDEKVIQAG FD +ST  +R+  L+ ++  +   ++++E P+DE IN +L+RSEEEFE++Q+MD ER   E A+K K     RL+  DEIP +I    D  D +++  ++ +  Y+      +R R+EVDYS D + + +FL+ +
Sbjct: 1168 KMNIEDYYTTAHGVREEIKEQHFMMGGGNPSLKLKPYQIKGLEWMVSLFNNNLNGILADEMGLGKTIQTIAFITYLMEIKKTSGPFLVIVPLSTVPNWQNEFDKWAANVHLIAYKGPKETRKVFEPIIKSGKFNVLLTTFEYVIREKALLGKLRWKYMIIDEGHRLKNQHCKLTEMLNTRFQCQRRLLITGTPLQNKLPELWALLNFLLPSIFSSCSTFEQWFNAPFATTGEKVELTQEETMLIIRRLHKVLRPFLLRRLKKEVESELPDKMEFVVRCDMSALQKVLYKHMQ------KGLLLDGKTNTGSKSLRNTMIHLRKLCNHPFLFENVE-ESCRNFWDA-------------RFISAVDLYRVSGKLELLSRILPKLQATGHRVLMFFQMTSMMTIVEDFLAGGTIQYLRLDGSTKPDERGALLDKFNAPNSEYFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKAEVRVFRLITANSVEEKILAAARYKLNVDEKVIQAGKFDNRSTGAERREILENIIKTENESEEDEEVPNDEDINDILSRSEEEFELFQKMDQERFENEQAQKAKP----RLVGEDEIPRDILRAADETDYIEKAKEEGRVPYLEVMPGSRRTRREVDYSADTMSDDKFLEKL 1802          

HSP 2 Score: 66.6254 bits (161), Expect = 1.883e-10
Identity = 44/104 (42.31%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  882 EKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            EKRR+  +  FL ++  HA+EF+EFH+       KV + +  Y  N  +   +E+ + E+ R+++L+ EDEEGYR ++DEKKD RL YLL+QTD++I  L  L+
Sbjct: 1016 EKRRKVTNFHFLQSLTKHAREFKEFHKRNMLNHTKVRKSMQQYITNENKRIAREEMKNEKNRIQKLIQEDEEGYRAMLDEKKDQRLVYLLEQTDDYIKSLCDLL 1119          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 434.876 bits (1117), Expect = 1.222e-131
Identity = 228/495 (46.06%), Postives = 316/495 (63.84%), Query Frame = 3
Query: 1698 NGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKE-LQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDK-DKKGRTERL-WSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAG 3173
            NG ++ YQ++GL WL SL +N +NGILADEMGLGKT+QTI +I Y+   K    P L+IVP ST+ NWA EF+KW PS+  ++  G    R + L+  +   KF+V  TTYE ++K K+ L K+ W+Y+IIDE HR+KN   KL++ +     +  RLL+TGTPLQN L ELWALLNFLLP+IF S + F+ WF      S + +  N +    +++RLHKVL+PFLLRR+K +VE  L  K E  +   +S +QR+ Y+ +     ++K +D  +  G+ E+    N+LM LRK  NHPY+F   E                 P  P   + H  D    SGK  +LD++L K K    RVL+F Q + ++DL+E +  +R ++Y RLDG+T  EDR + + A+N P+S+ FIFML+TRAGGLG+NL +AD VII+DSDWNP  DLQA DRAHRIGQ+ +VRV RLI  N+++E+I+  A  KL +D  VIQ G
Sbjct:  129 NGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELN-SENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWF------SNDAMSGNTD----LVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKV-----LMKDIDIINGAGKVEKARLMNILMHLRKCVNHPYLFDGAE-----------------PGPPFTTDQHLVD---NSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQG 587          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 392.889 bits (1008), Expect = 4.078e-112
Identity = 217/514 (42.22%), Postives = 309/514 (60.12%), Query Frame = 3
Query: 1695 INGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQ-----------------AQLKTS---KFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGM 3176
              G L  YQL+GL WL   ++N  + ILADEMGLGKT+Q++  +  LM+     GPFLI  PLST+ NW  E E+W P    + Y G    R  L+                 +++KT+   KF+VLLT+YE I  DK+ LS ++W  +++DE HR+KN+     + LN + I  YR+LLTGTPLQN L EL+ LLNFL    F  +  F   FN          E+++E+    I +LH +L P +LRRLK +V   +P K E +++ E+SA+Q+K Y NI ++     +V   K G T+    NVLM+L+K CNHPY+F + E+E  K       NG             G  L + SGKF LL ++L KLK   HRVL+F QMT ++D+ME   EY  ++Y R+DG+   + R D +  +N P ++ FIF+LSTRAGGLG+NL +ADTVII+DSDWNPH D+QA  RAHR+GQ+++V + R +   S+EEKI + A+ K+ ++  V++AG+
Sbjct:  598 TGGKLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIH-YRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFN----------EISKEDQ---IEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDALNV---KNGGTQMSLMNVLMELKKCCNHPYLFVKAELEAPKE-----KNGM----------YEGTALIKNSGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGL 1079          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 385.571 bits (989), Expect = 1.050e-109
Identity = 211/525 (40.19%), Postives = 311/525 (59.24%), Query Frame = 3
Query: 1698 NGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILY----------------------KGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMF--DQKSTDK 3200
             G L  YQL+G+ WL   ++N  + ILADEMGLGKT+Q++  +  LM+     GPFLI  PLST+ NW  E E W P    + Y                      +G PK+ K     L+  KF+VLLT+YE I  DK+ LS + W  +++DE HR+KN+     + L  + I  YR+LLTGTPLQN L EL+ LLNFL P+ F  + +F          + E  E+++E+    I +LH +L P +LRRLK +V   +P K E +++ E+SA+Q+K Y NI ++     +V   K G T+    N++M+L+K CNHPY+F +  +E  K     + NG             G+ L + +GKF LL ++L KLK   HRVL+F QMT ++D++E + +   +KY R+DG+   + R D +  +N P ++ F+F+LSTRAGGLG+NL +ADTVII+DSDWNPH D+QA  RAHR+GQ+++V + R +   S+EE+I + A+ K+ +   V++AG+   D KS  K
Sbjct:  613 GGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSK--IKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQ-YRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESF----------TAEFSEISKEDQ---IEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNV---KNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPK-----LKNGM----------YEGSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGLGAKDGKSMSK 1103          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075526)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 625/1167 (53.56%), Postives = 810/1167 (69.41%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKS---QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGL-------------EIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQ----QVQDDYI---GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            R+ EL    A +S    +   IEL+ALR+L  QR LR E +   ++DT+LETALN++ Y+R K+Q LREAR TEKLEKQ K E E++RRQKH EFL AVL H K+ REFHRN  ++  ++N+ +MN+ AN ER+++KEQER+E+ERMRRLMAEDEEGYRKLID+KKD RL +LL QTDE+I+ LT++VK HK                QMK          +F K      E   I    I   +  +V          +   T ++   +++P  K+L  W+  H  W     +E                    ED   K      ++D  D +     +D+  ++  Q+YY++AH+ HE++ EQASI++NGTLK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM+RKKV GP+LIIVPLST+ NW +EFEKW P+V  + YKGSP+ R+ LQ Q++ +KFNVLLTTYEY+IKDK+ L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT YIAPYRLLLTGTPLQNKLPELWALLNFLLP+IFKS +TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEY+IKC+MSALQR +Y ++QSK  +L   S          +   N ++QLRK+CNHP+MF  +E +Y  H       G+          + G DLYR SGKFELLDRILPKLK   HRVL+FCQMT  M ++E YL +R F YLRLDGTTK+EDRG+LL  FN   S+ F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+ +NS+EE+ILAAAR+KLN+DEKVIQAGMFDQKST  +R+ +L+ +L QD++E++E+    D+  IN M+ARSEEE EI++RMD ER+  ++     + RL+   E+P   D+    D+EV+    Q  +D I   G R RKEVDY+D+L E E+LKAIDD    ++ + + + K KR+++ N     D+ S                   L       +  +  K+M  +++ VI + ++DGR LSEPFMKLPSR+ LPDYY+IIK+P+D ++I QR++D KY  +++LE D   LC+NAQ YN + SLI+ DSI LQ V+  AR+++
Sbjct:  422 RMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKD--------------DQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV----------VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT-----GGH--------GVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELP---DWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDS-----------------LILKRRRRQNLDKRSKKQMHKIMSAVIKH-NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1530          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075525)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 625/1167 (53.56%), Postives = 810/1167 (69.41%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKS---QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGL-------------EIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQ----QVQDDYI---GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            R+ EL    A +S    +   IEL+ALR+L  QR LR E +   ++DT+LETALN++ Y+R K+Q LREAR TEKLEKQ K E E++RRQKH EFL AVL H K+ REFHRN  ++  ++N+ +MN+ AN ER+++KEQER+E+ERMRRLMAEDEEGYRKLID+KKD RL +LL QTDE+I+ LT++VK HK                QMK          +F K      E   I    I   +  +V          +   T ++   +++P  K+L  W+  H  W     +E                    ED   K      ++D  D +     +D+  ++  Q+YY++AH+ HE++ EQASI++NGTLK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM+RKKV GP+LIIVPLST+ NW +EFEKW P+V  + YKGSP+ R+ LQ Q++ +KFNVLLTTYEY+IKDK+ L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT YIAPYRLLLTGTPLQNKLPELWALLNFLLP+IFKS +TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEY+IKC+MSALQR +Y ++QSK  +L   S          +   N ++QLRK+CNHP+MF  +E +Y  H       G+          + G DLYR SGKFELLDRILPKLK   HRVL+FCQMT  M ++E YL +R F YLRLDGTTK+EDRG+LL  FN   S+ F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+ +NS+EE+ILAAAR+KLN+DEKVIQAGMFDQKST  +R+ +L+ +L QD++E++E+    D+  IN M+ARSEEE EI++RMD ER+  ++     + RL+   E+P   D+    D+EV+    Q  +D I   G R RKEVDY+D+L E E+LKAIDD    ++ + + + K KR+++ N     D+ S                   L       +  +  K+M  +++ VI + ++DGR LSEPFMKLPSR+ LPDYY+IIK+P+D ++I QR++D KY  +++LE D   LC+NAQ YN + SLI+ DSI LQ V+  AR+++
Sbjct:  422 RMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKD--------------DQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV----------VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT-----GGH--------GVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELP---DWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDS-----------------LILKRRRRQNLDKRSKKQMHKIMSAVIKH-NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1530          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075524)

HSP 1 Score: 1078.93 bits (2789), Expect = 0.000e+0
Identity = 625/1167 (53.56%), Postives = 810/1167 (69.41%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKS---QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGL-------------EIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQ----QVQDDYI---GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            R+ EL    A +S    +   IEL+ALR+L  QR LR E +   ++DT+LETALN++ Y+R K+Q LREAR TEKLEKQ K E E++RRQKH EFL AVL H K+ REFHRN  ++  ++N+ +MN+ AN ER+++KEQER+E+ERMRRLMAEDEEGYRKLID+KKD RL +LL QTDE+I+ LT++VK HK                QMK          +F K      E   I    I   +  +V          +   T ++   +++P  K+L  W+  H  W     +E                    ED   K      ++D  D +     +D+  ++  Q+YY++AH+ HE++ EQASI++NGTLK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM+RKKV GP+LIIVPLST+ NW +EFEKW P+V  + YKGSP+ R+ LQ Q++ +KFNVLLTTYEY+IKDK+ L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT YIAPYRLLLTGTPLQNKLPELWALLNFLLP+IFKS +TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEY+IKC+MSALQR +Y ++QSK  +L   S          +   N ++QLRK+CNHP+MF  +E +Y  H       G+          + G DLYR SGKFELLDRILPKLK   HRVL+FCQMT  M ++E YL +R F YLRLDGTTK+EDRG+LL  FN   S+ F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+ +NS+EE+ILAAAR+KLN+DEKVIQAGMFDQKST  +R+ +L+ +L QD++E++E+    D+  IN M+ARSEEE EI++RMD ER+  ++     + RL+   E+P   D+    D+EV+    Q  +D I   G R RKEVDY+D+L E E+LKAIDD    ++ + + + K KR+++ N     D+ S                   L       +  +  K+M  +++ VI + ++DGR LSEPFMKLPSR+ LPDYY+IIK+P+D ++I QR++D KY  +++LE D   LC+NAQ YN + SLI+ DSI LQ V+  AR+++
Sbjct:  418 RMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKD--------------DQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV----------VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT-----GGH--------GVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELP---DWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDS-----------------LILKRRRRQNLDKRSKKQMHKIMSAVIKH-NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1526          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075523)

HSP 1 Score: 1078.93 bits (2789), Expect = 0.000e+0
Identity = 625/1167 (53.56%), Postives = 810/1167 (69.41%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKS---QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGL-------------EIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQ----QVQDDYI---GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            R+ EL    A +S    +   IEL+ALR+L  QR LR E +   ++DT+LETALN++ Y+R K+Q LREAR TEKLEKQ K E E++RRQKH EFL AVL H K+ REFHRN  ++  ++N+ +MN+ AN ER+++KEQER+E+ERMRRLMAEDEEGYRKLID+KKD RL +LL QTDE+I+ LT++VK HK                QMK          +F K      E   I    I   +  +V          +   T ++   +++P  K+L  W+  H  W     +E                    ED   K      ++D  D +     +D+  ++  Q+YY++AH+ HE++ EQASI++NGTLK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM+RKKV GP+LIIVPLST+ NW +EFEKW P+V  + YKGSP+ R+ LQ Q++ +KFNVLLTTYEY+IKDK+ L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT YIAPYRLLLTGTPLQNKLPELWALLNFLLP+IFKS +TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEY+IKC+MSALQR +Y ++QSK  +L   S          +   N ++QLRK+CNHP+MF  +E +Y  H       G+          + G DLYR SGKFELLDRILPKLK   HRVL+FCQMT  M ++E YL +R F YLRLDGTTK+EDRG+LL  FN   S+ F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+ +NS+EE+ILAAAR+KLN+DEKVIQAGMFDQKST  +R+ +L+ +L QD++E++E+    D+  IN M+ARSEEE EI++RMD ER+  ++     + RL+   E+P   D+    D+EV+    Q  +D I   G R RKEVDY+D+L E E+LKAIDD    ++ + + + K KR+++ N     D+ S                   L       +  +  K+M  +++ VI + ++DGR LSEPFMKLPSR+ LPDYY+IIK+P+D ++I QR++D KY  +++LE D   LC+NAQ YN + SLI+ DSI LQ V+  AR+++
Sbjct:  418 RMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKD--------------DQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV----------VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT-----GGH--------GVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELP---DWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDS-----------------LILKRRRRQNLDKRSKKQMHKIMSAVIKH-NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1526          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0333580)

HSP 1 Score: 1078.93 bits (2789), Expect = 0.000e+0
Identity = 625/1167 (53.56%), Postives = 810/1167 (69.41%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKS---QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGL-------------EIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQ----QVQDDYI---GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            R+ EL    A +S    +   IEL+ALR+L  QR LR E +   ++DT+LETALN++ Y+R K+Q LREAR TEKLEKQ K E E++RRQKH EFL AVL H K+ REFHRN  ++  ++N+ +MN+ AN ER+++KEQER+E+ERMRRLMAEDEEGYRKLID+KKD RL +LL QTDE+I+ LT++VK HK                QMK          +F K      E   I    I   +  +V          +   T ++   +++P  K+L  W+  H  W     +E                    ED   K      ++D  D +     +D+  ++  Q+YY++AH+ HE++ EQASI++NGTLK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM+RKKV GP+LIIVPLST+ NW +EFEKW P+V  + YKGSP+ R+ LQ Q++ +KFNVLLTTYEY+IKDK+ L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT YIAPYRLLLTGTPLQNKLPELWALLNFLLP+IFKS +TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEY+IKC+MSALQR +Y ++QSK  +L   S          +   N ++QLRK+CNHP+MF  +E +Y  H       G+          + G DLYR SGKFELLDRILPKLK   HRVL+FCQMT  M ++E YL +R F YLRLDGTTK+EDRG+LL  FN   S+ F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+ +NS+EE+ILAAAR+KLN+DEKVIQAGMFDQKST  +R+ +L+ +L QD++E++E+    D+  IN M+ARSEEE EI++RMD ER+  ++     + RL+   E+P   D+    D+EV+    Q  +D I   G R RKEVDY+D+L E E+LKAIDD    ++ + + + K KR+++ N     D+ S                   L       +  +  K+M  +++ VI + ++DGR LSEPFMKLPSR+ LPDYY+IIK+P+D ++I QR++D KY  +++LE D   LC+NAQ YN + SLI+ DSI LQ V+  AR+++
Sbjct:  426 RMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKD--------------DQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV----------VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT-----GGH--------GVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELP---DWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDS-----------------LILKRRRRQNLDKRSKKQMHKIMSAVIKH-NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1534          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 496/823 (60.27%), Postives = 632/823 (76.79%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E + +Q++ LINGTLKQYQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +  K       +  N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G DLYRASGKFELLDRILPKLK   HRVL+FCQMT LM ++E Y  YR F YLRLDGTTKSEDR  LL  FN+  S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDAL E ++L+AI+D   EE  +  R ++ KR+R +++    ++  K       PPA                     +P   KL K+M  +++ VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  701 QSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDA---EVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAIEDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1490          

HSP 2 Score: 162.155 bits (409), Expect = 1.952e-39
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LR +++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ I  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  360 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 547          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 496/823 (60.27%), Postives = 632/823 (76.79%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E + +Q++ LINGTLKQYQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +  K       +  N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G DLYRASGKFELLDRILPKLK   HRVL+FCQMT LM ++E Y  YR F YLRLDGTTKSEDR  LL  FN+  S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDAL E ++L+AI+D   EE  +  R ++ KR+R +++    ++  K       PPA                     +P   KL K+M  +++ VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  701 QSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDA---EVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAIEDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1490          

HSP 2 Score: 161.77 bits (408), Expect = 2.410e-39
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LR +++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ I  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  360 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 547          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 496/823 (60.27%), Postives = 632/823 (76.79%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E + +Q++ LINGTLKQYQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +  K       +  N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G DLYRASGKFELLDRILPKLK   HRVL+FCQMT LM ++E Y  YR F YLRLDGTTKSEDR  LL  FN+  S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDAL E ++L+AI+D   EE  +  R ++ KR+R +++    ++  K       PPA                     +P   KL K+M  +++ VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  701 QSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDA---EVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAIEDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1490          

HSP 2 Score: 161.77 bits (408), Expect = 2.552e-39
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LR +++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ I  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  360 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 547          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 500/849 (58.89%), Postives = 636/849 (74.91%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDKKGRTE---------------------------RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E + +Q++ LINGTLKQYQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +KDKK   E                           +   N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G DLYRASGKFELLDRILPKLK   HRVL+FCQMT LM ++E Y  YR F YLRLDGTTKSEDR  LL  FN+  S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDAL E ++L+AI+D   EE  +  R ++ KR+R +++    ++  K       PPA                     +P   KL K+M  +++ VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  701 QSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKVNRETVCLLTFTPLCRFDVFNVFPPQGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDA---EVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAIEDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1516          

HSP 2 Score: 161.77 bits (408), Expect = 2.338e-39
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LR +++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ I  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  360 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 547          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: SMARCA4 (transcription activator BRG1-like [Source:NCBI gene;Acc:100535713])

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 432/647 (66.77%), Postives = 518/647 (80.06%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI 3542
            +QSYYA+AH+  E + +Q+S+LING LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF ++E  +++H  +    G           + G DLYRASGKFE+LDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN P S++FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQ NEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+ARSE+EF+ + RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R RKEVDYSD+L E ++LKAI
Sbjct:  681 LQSYYAVAHAVTERVDKQSSLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEETFSEH--LGFSGGI----------VQGLDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKTFNDPASQYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQLNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARSEDEFDQFMRMDLDRRREEARNPKRKPRLMEEDELPTWIMKDDA---EVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAI 1312          

HSP 2 Score: 166.777 bits (421), Expect = 8.004e-41
Identity = 116/188 (61.70%), Postives = 150/188 (79.79%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LET+L+ +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+  +K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  337 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETSLDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKMQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 524          

HSP 3 Score: 140.584 bits (353), Expect = 6.978e-33
Identity = 57/107 (53.27%), Postives = 96/107 (89.72%), Query Frame = 3
Query: 3735 LMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            L K+M+ +++ VI Y++ +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ ++YRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct: 1381 LTKKMKKIVDAVIKYKENNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHRYRSLNDLERDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSLRQKIE 1487          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 998.423 bits (2580), Expect = 0.000e+0
Identity = 501/829 (60.43%), Postives = 638/829 (76.96%), Query Frame = 3
Query: 1623 SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI---------XXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDK-DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            S +QSYYA+AH+  E++ +Q+++L+NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW  EF+KWGPSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H  +    G           + GADLYRASGKFELLDRILPKL+  +H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+ +SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +RK +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G RNRKEVDYSD+L E ++LKAI         ++   ++    ++          +EG  + +  +PPA                     +P   KL K+M+ +++ VI Y+D  +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct:  648 SGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH--LGFSGGI----------VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMDDEGKKQKKRGRPPA------------------EKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1443          

HSP 2 Score: 169.474 bits (428), Expect = 1.529e-41
Identity = 119/188 (63.30%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+EFHR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  336 RIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 523          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 998.423 bits (2580), Expect = 0.000e+0
Identity = 503/828 (60.75%), Postives = 639/828 (77.17%), Query Frame = 3
Query: 1623 SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXX--------XXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDK-DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            S +QSYYA+AH+  E++ +Q+++L+NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW  EF+KWGPSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H  +    G           + GADLYRASGKFELLDRILPKL+  +H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+ +SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +RK +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G RNRKEVDYSD+L E ++LKAI++           ++    +R R I    + +EG  + +  +PPA                          KL K+M+ +++ VI Y+D  +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct:  652 SGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH--LGFSGGI----------VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIRDDEGKKQKKRGRPPAEKLSPNPP------------------KLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1446          

HSP 2 Score: 169.474 bits (428), Expect = 1.469e-41
Identity = 119/188 (63.30%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+EFHR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  340 RIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 527          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 995.727 bits (2573), Expect = 0.000e+0
Identity = 503/839 (59.95%), Postives = 640/839 (76.28%), Query Frame = 3
Query: 1623 SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXN-------------------QXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDK-DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            S +QSYYA+AH+  E++ +Q+++L+NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW  EF+KWGPSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H  +    G           + GADLYRASGKFELLDRILPKL+  +H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+ +SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +RK +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G RNRKEVDYSD+L E ++LKAI++   EE  +                          + + + +EG  + +  +PPA                     +P   KL K+M+ +++ VI Y+D  +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct:  667 SGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH--LGFSGGI----------VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMPTTSTRGRERDDEGKKQKKRGRPPA------------------EKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1472          

HSP 2 Score: 169.859 bits (429), Expect = 1.187e-41
Identity = 119/188 (63.30%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+EFHR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  355 RIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 542          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 503/839 (59.95%), Postives = 640/839 (76.28%), Query Frame = 3
Query: 1623 SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXN-------------------QXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDK-DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            S +QSYYA+AH+  E++ +Q+++L+NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW  EF+KWGPSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H  +    G           + GADLYRASGKFELLDRILPKL+  +H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+ +SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +RK +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G RNRKEVDYSD+L E ++LKAI++   EE  +                          + + + +EG  + +  +PPA                     +P   KL K+M+ +++ VI Y+D  +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct:  714 SGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH--LGFSGGI----------VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMPTTSTRGRERDDEGKKQKKRGRPPA------------------EKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1519          

HSP 2 Score: 169.859 bits (429), Expect = 1.208e-41
Identity = 119/188 (63.30%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+EFHR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  370 RIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 557          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 508/860 (59.07%), Postives = 646/860 (75.12%), Query Frame = 3
Query: 1623 SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDK----------------------KGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXN-------------------QXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDK-DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            S +QSYYA+AH+  E++ +Q+++L+NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW  EF+KWGPSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L    +KDK                      KG T+ L  N +MQLRKICNHPYMF  +E  +++H  +    G           + GADLYRASGKFELLDRILPKL+  +H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+ +SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +RK +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G RNRKEVDYSD+L E ++LKAI++   EE  +                          + + + +EG  + +  +PPA                     +P   KL K+M+ +++ VI Y+D  +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct:  668 SGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKVLSIFCLCSIPVLLCVTPIQGKGGTKTLM-NTIMQLRKICNHPYMFQHIEESFSEH--LGFSGGI----------VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMPTTSTRGRERDDEGKKQKKRGRPPA------------------EKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1493          

HSP 2 Score: 169.859 bits (429), Expect = 1.229e-41
Identity = 119/188 (63.30%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+EFHR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  342 RIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 529          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:MGI Symbol;Acc:MGI:88192])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 504/841 (59.93%), Postives = 635/841 (75.51%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSE---------------DESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LK +   E     + +   + K+  +  +  SE               DE SK       PPA                     +P    L K+M+ +++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1535          

HSP 2 Score: 171.014 bits (432), Expect = 4.601e-42
Identity = 119/188 (63.30%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+FRE+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:MGI Symbol;Acc:MGI:88192])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 511/837 (61.05%), Postives = 639/837 (76.34%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEG----------SSEDESSK-------PPAXXXXXXXXXXXXXXSXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR    G            +DE SK       PPA                  +P+ P  +K MK++   ++ VI Y+D  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPA---------------EKLSPNPPNLTKKMKKI---VDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1531          

HSP 2 Score: 171.014 bits (432), Expect = 4.669e-42
Identity = 119/188 (63.30%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+FRE+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:MGI Symbol;Acc:MGI:88192])

HSP 1 Score: 988.023 bits (2553), Expect = 0.000e+0
Identity = 511/838 (60.98%), Postives = 639/838 (76.25%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEG----------SSEDESSK-------PPAXXXXXXXXXXXXXXSXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR    G            +DE SK       PPA                  +P+ P  +K MK++   ++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPA---------------EKLSPNPPNLTKKMKKI---VDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1532          

HSP 2 Score: 171.014 bits (432), Expect = 4.711e-42
Identity = 119/188 (63.30%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+FRE+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 500/829 (60.31%), Postives = 640/829 (77.20%), Query Frame = 3
Query: 1614 YNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            Y+    QSYY +AH+  E +++Q+++LINGTLK YQL+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV KI YKG+P +R+ L  QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSALQ+ +Y ++Q+K  +L    +  K       +  N +MQLRKICNHPYMF  +E  +A+H  +   NG           I+GA+LYRASGKFELLDRILPKL+   HRVL+FCQMT LM +ME Y  +R F YLRLDGTTKSEDR  LL  FN+P S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E  ++EDE PDDET+NQM+AR EEEF+++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R R++VDYSDAL E ++L+AI+D   EE  +  R +K KR+R +++   +++  K       PPA                     +P   KL K+M  +++ VI+Y+D  GR LSE F++LPSRKDLP+YY++I+KP+DF++I++R++++KYRS+ DLE D+ +LC NAQT+N++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  704 YSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEH--LGYSNGV----------INGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPVKEDVEKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKI 1499          

HSP 2 Score: 164.851 bits (416), Expect = 3.454e-40
Identity = 116/188 (61.70%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL +    L         +ELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+++ +  + ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  368 RIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLV 555          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 500/847 (59.03%), Postives = 641/847 (75.68%), Query Frame = 3
Query: 1614 YNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDK------------------DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            Y+    QSYY +AH+  E +++Q+++LINGTLK YQL+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV KI YKG+P +R+ L  QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSALQ+ +Y ++Q+K  +L    +  K       +  N +MQLRKICNHPYMF  +E  +A+H  +   NG           I+GA+LYRASGKFELLDRILPKL+   HRVL+FCQMT LM +ME Y  +R F YLRLDGTTKSEDR  LL  FN+P S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E  ++EDE PDDET+NQM+AR EEEF+++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R R++VDYSDAL E ++L+AI+D   EE  +  R +K KR+R +++   +++  K       PPA                     +P   KL K+M  +++ VI+Y+D+                   GR LSE F++LPSRKDLP+YY++I+KP+DF++I++R++++KYRS+ DLE D+ +LC NAQT+N++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  704 YSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEH--LGYSNGV----------INGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPVKEDVEKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPCNSQLEIEGNSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKI 1517          

HSP 2 Score: 164.851 bits (416), Expect = 3.287e-40
Identity = 116/188 (61.70%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL +    L         +ELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+++ +  + ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  368 RIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLV 555          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|P25439|BRM_DROME (ATP-dependent helicase brm OS=Drosophila melanogaster OX=7227 GN=brm PE=1 SV=2)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 625/1167 (53.56%), Postives = 810/1167 (69.41%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKS---QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGL-------------EIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQ----QVQDDYI---GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            R+ EL    A +S    +   IEL+ALR+L  QR LR E +   ++DT+LETALN++ Y+R K+Q LREAR TEKLEKQ K E E++RRQKH EFL AVL H K+ REFHRN  ++  ++N+ +MN+ AN ER+++KEQER+E+ERMRRLMAEDEEGYRKLID+KKD RL +LL QTDE+I+ LT++VK HK                QMK          +F K      E   I    I   +  +V          +   T ++   +++P  K+L  W+  H  W     +E                    ED   K      ++D  D +     +D+  ++  Q+YY++AH+ HE++ EQASI++NGTLK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM+RKKV GP+LIIVPLST+ NW +EFEKW P+V  + YKGSP+ R+ LQ Q++ +KFNVLLTTYEY+IKDK+ L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT YIAPYRLLLTGTPLQNKLPELWALLNFLLP+IFKS +TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEY+IKC+MSALQR +Y ++QSK  +L   S          +   N ++QLRK+CNHP+MF  +E +Y  H       G+          + G DLYR SGKFELLDRILPKLK   HRVL+FCQMT  M ++E YL +R F YLRLDGTTK+EDRG+LL  FN   S+ F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+ +NS+EE+ILAAAR+KLN+DEKVIQAGMFDQKST  +R+ +L+ +L QD++E++E+    D+  IN M+ARSEEE EI++RMD ER+  ++     + RL+   E+P   D+    D+EV+    Q  +D I   G R RKEVDY+D+L E E+LKAIDD    ++ + + + K KR+++ N     D+ S                   L       +  +  K+M  +++ VI + ++DGR LSEPFMKLPSR+ LPDYY+IIK+P+D ++I QR++D KY  +++LE D   LC+NAQ YN + SLI+ DSI LQ V+  AR+++
Sbjct:  422 RMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKD--------------DQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHV----------VEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT-----GGH--------GVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELP---DWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDS-----------------LILKRRRRQNLDKRSKKQMHKIMSAVIKH-NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRI 1530          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|A7Z019|SMCA4_BOVIN (Transcription activator BRG1 OS=Bos taurus OX=9913 GN=SMARCA4 PE=2 SV=1)

HSP 1 Score: 998.038 bits (2579), Expect = 0.000e+0
Identity = 511/838 (60.98%), Postives = 639/838 (76.25%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEGSS-----------EDESSK------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR  + G S           +DES K      PPA                     +P    L K+M+ +++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  720 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGPSTPTTSTRSRDKDDESKKQKKRGRPPA------------------EKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1524          

HSP 2 Score: 169.859 bits (429), Expect = 7.164e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  373 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 560          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|Q8K1P7|SMCA4_RAT (Transcription activator BRG1 OS=Rattus norvegicus OX=10116 GN=Smarca4 PE=1 SV=1)

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 511/837 (61.05%), Postives = 639/837 (76.34%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEG----------SSEDESSK-------PPAXXXXXXXXXXXXXXSXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR    G            +DE SK       PPA                  +P+ P  +K MK++   ++ VI Y+D  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPA---------------EKLSPNPPNLTKKMKKI---VDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1531          

HSP 2 Score: 170.629 bits (431), Expect = 3.437e-41
Identity = 119/188 (63.30%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+FRE+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|Q3TKT4|SMCA4_MOUSE (Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1)

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 511/837 (61.05%), Postives = 639/837 (76.34%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI--XXXXXXXXXXNQXXXXXXXXXXXXEG----------SSEDESSK-------PPAXXXXXXXXXXXXXXSXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            +QSYYA+AH+  E + +Q+++++NG LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNWA EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN+P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+AR EEEF+++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R+RKEVDYSD+L E ++LKAI     E  E+   Q+    KRKR    G            +DE SK       PPA                  +P+ P  +K MK++   ++ VI Y+D  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct:  728 LQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPA---------------EKLSPNPPNLTKKMKKI---VDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1531          

HSP 2 Score: 171.014 bits (432), Expect = 3.266e-41
Identity = 119/188 (63.30%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+FRE+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  381 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 568          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|Q6DIC0|SMCA2_MOUSE (Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1)

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 500/829 (60.31%), Postives = 640/829 (77.20%), Query Frame = 3
Query: 1614 YNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            Y+    QSYY +AH+  E +++Q+++LINGTLK YQL+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV KI YKG+P +R+ L  QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSALQ+ +Y ++Q+K  +L    +  K       +  N +MQLRKICNHPYMF  +E  +A+H  +   NG           I+GA+LYRASGKFELLDRILPKL+   HRVL+FCQMT LM +ME Y  +R F YLRLDGTTKSEDR  LL  FN+P S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E  ++EDE PDDET+NQM+AR EEEF+++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R R++VDYSDAL E ++L+AI+D   EE  +  R +K KR+R +++   +++  K       PPA                     +P   KL K+M  +++ VI+Y+D  GR LSE F++LPSRKDLP+YY++I+KP+DF++I++R++++KYRS+ DLE D+ +LC NAQT+N++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  698 YSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEH--LGYSNGV----------INGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPVKEDVEKAKKRRGRPPA------------------EKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKI 1493          

HSP 2 Score: 164.851 bits (416), Expect = 2.308e-39
Identity = 116/188 (61.70%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL +    L         +ELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+++ +  + ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  362 RIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLV 549          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: G4LZ02 (Helicase, putative OS=Schistosoma mansoni OX=6183 GN=Smp_158050 PE=4 SV=1)

HSP 1 Score: 1356.66 bits (3510), Expect = 0.000e+0
Identity = 776/1197 (64.83%), Postives = 942/1197 (78.70%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXX-----XXXXXXXXXSQMK---------YDSII-------AYL-----TQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLE-EESPQAKNLIAWIKEHEEWRLSLKDEQGL---EIFQEDEEMK---GYXXXXXXXXXXXXXXXXXXXXYNK------SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDKKGRTE-RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALL-XXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIP-----ENIDYHDSLDEEVQQVQDDYIG-KRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSS---EDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMME 4064
            QRI EL++ +   ++ Q ++L IEL+ALRLL  QR LRQ+I++ M++DTSLETALNV+AYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVL H K+FREFHRN NS+  K+N+ ++NY AN ERDKRKEQER++RERMRRLMAEDEEGYR LID KKD RLH+LL QTDEFI+ LTKLV++HK+EQ  +      ++ +  + S ++          D II       AY      T++F +   ELN + RD + GK+ S    LP D  IP++  TT+E +E + +P A  +  W++EH+ W +   D  G    ++ + DEE K    +D+  +DD++  VHVGTEDDEYNK      +  QSYY LAH+  EE+KEQASIL++G LK+YQL+GLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLMERK+VNGPFLIIVPLS MSNWAMEF++WGPSVKKILYKGSP+ R+ LQ Q+K SK NVLLTTYEYIIKDKS+LSKVKWKYMIIDEGHRMKNHHCKLTQ+LNT+Y APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA++GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVE+QLPEKVEYVIKCEMS LQR +YS++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MFP +E+  A+  F+ +HNGNPPP +P+P ++ G  LYR+SGKFELLDRILPKLK   HRVL+FCQMT LM +M+ Y +YR F+YLRLDGTT+SEDRG+LL  FN  + + FIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLI INS+EEKILAAARFKL+VD+KVIQAGMFDQKST  +R+ +L+ALL   +E++++EDE PDDETINQMLAR+EEEFEIYQR+D ER+ AE  +A  + RL+   E+P     ++I+ ++S       ++D+  G KR RKEVDYSDAL E +FLKAID+   EE  + QR ++  RK++     S   +D SS+  +      +   R  G      S  IS KL K++Q LL+IVI+Y+DKD RILSEPFMKLP+RK+LPDYY++IKKP+DF RIRQR+KD KYRS+D+LE+DI +LCKNAQTYNMDGSLIFEDS++LQSVW+NARE+LE +E
Sbjct:  179 QRIKELSSLTVSSTSEQRVSLLIELRALRLLNFQRQLRQDIVSAMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLSHGKDFREFHRNVNSRMVKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRFRERSERRKFAQESALQNAVVFYRKLADDIIKNGGQPPAYFATLPSTEKFPE---ELNQVNRDWLCGKMSSSSIQLP-DVRIPMYQTTTKEIVEGDAAPLASEVCTWLQEHQGWEILPTDTDGSVIHDLLEPDEEFKRKRKFDDDDDDDDNSMVHVGTEDDEYNKRGESGANAPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMERKRVNGPFLIIVPLSVMSNWAMEFDRWGPSVKKILYKGSPQARRLLQTQIKASKINVLLTTYEYIIKDKSALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCEMSDLQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLMNTIMQLRKICNHPFMFPHIEMAIAEQNFLNVHNGNPPPTLPVPTQVEGKILYRSSGKFELLDRILPKLKCCGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRSEDRGELLVKFNDTSEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARNEEEFEIYQRLDAERQFAESQQAKREPRLMEFSELPKWIVRDDIEVNNSESLTYLSLEDNVFGMKRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQKRAARKKRKRLDDSSFLDDGSSETGSVIMAAPQAAKRRRGRPPHGSSTGISPKLAKKLQRLLDIVIEYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPVDFNRIRQRVKDGKYRSVDELEADILLLCKNAQTYNMDGSLIFEDSVVLQSVWTNARERLEEIE 1371          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A3Q0KR71 (Helicase, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1355.89 bits (3508), Expect = 0.000e+0
Identity = 779/1201 (64.86%), Postives = 943/1201 (78.52%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXX-----XXXXXXXXXSQMK---------YDSII-------AYL-----TQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLE-EESPQAKNLIAWIKEHEEWRLSLKDEQGL---EIFQEDEEMK---GYXXXXXXXXXXXXXXXXXXXXYNK------SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDKKGRTE-RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALL-XXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIG-KRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXX--------EGSSEDES----SKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMME 4064
            QRI EL++ +   ++ Q ++L IEL+ALRLL  QR LRQ+I++ M++DTSLETALNV+AYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVL H K+FREFHRN NS+  K+N+ ++NY AN ERDKRKEQER++RERMRRLMAEDEEGYR LID KKD RLH+LL QTDEFI+ LTKLV++HK+EQ  +      ++ +  + S ++          D II       AY      T++F +   ELN + RD + GK+ S    LP D  IP++  TT+E +E + +P A  +  W++EH+ W +   D  G    ++ + DEE K    +D+  +DD++  VHVGTEDDEYNK      +  QSYY LAH+  EE+KEQASIL++G LK+YQL+GLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLMERK+VNGPFLIIVPLS MSNWAMEF++WGPSVKKILYKGSP+ R+ LQ Q+K SK NVLLTTYEYIIKDKS+LSKVKWKYMIIDEGHRMKNHHCKLTQ+LNT+Y APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA++GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVE+QLPEKVEYVIKCEMS LQR +YS++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MFP +E+  A+  F+ +HNGNPPP +P+P ++ G  LYR+SGKFELLDRILPKLK   HRVL+FCQMT LM +M+ Y +YR F+YLRLDGTT+SEDRG+LL  FN  + + FIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLI INS+EEKILAAARFKL+VD+KVIQAGMFDQKST  +R+ +L+ALL   +E++++EDE PDDETINQMLAR+EEEFEIYQR+D ER+ AE  +A  + RL+   E+P+ I   D   E    ++D+  G KR RKEVDYSDAL E +FLKAID+   EE  + QR ++  RK++          +GSSE  S    +   A     +   G   GS S + +  +S KL K++Q LL+IVI+Y+DKD RILSEPFMKLP+RK+LPDYY++IKKP+DF RIRQR+KD KYRS+D+LE+DI +LCKNAQTYNMDGSLIFEDS++LQSVW+NARE+LE +E
Sbjct:  179 QRIKELSSLTVSSTSEQRVSLLIELRALRLLNFQRQLRQDIVSAMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLSHGKDFREFHRNVNSRMVKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRFRERSERRKFAQESALQNAVVFYRKLADDIIKNGGQPPAYFATLPSTEKFPE---ELNQVNRDWLCGKMSSSSIQLP-DVRIPMYQTTTKEIVEGDAAPLASEVCTWLQEHQGWEILPTDTDGSVIHDLLEPDEEFKRKRKFDDDDDDDDNSMVHVGTEDDEYNKRGESGANAPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMERKRVNGPFLIIVPLSVMSNWAMEFDRWGPSVKKILYKGSPQARRLLQTQIKASKINVLLTTYEYIIKDKSALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCEMSDLQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLMNTIMQLRKICNHPFMFPHIEMAIAEQNFLNVHNGNPPPTLPVPTQVEGKILYRSSGKFELLDRILPKLKCCGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRSEDRGELLVKFNDTSEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARNEEEFEIYQRLDAERQFAESQQAKREPRLMEFSELPKWIVRDDIELERSLSLEDNVFGMKRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQKRAARKKRKRLDDSSFLDDGSSETGSVIMAAPQAAKRRRGRPPHGSSTGSTSRSSNQSVSPKLAKKLQRLLDIVIEYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPVDFNRIRQRVKDGKYRSVDELEADILLLCKNAQTYNMDGSLIFEDSVVLQSVWTNARERLEEIE 1375          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A4E0RV45 (Global transcription activator snf2l2 OS=Fasciola hepatica OX=6192 GN=D915_007926 PE=4 SV=1)

HSP 1 Score: 1349.73 bits (3492), Expect = 0.000e+0
Identity = 771/1202 (64.14%), Postives = 930/1202 (77.37%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSI---------------------IAYL-----TQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLE-EESPQAKNLIAWIKEHEEWRLSLKDEQGL---EIFQEDEEMK-----GYXXXXXXXXXXXXXXXXXXXXYNK------SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDKKGRTE-RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALL-XXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIG-KRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXX--------XXXXXEGSSEDES---SKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMME 4064
            QRI EL++ + F +  Q ++L +EL++LRLL  QR LRQ+I+  M++DTSLETALNV+AYRRPKKQTL+EARFTEKLEKQMKHEQEKRRRQKHQEFLNAVL H K+FREFHRN NS+  K+N+ ++NY AN ERDKRKEQER++RERMRRLMAEDEEGYR LIDEKKD RLH+LL QTDEFI  LTKLV++HK+EQ  ++ +ER E+R Q +  ++                       YL     T++F +   E N + RD + GK  +   LLPQ   IP++  TT+E  E + +P A  + +W++EH  W +   D  G    ++   DEE+K       D+  +DD+   VHVGTEDDEYNK      +  QSYY LAH+  EE+KEQ SIL++G LK+YQL+GLEWLVSLYNNNLNGILADEMGLGKTIQTI LIT+LME+K+VNGPFLIIVPLS MSNWA+EF++W PSVKKILYKGSP+ R+ LQ QLK SK NVLLTTYEYIIKDKS+LSKVKWKYMIIDEGHRMKNHHCKLTQ+LNT+YIAPYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPF+++GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVE+QLPEKVEYVIKCEMSALQR +YS++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MF  +E+  A+  FM  H GNPPP VP+P ++ G  LYRASGKFELLDRILPKLK   HRVL+FCQMT LM +M+ Y +YR F+YLRLDGTT+SEDRGDLL  FN  + + FIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLI INS+EEKILAAARFKL+VD+KVIQAGMFDQKST  +R+ +L+ALL   +E++++EDE PDDETINQMLARSEEEFEIYQRMD+ER+  E  +A  + RL+   E+P+ I   +   E   +V++   G KR RKEVDYSDAL E +FLKAID+   EE  + QR ++  R           +++ SSE  S   + PP      +RGR       +      +S K  K+MQ LL+I+I+Y+D D R+LSEPFMKLP+RK+LPDYY++IKKPMDF RI+QR++D KY SID+LE+DI +LCKNAQTYNMDGSLIFEDS++LQSVW+NARE+LE +E
Sbjct:  302 QRIKELSSLTMFSTPEQRISLMLELRSLRLLNFQRQLRQDIVASMRRDTSLETALNVKAYRRPKKQTLKEARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLTHGKDFREFHRNVNSRMVKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDEKKDQRLHHLLTQTDEFIGNLTKLVREHKREQTKQRVRERSERRRQAQETALQNAVNYYRRLADEAVRSGRPPPTYLATLPPTEKFPE---EFNQVNRDWLNGKAPAANILLPQ-VRIPMYQATTKEICEGDAAPMASEVYSWLQEHPGWEVLPTDVDGSTVQDLLDTDEELKRKRRFDDDDDDDDDDSAMVHVGTEDDEYNKRGESSANAPQSYYTLAHAVREEVKEQPSILVHGKLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITHLMEKKRVNGPFLIIVPLSVMSNWALEFDRWAPSVKKILYKGSPQARRILQGQLKASKINVLLTTYEYIIKDKSALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYIAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFSATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCEMSALQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLLNTIMQLRKICNHPFMFSHIELAIAEQNFMATHGGNPPPGVPLPTQVEGKVLYRASGKFELLDRILPKLKACGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRSEDRGDLLVKFNDTSEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARSEEEFEIYQRMDMERQFTESQQARQEQRLMEYSELPKWIIRDEVELERSLRVEESVFGMKRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQKRATRKKRKRIDDSSFMDDASSEAGSISMTAPPT--AKRRRGRPPHSSGSTGGRGGALSPKQTKKMQRLLDIIIEYKDNDQRVLSEPFMKLPTRKELPDYYEVIKKPMDFHRIKQRVRDGKYHSIDELEADIMLLCKNAQTYNMDGSLIFEDSVVLQSVWTNARERLEELE 1497          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A4Z2D631 (Putative global transcription activator SNF2L2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004441 PE=4 SV=1)

HSP 1 Score: 1305.81 bits (3378), Expect = 0.000e+0
Identity = 758/1177 (64.40%), Postives = 918/1177 (77.99%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMK--------------YDSII-------AYLTQ--RFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEES-PQAKNLIAWIKEHEEWRLSLKDEQGL---EIFQEDEEMKG----YXXXXXXXXXXXXXXXXXXXXYNK------SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDKKGRTE-RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALL-XXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIG-KRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXX--------XXXXXEGSSEDES----SKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLI 3998
            QRI EL++ +   S+ Q ++L IEL+ALRLL  QR LRQ+I++ M++DTSLETALNV+AYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLN++L H K+FREFHRN NS+  K+N+ ++NY AN ERDKRKEQER++RERMRRLMAEDEEGYR LID KKD RLH+LL QTDEFI+ LTKLV++HK+EQ  ++ +ER E+R   +               D +I       AY       +K   ELN + RD + GK+ S + L   +  IP++  TT+E +E +S P A  +  W++EH+ W +   D  G    ++ + DEE K      D+  +DD++  VHVGTEDDEYNK      +  QSYY LAH+  EE+KEQASIL++G LK+YQL+GLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLMERK+VNGPFLIIVPLS MSNW+MEF++WGPSVKKILYKGSP+ R+ LQ Q+K SK NVLLTTYEYIIKDKS+LSKVKWKYMIIDEGHRMKNHHCKLTQ+LNT+Y APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA++GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVE+QLPEKVEYVIKCEMS LQR +YS++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MFP +E+  A+  F+ +HNGNPPP++P+P ++ G  LYR+SGKFELLDRILPKLK   HRVL+FCQMT LM +M+ Y +YR F+YLRLDGTT+SEDRG+LL  FN  + + FIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLI INS+EEKILAAARFKL+VD+KVIQAGMFDQKST  +R+ +L+ALL   +E++++EDE PDDETINQMLAR+EEEFEIYQR+D ER+ +E  +A  + RL+   E+P+ I   D   E    ++D+  G KR RKEVDYSDAL E +FLKAID+   EE  + QR ++  R           +++GSSE  S    +   A     +   G   GS S +    +S KL K++Q LL+IVI+Y+DKD RILSEPFMKLP+RK+LPDYY++IKKP+DF RIRQR+KD KYRS+D+LE+DI +LCKNAQTYNMDGSL+
Sbjct:  180 QRIKELSSLTVSTSSEQRISLLIELRALRLLNFQRQLRQDIVSAMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNSILSHGKDFREFHRNVNSRMIKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRFRERSERRKFAQESALQNAVVFYRKLADDVIKNGGQPPAYFATLPSTDKFPEELNQVNRDWLCGKMSSNIQL--PEVRIPMYQTTTKEIVEGDSAPLASEVYTWLQEHQGWEILPTDTDGSVIHDLLEPDEEFKRKRKFDDDDDDDDDNSMVHVGTEDDEYNKRGESGANAPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMERKRVNGPFLIIVPLSVMSNWSMEFDRWGPSVKKILYKGSPQARRLLQTQIKASKINVLLTTYEYIIKDKSALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCEMSDLQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLMNTIMQLRKICNHPFMFPHIEMAIAEQNFLNIHNGNPPPSLPVPTQVEGKILYRSSGKFELLDRILPKLKCCGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRSEDRGELLVKFNDTSEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARNEEEFEIYQRLDAERQFSESQQAKREPRLMEFSELPKWIVRDDIELERSLSLEDNVFGMKRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQKRAARKKRKRLDDSSFMDDGSSETGSVIMAAPQAAKRRRGRPPHGSSTGSTSRSSIQSVSPKLAKKLQRLLDIVIEYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPVDFNRIRQRVKDGKYRSLDELEADILLLCKNAQTYNMDGSLV 1354          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A0X3P6Q3 (Putative global transcription activator SNF2L2 OS=Schistocephalus solidus OX=70667 GN=SMCA2 PE=4 SV=1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 737/1195 (61.67%), Postives = 907/1195 (75.90%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQM----------KYDSIIAYLTQRFNKS------------QNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLE-EESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYXXXXXXX---XXXXXXXXXXXXXYNK------SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK-SVDKDKKGR-TERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXX-XXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDD---YIGKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXX--------EGSSEDESSK---PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMME 4064
            QRI +++  S F +  Q + L+IEL++LRLL  QR LRQ++++ M++DTSLETALN++AYRRPKKQ LREAR+TEKLE+QMKHEQ+KRRRQKHQEF+NAVL H ++FREFHR+ N+K  KVN+ ++N     +RD+R+EQ+R++RERMRRLM ED+ GYR LIDEKK+ RLHYLL QTDEFI  L+KLVKDHK+EQ   +  E  E+R +           +Y ++ + L  +   S             +EL   +RD+  GK+       P    IP+ N +TRE +  E +P A  L +W++EH  W ++   E G    +  E++ G  +  E++    ++ V  GTEDDEY++      +  QSYY LAH+  EE+KEQASILING LK+YQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLME+K+VNGP+LIIVPLS MSNWAMEF+KW PSVKKILYKGSP+ R+ LQ Q+K SKFNVLLTTYEYIIKDK+SLSKVKWKYMIIDEGHRMKNHHCKLTQ+LNT+Y APYRLLLTGTPLQNKLPELWALLNFLLP IF S NTFEQWFNAPFA++GEKVELN EETLLIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKCEMSALQR +YS +QSK  IL    ++DKKG+   R   N +MQLRKICNHP+MF  +E   A++    +      P +P P +  G  LYR+SGKFEL+DRILPKLK   HRVL+FCQMT LM +M+ Y +YR F+YLRLDGTTKS+DRG+LL  FN    ++FIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLI INS+EEKILAAAR+KLNVDEKVIQAGMFDQKST  +R+ +L+ALL+QDE  D+++     DETINQMLAR+E+EF++YQ+MD ER   E  +   ++RL+  DE+P+ I   +   E    +++D   +  KR RKEVDYSDAL E +FLKAID+   EE  + QR +K  ++++ +        + SSE  S     PPA     +R    P GS SS  S   SSKL+KRM+ LL IVI+Y+DKD R+LSEPFMKLP+RK+LPDYY++IKKP+DF RIRQR++D KYRSIDDLE+D+ +LCKNAQTYNMDGSLIFEDS++LQ+VW NARE+LE +E
Sbjct:  293 QRIKDISGLSLFSTPEQRVQLQIELRSLRLLNFQRQLRQDVVSAMRRDTSLETALNIKAYRRPKKQNLREARYTEKLERQMKHEQDKRRRQKHQEFINAVLSHGRDFREFHRSVNNKLTKVNKAVLN----ADRDRRREQQRIDRERMRRLMEEDDTGYRNLIDEKKNKRLHYLLTQTDEFIDNLSKLVKDHKREQNKMRVTELHERRKEAQECALQHACARYQAMASELIAKGAPSPSFLATLPSDSFSDELMQASRDLANGKMPMLSGPWPA-VRIPVTNGSTRETITGEAAPLASELYSWLQEHPGWEIAPTYETGAIAPELLEDLVGAPKKAEEEDDDTENPVVRGTEDDEYSRRGESETNAPQSYYTLAHAIREEVKEQASILINGKLKEYQMRGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPYLIIVPLSVMSNWAMEFDKWSPSVKKILYKGSPQARRMLQNQIKASKFNVLLTTYEYIIKDKASLSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFDSCNTFEQWFNAPFAATGEKVELNHEETLLIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCEMSALQRVLYSYMQSKGVILTDGSERDKKGKGGTRTLMNTIMQLRKICNHPFMFSHIESAIAEYTQPAI------PGMPPPTQCEGKALYRSSGKFELIDRILPKLKATGHRVLIFCQMTSLMTIMQDYFDYRGFRYLRLDGTTKSDDRGELLVKFNDAKKDYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARYKLNVDEKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEDENEAPDDETINQMLARTEDEFDLYQQMDAERRFTESQQPKRESRLMERDELPDWIIRDEEEVERSLSLEEDNALFGVKRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQKKAAKRKRKHNDDYSLIDDASSEAGSGSLVVPPA---LKRRRGRPPQGSGSSNRSNAPSSKLLKRMKRLLEIVIEYKDKDLRVLSEPFMKLPTRKELPDYYEVIKKPVDFNRIRQRVRDGKYRSIDDLEADVILLCKNAQTYNMDGSLIFEDSVVLQTVWKNARERLEDIE 1473          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:103043671])

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 495/823 (60.15%), Postives = 632/823 (76.79%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E++++Q+++LINGTLK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +  K       +  N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G+DLYRASGKFELLDRILPKL    HRVL+FCQMT LM +ME Y  YR F YLRLDGTTKSEDR  LL  FN+  S +FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDA+ E ++L+AI+D   EE  +  R +K KR+R +++G   +E  K       PPA                     +P   +L K+M  ++  VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  711 QSYYGVAHAVIEKVEKQSTLLINGTLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGSDLYRASGKFELLDRILPKLHTTNHRVLLFCQMTTLMTIMEDYFAYRNFLYLRLDGTTKSEDRAALLKTFNEEGSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRRDVDYSDAMTEKQWLRAIEDGNLEEMEEEIRLKKRKRRRHVDKGPRREEGEKAKKKRGRPPA------------------EKLSPNPPRLTKQMAAIIETVINYRDGSGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSLGDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1500          

HSP 2 Score: 164.466 bits (415), Expect = 3.375e-40
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LRQ+++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ +  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  370 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTTLV 557          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:103043671])

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 495/823 (60.15%), Postives = 632/823 (76.79%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E++++Q+++LINGTLK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +  K       +  N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G+DLYRASGKFELLDRILPKL    HRVL+FCQMT LM +ME Y  YR F YLRLDGTTKSEDR  LL  FN+  S +FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDA+ E ++L+AI+D   EE  +  R +K KR+R +++G   +E  K       PPA                     +P   +L K+M  ++  VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  711 QSYYGVAHAVIEKVEKQSTLLINGTLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGSDLYRASGKFELLDRILPKLHTTNHRVLLFCQMTTLMTIMEDYFAYRNFLYLRLDGTTKSEDRAALLKTFNEEGSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRRDVDYSDAMTEKQWLRAIEDGNLEEMEEEIRLKKRKRRRHVDKGPRREEGEKAKKKRGRPPA------------------EKLSPNPPRLTKQMAAIIETVINYRDGSGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSLGDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1500          

HSP 2 Score: 164.466 bits (415), Expect = 3.563e-40
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LRQ+++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ +  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  370 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTTLV 557          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:103043671])

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 495/823 (60.15%), Postives = 632/823 (76.79%), Query Frame = 3
Query: 1632 QSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            QSYY +AH+  E++++Q+++LINGTLK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  E +KW PS+ KI YKG+P +R+ L  QL++ KFNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q K  +L    +  K       +  N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G+DLYRASGKFELLDRILPKL    HRVL+FCQMT LM +ME Y  YR F YLRLDGTTKSEDR  LL  FN+  S +FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E   +EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+   EV+++  +         G R+R++VDYSDA+ E ++L+AI+D   EE  +  R +K KR+R +++G   +E  K       PPA                     +P   +L K+M  ++  VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS+ DLE D+ +LC NAQTYN++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  626 QSYYGVAHAVIEKVEKQSTLLINGTLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGFPNGI----------ISGSDLYRASGKFELLDRILPKLHTTNHRVLLFCQMTTLMTIMEDYFAYRNFLYLRLDGTTKSEDRAALLKTFNEEGSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWIIKDDA---EVERLTCEEEEEKMFGRGSRHRRDVDYSDAMTEKQWLRAIEDGNLEEMEEEIRLKKRKRRRHVDKGPRREEGEKAKKKRGRPPA------------------EKLSPNPPRLTKQMAAIIETVINYRDGSGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSLGDLEKDVMLLCHNAQTYNLEGSQIYEDSIVLQSVFKSARQKI 1415          

HSP 2 Score: 164.081 bits (414), Expect = 4.392e-40
Identity = 115/188 (61.17%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L         +ELKALRLL  QR LRQ+++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+ + K  K+++ +  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  316 RIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTTLV 503          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: ENSAMXT00000045183.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:20055319:20094907:-1 gene:ENSAMXG00000011238.2 transcript:ENSAMXT00000045183.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 486/820 (59.27%), Postives = 612/820 (74.63%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIX-------------XXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLI 3998
            +QSYYA+AH+  E + +Q+S+LING LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF ++E  +++H+     +G           + GADLYRASGKFE+LDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN P S++FIF+LSTRAGGLGLNLQSADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+ARSEEEF+ + RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R RKEVDYSD+L E ++LKAI+                  +   ++             G  +DE SK       PPA                           L K+M+ +++ +I Y++  +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ ++YRS++DLE D+ +LC+NAQT+N++GSL+
Sbjct:  731 LQSYYAVAHAVTERVDKQSSLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEHLGF---SGG---------IVQGADLYRASGKFEVLDRILPKLRATNHKVLLFCQMTTLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKTFNDPESQYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARSEEEFDHFMRMDLDRRREEARNPKRKPRLMEEDELPTWIMKDDA---EVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRHKKTTRKRKRDRDLDAGPSTSGTRSGRDKDEESKRQKKRGRPPAEKLTPNPPA------------------LTKKMKKIVDAMIKYKESSNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHRYRSLNDLERDVMLLCQNAQTFNLEGSLV 1517          

HSP 2 Score: 165.236 bits (417), Expect = 1.927e-40
Identity = 116/188 (61.70%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M+++T+LETAL+ +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  389 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRETALETALDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 576          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4a [Source:ZFIN;Acc:ZDB-GENE-030605-1])

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 486/822 (59.12%), Postives = 623/822 (75.79%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAIXXXX-----XXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            +QSYY++AH+  E + +Q+++++NGTLKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW +EF+KW PSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEK+++ I C +       Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF  +E  +++H+      G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN P S +F+F+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+ARSEEEF+ + RMD++R   E      + RL+  DE+P  I   D+   EV+++  +         G R RKEVDYSD+L E ++LKAI++        E        ++ + +     G S   SS   +        + +  G   +   +P  S L K+M+ +++ VI Y+D +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct:  661 LQSYYSVAHAVTETVDKQSTLMVNGTLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRINGPFLIIVPLSTLSNWVLEFDKWAPSVVKVSYKGSPAARRAFLPILRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKIQFSI-CLL-------YRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGF---TGG---------IVQGPDLYRASGKFELLDRILPKLRATNHKVLLFCQMTTLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKNFNDPASSYFVFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARSEEEFDHFMRMDLDRRREEARNPKRRPRLMEEDELPTWIMKDDA---EVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLDEIEEEVRHKKTTRKRKRDRDLDLPGPSTPSSSGGRSRDKDEDGKKQKKRGRPPAEKLSPNPSSLTKKMKKIVDAVIKYKDGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKI 1459          

HSP 2 Score: 170.629 bits (431), Expect = 3.587e-42
Identity = 119/188 (63.30%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  KV + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  325 RIQELENIPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITGKVQKVTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 512          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 492/849 (57.95%), Postives = 621/849 (73.14%), Query Frame = 3
Query: 1623 SHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWS--NVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXX--------------------------------XXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDD-----YIGKRNRKEVDYSDALMEHEFLKAIXXXXXX--XXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRD-----KDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVW 4031
            S  QSYY +AH+  E ++ Q+S+L+NG+LK YQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW MEF+KWGPSV KI YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT YIAP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSALQ+ +Y ++Q+K  +L    +  K       +  N ++QLRKI NHPYMF  +E  +A+H+          PN      + GADL+RASGKFELLDRILPKL+ + HRVL+FCQMT LM +ME Y  +R F+YLRLDGTTKSEDR +LL  FN+PNS +FIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+                                    + +EDE PDDET+NQM+ARSEEEFE++ RMD++R   +      + RL+  DE+P N    D  + E    +D+       G R RKEVDYSD+L E ++LKAI++   +  E+    +  + +++     G S +     P      +    +  G        P    L ++M+ +++ VI YRD       GR LS+ F++LPSRK+LP+YY++I++P+DF +I++R++ +KYRS+DDLE D+ +LC NAQT+N++GSLI+EDS +LQ V+
Sbjct:  708 SGSQSYYTMAHAVSERVECQSSLLVNGSLKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPFLIIVPLSTLSNWMMEFDKWGPSVVKISYKGSPIARRAFMPQLRSGKFNVLLTTYEYIIKDKHVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGAKTLMNTIVQLRKIANHPYMFQHIEESFAEHLGF--------PN----SIVQGADLFRASGKFELLDRILPKLRVSNHRVLLFCQMTSLMTIMEDYFAFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSGHERRAFLQAVLEHEEQNEVRVWSTNGFVHHHHEQHQPGSVQRYVFSPPQREEDEVPDDETVNQMIARSEEEFEMFMRMDLDRRREDARNPRRRPRLMEEDELP-NWIIKDDAEVERLTCEDEEEKLFGRGSRQRKEVDYSDSLTEKQWLKAIEEGNLDLLEEEVRMKKARKRKRDPDTPGPSRERVGAAP----EPEEKAKKKRGRPPVEKPVPNPPALTRKMKRIIDTVIKYRDSVPVRSCGRQLSDVFIQLPSRKELPEYYELIRRPVDFNKIKERIRIHKYRSMDDLEKDVMLLCHNAQTFNLEGSLIYEDSKVLQGVF 1539          

HSP 2 Score: 167.548 bits (423), Expect = 6.753e-42
Identity = 118/189 (62.43%), Postives = 145/189 (76.72%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
             RI+EL N    L         IE+KALRLL  QR LRQE++  M++DT+LETALN +AY+R K+QTLREAR TEKLEKQ K EQE++R+QKHQE+LN++L HAK+F+EFHR   +K  KV R +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYR LID+KKD RL YLL QTDE+I  LT LV
Sbjct:  358 HRIEELENLPGSLPGDLRNKATIEIKALRLLNFQRQLRQEVVACMRRDTTLETALNAKAYKRSKRQTLREARITEKLEKQQKIEQERKRKQKHQEYLNSILQHAKDFKEFHRTMTAKVQKVTRAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRNLIDQKKDKRLAYLLMQTDEYIGNLTDLV 546          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001164.1 (pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 gene:ENSPMAG00000001030.1 transcript:ENSPMAT00000001164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 324/465 (69.68%), Postives = 384/465 (82.58%), Query Frame = 3
Query: 1635 SYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQ 3023
            SYYA+AH+  E +  Q+S++ING+LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME K++NGP+LIIVPLST+SNW +EF+KW PSV KI YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LN+ YIAP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQ+ +Y ++Q+K  +L   S    K     +   N +MQLRKICNH YMF  +E  +++H  +    G           I GA+LYRASGKFE+LDRILPKL+   HRVL+FCQMT LM +ME Y  +R F+YLRLDGTTK+++RGDLL  FN+P+S +FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQ
Sbjct:  258 SYYAMAHAITESVDRQSSLMINGSLKMYQVQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMENKRLNGPYLIIVPLSTLSNWVIEFDKWAPSVVKISYKGSPAARRAFMVQLRSGKFNVLLTTYEYIIKDKHVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNSHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHVYMFQHIEESFSEH--LGFSGGI----------IQGAELYRASGKFEVLDRILPKLRATNHRVLLFCQMTALMTIMEDYFAFRSFRYLRLDGTTKADERGDLLKMFNEPDSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQ 710          

HSP 2 Score: 81.2629 bits (199), Expect = 1.037e-15
Identity = 60/95 (63.16%), Postives = 78/95 (82.11%), Query Frame = 3
Query:  909 EFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            E+L ++L HAK+F+E+HR+  +K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE+I  LT LV
Sbjct:    1 EYLTSILQHAKDFKEYHRSMAAKVQKLTKAVSTYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYIGNLTDLV 95          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001160.1 (pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 gene:ENSPMAG00000001030.1 transcript:ENSPMAT00000001160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 324/465 (69.68%), Postives = 384/465 (82.58%), Query Frame = 3
Query: 1635 SYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQ 3023
            SYYA+AH+  E +  Q+S++ING+LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME K++NGP+LIIVPLST+SNW +EF+KW PSV KI YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LN+ YIAP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQ+ +Y ++Q+K  +L   S    K     +   N +MQLRKICNH YMF  +E  +++H  +    G           I GA+LYRASGKFE+LDRILPKL+   HRVL+FCQMT LM +ME Y  +R F+YLRLDGTTK+++RGDLL  FN+P+S +FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQ
Sbjct:  317 SYYAMAHAITESVDRQSSLMINGSLKMYQVQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMENKRLNGPYLIIVPLSTLSNWVIEFDKWAPSVVKISYKGSPAARRAFMVQLRSGKFNVLLTTYEYIIKDKHVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNSHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHVYMFQHIEESFSEH--LGFSGGI----------IQGAELYRASGKFEVLDRILPKLRATNHRVLLFCQMTALMTIMEDYFAFRSFRYLRLDGTTKADERGDLLKMFNEPDSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQ 769          

HSP 2 Score: 53.1434 bits (126), Expect = 4.357e-7
Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3
Query: 1098 GYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            GYRKLID+KKD RL YLLQQTDE+I  LT LV
Sbjct:  123 GYRKLIDQKKDKRLAYLLQQTDEYIGNLTDLV 154          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 446.047 bits (1146), Expect = 1.324e-140
Identity = 233/503 (46.32%), Postives = 314/503 (62.43%), Query Frame = 3
Query: 1671 IKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIR-KELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRA-ILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAG 3173
             +E  S +  GT++ YQ++GL WL+SLY N +NGILADEMGLGKT+QTI L+ Y+   + + GP +++VP ST+ NW  EFE+W PS++ +   G    R    Q  +   +++V +T+YE II++KS   K  W+Y++IDE HR+KN   KL++I+  F     RLLLTGTPLQN L ELW+LLNFLLP++F S +TF  WF+       ++          ++ RLH VLRPFLLRR+K +VE  LP K E  I   +S +QR+ Y+ I  K   IL S  K  K R      N+LMQLRK CNHPY+F   E                 P  P   + H   +   SGK  +LD++LPKL     RVL+F QMT +MD++E Y  +R ++Y RLDG T  EDR   + +FN P+S  F+FMLSTRAGGLG+NL +AD VI++DSDWNP  DLQA DRAHRIGQ+  VRV R I  +++E++I+  A  KL +D  VIQ G
Sbjct:  100 FEESPSYVKCGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIEWDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTT-NRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDTNNCFGDQQ----------LVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKMRL----LNILMQLRKCCNHPYLFDGAE-----------------PGPPYTTDTH---IVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQG 567          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 445.662 bits (1145), Expect = 2.809e-136
Identity = 233/514 (45.33%), Postives = 324/514 (63.04%), Query Frame = 3
Query: 1671 IKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSK-FNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVD-KDKKGRTERL-WSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQ---AG-MFDQKS 3191
             +E  + +  GT++ YQ++GL WL+SLY N +NGILADEMGLGKT+QTI L+ Y+   + + GP +++VP ST+ NW  EFE+W PS++ +   G+   R      + T + ++V +T+YE +I++KS   K  W+Y++IDE HR+KN   KL+ I+  F  +  RLLLTGTPLQN L ELW+LLNFLLP++F S   F+ WF+           L  +E   ++ RLH VLRPFLLRR+K +VE  L  K E  I   +S +QR+ Y+ I     ++K +D  +  G+ ++L   N+LMQLRK CNHPY+F   E                 P  P   + H   L   SGK  +LD++LPKL+    RVL+F QMT ++D++E Y  ++ + Y RLDG T  EDR + + A+N PNS  FIFMLSTRAGGLG+NL +AD VI++DSDWNP  DLQA DRAHRIGQ   VRV R +  N++EE+I+  A  KL +D  VIQ   AG + DQ++
Sbjct:  125 FEESPTYVKGGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVATDENVYTKREWDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFK-STNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNC-------LGDQE---LVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKI-----LMKDIDILNSAGKMDKLRLLNILMQLRKCCNHPYLFDGAE-----------------PGPPYTTDTH---LVNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQA 602          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 361/645 (55.97%), Postives = 468/645 (72.56%), Query Frame = 3
Query: 1641 YALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSG--EKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-------INQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPE--NIDYHDSLDEEVQQVQDDYIGK--RNRKEVDYSDALMEHEFLK 3536
            Y +AH   E+IK+Q SIL+ GTLK YQ+KGL+W+VSL+NN+LNGILADEMGLGKTIQTI L+TYL E K + GP+L+IVPLST+SNW+ EF KW P+++ I +KGSP  RK  QA+++  +F+V+LTT+EYIIK+++ LSKVKW +MIIDEGHRMKN   KL+  LNT Y A YRL+LTGTPLQN LPELWALLNF+LP IF SV +F++WFN PFA++G  +K+EL++EETLL+IRRLHKVLRPFLLRRLKK+VE +LP+KVE V+KC+MSALQ+ +Y  +   R +      +KK    R ++N +MQL+KICNHP++F EVE +                    P      D++R +GKFELLDRILPKLK   HRVL+F QMT +MD+ME +L Y   KYLRLDG TKS++R +LL  FN P+SE+  F+LSTRAGGLGLNLQ+ADTVIIFD+DWNPHQDLQAQDRAHRIGQ+NEVR+LRLI  NS+EE IL  A  KL++D KVIQAG FD KST ++++  L++LLD +E    + E   +E        IN++LAR++EE  +  RMD +R   E+   V K+RLL   E+P+  + D    L  E  +    Y G+  R RK   Y+D + E ++L+
Sbjct:  745 YNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQIN------------------PTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEEELGV-KSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLR 1370          

HSP 2 Score: 69.3218 bits (168), Expect = 4.342e-12
Identity = 35/99 (35.35%), Postives = 59/99 (59.60%), Query Frame = 3
Query: 3732 KLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSV 4028
            K+ K+   L +  ++Y ++ GR LS+ F+  PS+   PDYY IIK P+ F  I   ++   Y S+ +   D  ++  NA+ YN +GS+++EDS+ L+ V
Sbjct: 1549 KVAKQALDLYHFALNYENEAGRKLSDIFLSKPSKALYPDYYMIIKYPVAFDNINTHIETLAYNSLKETLQDFHLIFSNARIYNTEGSVVYEDSLELEKV 1647          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 362/648 (55.86%), Postives = 470/648 (72.53%), Query Frame = 3
Query: 1638 YYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSG--EKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTE---RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXT-INQMLARSEEEFEIYQRMDIERELAEKNKA------VHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIGK-RNRKEVDYSDALMEHEFLKAI 3542
            YY +AH   E+I +Q SIL+ GTLK+YQL+GLEW+VSLYNN+LNGILADEMGLGKTIQ+I LITYL E KK  GPFL+IVPLST++NW +EFEKW PS+  I+YKG+P  R  LQ Q++   F+VLLTTYEYIIKDKS LSK  W +MIIDEGHRMKN   KL+  ++ +Y    RL+LTGTPLQN LPELWALLNF+LP IF S  TFE WFN PFA++G  EK+EL +EETLLIIRRLHKVLRPFLLRRLKKEVE  LP+KVE VIKC++S LQ+++Y  +    A+   V    +G T+   +  +N +MQLRKICNHP++F EVE                   V  P   +   L+R +GKFELLDR+LPK K + HRVLMF QMT +MD+ME +L  +  KY+RLDG+TK+E+R ++L AFN P+S++F F+LSTRAGGLGLNLQ+ADTVIIFD+DWNPHQDLQAQDRAHRIGQ+NEVR+LRLI  +S+EE IL  A  KL++D KVIQAG FD KST ++++ +L+ L++ + + DD+D+   D+  +N  LARS +E  ++ ++D ER   E+  A      V   RL+  DE+P+   + + ++E  ++   + +G+ R +K V Y D L E +FL+A+
Sbjct:  447 YYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALF--VGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE------------------GVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPKV--FREDIEEHFKKEDSEPLGRIRQKKRVYYDDGLTEEQFLEAV 1072          

HSP 2 Score: 56.6102 bits (135), Expect = 3.255e-8
Identity = 23/66 (34.85%), Postives = 44/66 (66.67%), Query Frame = 3
Query: 3813 FMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDS 4010
            F KLPS++D PDY+ +I+KPM    I +  K+  Y++++++   +  + +NA+ YN +GS ++ D+
Sbjct: 1278 FEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDA 1343          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 452.21 bits (1162), Expect = 1.477e-137
Identity = 234/504 (46.43%), Postives = 332/504 (65.87%), Query Frame = 3
Query: 1671 IKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKEL-QAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKR--AILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAG 3173
            + E  S + +G L+ YQ++GL WL+SL+ N L+GILADEMGLGKT+QTI  + YL   K++ GPFLIIVP ST+ NW  EF KW P+V  ++  G    R ++ +  +  ++F+VL+T+YE +I++K++L ++ W+Y++IDE HR+KN    L+QI+  FY +  RLL+TGTPLQN L ELWALLNFLLP+IF     F++WF           E +QE   ++I++LH VL PFLLRR+K +VE  L  K+E  +   M+ +Q + Y ++  K   A+  +V K ++G+T  L  N++MQLRK CNHPY+F   E                 P  P   + H   L   SGK  +LD++L +LK    RVL+F QM+ L+D++E Y  +R F+Y R+DG+T  E+R + +  +NKPNSE F+F+L+TRAGGLG+NL +ADTVI+FDSDWNP  DLQA DRAHRIGQ+ +V V R +  N+IEEK++  A  KL +D+ VIQ G
Sbjct:  172 VSESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFY-SKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQ------NNSEQDQE---IVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGK-REGKTRLL--NIVMQLRKCCNHPYLFEGAE-----------------PGPPYTTDEH---LIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQG 642          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 425.631 bits (1093), Expect = 7.114e-128
Identity = 225/498 (45.18%), Postives = 315/498 (63.25%), Query Frame = 3
Query: 1680 QASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKEL-QAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKR-AILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQ 3167
            ++   +NG L+ YQ++G+ WLVSL+ N + GILADEMGLGKT+QTI  + YL   +K+ GPFL+I P ST++NW  E  +W P V   + +G  + R EL Q +L    F+V++ +YE II++KS L K+ W+Y+IIDE HR+KN    L+Q+L  F  +  RLL+TGTPLQN L ELWALLNFLLP+IF     F+ WF      S E  E +Q++   I+++LH VL+PFLLRR+K +VE  L  K E  +   MS++Q+K Y  I  K    +   +  K+ +T  L  N++MQLRK CNHPY+F   E                 P  P   + H   +Y A+    L   +    +    RVL+F QM+ L+D++E Y  +R ++Y R+DG+T  EDR   +  +N P+S+ F+F+L+TRAGGLG+NL SAD V+++DSDWNP  DLQA DRAHRIGQ+ +V+V RL+  NS+EEKIL  A  KL +D+ VIQ
Sbjct:  187 ESPAYVNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREF-TSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWF------SSESTEEDQDK---IVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLL--NIMMQLRKCCNHPYLFDGAE-----------------PGPPYTTDEHL--VYNAAKLQVLDKLLKKLKEEGS-RVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQ 652          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 412.535 bits (1059), Expect = 8.143e-121
Identity = 224/526 (42.59%), Postives = 318/526 (60.46%), Query Frame = 3
Query: 1635 SYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQ----------AQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFD 3182
            S Y       E++  Q   +  G L+ +QL G+ W+  L++   NGILADEMGLGKT+QT+  I++L+  ++ NGP +I+VPLSTM  W   FEKW P +  I Y G+ K R  ++             KT KFNVLLTTYEYI+KD++ L  +KW++M +DE HR+KN    L + LN+F +A  R+L+TGTPLQN + EL AL+NFL+P  F    T +Q  +          E   EE    I  LH+ ++PF+LRRLKK+VE  LP K E +++ E+S +Q + Y NI +K     ++    KG    L  N++ +L+K  NHPY+F   E    + V  K  +G       + +E     L  +SGK  LLD++L +LK+  HRVL+F QM  ++D++  YL  +   + RLDGT  S  R   +  FN P+S  F+F+LSTRAGGLG+NL +ADTV+IFDSDWNP  DLQA  RAHRIGQ+N V V RL+  +++EE++L  AR K+ ++  +I  G+ D
Sbjct:  352 SNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVA-NRMLITGTPLQNNIKELAALVNFLMPGRF----TIDQEID---------FENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN--YSALTAGAKGGHFSLL-NIMNELKKASNHPYLFDNAE----ERVLQKFGDGK------MTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTD 850          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 639/1238 (51.62%), Postives = 828/1238 (66.88%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLE-EESPQAKNLIAWIKEHEEWRLSLKDEQGLE------------------IFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALL---------------XXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAE-KNKAVHKN--RLLVADEIPENIDYHDSLDEEVQQVQDDYI----GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSK-------PPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKD-GRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMMEINGXXXXXXXXXXXXXPDTLSEICEQSDTKIKEEGDEEDPS 4187
            QRI EL      L +   +   IEL+ALRLL  Q+ LR E++   +KDT+LETALN +AY+R KKQ+LREAR TEKLEKQ K EQE++RRQKHQE+LN +L HA++F+E+HR+  SK  K+N+ +MNY + T+R+K+KE+ER+E+ERMRRLMAEDEEGYRKLID KKD RLHYLL QTDE+IA LTK+V+                   Q K D        R  + +++ ++ T D               D+HIP+ +  T E L+ +++P A  L  W+  H  + ++ + E                      +   D + K   E  +           E +  N     +YY++AHS  E I EQ S+L+ G LK+YQL GLEW+VSL+NNNLNGILADEMGLGKTIQTI L +YL+E+K++NGPFL+IVPLST+SNW +EFEKW PS   + YKGSP +R+   A L+T KFNV+LTTYEY+++DK+ L+KV+WKYM++DEGHRMKNHHCKLTQ+LNT Y A +R+LLTGTPLQN+LPELWALLNFLLP IFKSV+TFEQWFNAPFA +GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYV+KC+MS LQR +Y+++  K  +L   S    K     +   N +MQLRKICNHP+MF  +E   A+H  +  H G           + G D+YRASGKFELLDRILPKLKR KHRVLMFCQMT LM ++E Y  ++ F YLRLDGTTKSEDRG LL  FN  +S +F+F+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+ EVRVLRL+ +NS+EEKILAAAR+KLNVDEKVIQAGMF+Q ST  +RK +L ALL                   +  +E E PDDET+NQM+ARSEEEFE+YQRMDIER   E ++   H+   RL+  +E+P  I   D+  E +   +++      G R RK+VDYS+ L E ++LKAI+D   EE  + Q   +   K++  EG+ E ++ K       PPA                     +P    L K+M+ LL  V+ + D+D GR L+EPF+ LP++KDLPDYY IIK+P+D ++IR+R+  +KYR ++DL+ D  ++C+NAQTYNM+GS+IF+DSI LQS++ +A  K++  E                P T  +     DT  +EEGD +  S
Sbjct:  301 QRIKELEGLPGNLPDDLRIKAMIELRALRLLNFQKQLRHEVVACTRKDTTLETALNSKAYKRSKKQSLREARITEKLEKQQKMEQERKRRQKHQEYLNMILQHARDFKEYHRSVQSKIVKLNKAVMNYHSVTDREKKKEEERIEKERMRRLMAEDEEGYRKLIDHKKDKRLHYLLSQTDEYIASLTKMVQ-------------------QHKRDHKKKLQKGRVRR-KSDFDDETPDA--------------DKHIPVVDTETGEVLKGDDAPTAGELEDWLTTHPGYAVAPRQEDEESDEDDEEDEEEEEEESTQNLLYRDVKSKEKSEREKRKELYGKDDEGELESENPQEAINYYSIAHSMKETITEQPSMLVGGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMRRSAGAVLRTGKFNVVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEH--LGFHGGI----------VTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQAGMFNQNSTSSERKAFLMALLDTENDDDEAPKSNSNGASSAAMEESEVPDDETVNQMIARSEEEFELYQRMDIERRRTEVRDPTTHRRRPRLMADNELPRWILKDDNEVERLTWEEEEEKMFARGSRQRKKVDYSEHLTEKQWLKAIEDGCLEEVEERQ-KTRKVAKKRRREGTEEPDAPKMKKKRGRPPA------------------VRLSPNPPDLTKKMKRLLKYVVKHVDEDTGRSLAEPFLILPTKKDLPDYYQIIKQPVDIRKIRERINSHKYRCLEDLDEDFTLMCRNAQTYNMEGSIIFDDSIKLQSLFDHAMSKVKSGE------------ELHIPKTSQDQESDKDTTDREEGDNDGES 1461          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 444.121 bits (1141), Expect = 3.268e-135
Identity = 229/504 (45.44%), Postives = 323/504 (64.09%), Query Frame = 3
Query: 1671 IKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKE-LQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDK-DKKGRTERL-WSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAG 3173
             +E  + +  G ++ YQ++GL WL+SLY N +NGILADEMGLGKT+QTI L+ Y+   + V GP ++I P ST++NW  EFE+W PS++ +   G+ + R   ++  +   +++V +T+YE +I++K+   K  W+Y++IDE HR+KN   KL++I+     A  RLLLTGTPLQN L ELWALLNFLLP++F S + F+ WFN     S   VE  Q     ++ RLH VLRPFLLRRLK +VE +L  K E  +   ++ +QR  Y+ I     ++K +D  +  G+T+++   N+LMQLRK CNHPY+F   E                 P  P   ++H   L   SGK  +LD++L +LK+   RVL+F QMT L+D++E Y  +R + Y RLDG T  E+R   + +FN P S  FIFMLSTRAGGLG+NL +AD VI++DSDWNP  DLQA DRAHRIGQ+ +V+V R I  +++EE+I+  A  KL +D  VIQ G
Sbjct:  132 FEESPNYIKGGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGEWDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSA-NRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFN-----SNNLVEEKQ-----LVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKI-----LMKDIDVVNGAGKTDKMRLLNILMQLRKCCNHPYLFDGAE-----------------PGPPYTTDVH---LIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQG 599          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO46669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD7])

HSP 1 Score: 409.838 bits (1052), Expect = 8.415e-124
Identity = 231/553 (41.77%), Postives = 332/553 (60.04%), Query Frame = 3
Query: 1680 QASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQL----KTSKFN---VLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFN--APFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVY--------------------------SNIQSKRAILKSVD----KDKKGRTERLWSNVLM---QLRKIC--NHPYMFPEVEIEYAKHVFMKMHNGNPP-----PNVPIPKEIH-GADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQK 3188
            Q  +L  G L+ YQL+G+EWL  LY N +NGILADEMGLGKTIQ IGL++YL+E   V GPFL+  PLST+ NW  EF ++ P +  ILY GS + R  L+ ++    K   F    V++T+YE  + D+  L ++ WK+MI+DEGHR+KN +C+L + L ++  A  RLLLTGTPLQN L ELW+LLNFLLP+IF  +N+F++WF+  A     G +  + QE+   ++ RLH +L PFLLRRLK +VE  LP K E +++  +++ Q + Y                          S  + KR   ++++     D+ G  E L   +       R+IC  +      ++ I+    + +     N P     P  P+ ++     +L R SGK  LLD+++P LKR  H++L+F QMT ++D+++ Y   R ++Y RLDG+ K EDR + + AF   + E FIF+LSTRAGGLGLNL +ADTVII+DSDWNP  DLQAQDR HRIGQ   + V RL+  N++++KI+  A  K  +++ VI  G F  K
Sbjct:  289 QPVLLTGGALRSYQLEGVEWLKGLYENGVNGILADEMGLGKTIQCIGLVSYLIEM-GVRGPFLVAAPLSTLPNWVSEFRRFSPQIPVILYHGSIQERTSLRRKITKLKKAGPFETMPVVVTSYEIAMNDQKHLFQLMWKHMIVDEGHRIKNLNCRLIRELKSYNSA-NRLLLTGTPLQNNLAELWSLLNFLLPDIFDDLNSFQRWFDFSAINDEGGNEKIIAQEKEHQVLERLHSILTPFLLRRLKTDVELSLPPKKEVLVRAPLTSKQTEFYRAALDKTILDIVGDNKDKKEDKVEISSTGRKKRKGRRNINYKIFDDENGSIEELAEELATLEKSRREICTPSQKSSTYDISIKITNILMLLRKCCNHPYLLEYPLDPVTQQYKIDEELVRCSGKMLLLDQMVPALKRRGHKILIFSQMTKMLDILQDYCYLRGYQYSRLDGSMKVEDRREEIDAFAS-DPEKFIFLLSTRAGGLGLNLSAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPILVYRLVTSNTVDQKIVERAASKRKLEKMVIYKGKFKGK 838          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 376.711 bits (966), Expect = 8.334e-113
Identity = 212/519 (40.85%), Postives = 302/519 (58.19%), Query Frame = 3
Query: 1698 NGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKEL------------QAQLKT--------SKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKST 3194
             G L +YQ +GL WL   +    N ILADEMGLGKTIQTI  +  LM+     GPFL+  PLST+ NW  EFE W P +  + Y G  + R  +            ++ LK          KF+VLLT+YE +  D +SL  + W  +++DE HR+KN+  K  + L+ + I  Y+LLLTGTPLQN L ELW LL FL P  F + N F   F+           + +E+    I++LH +L P +LRRLK +V   +P K E +++ E+S +Q+K Y  I ++    ++++   KG  +    NV+M+L+K CNHPY+F    +E AK    +  +G   PN           L  ASGK  LL ++L KL+   HRVL+F QMT ++DL+E +LE   +KY R+DG+     R + +  FN P S+ F F+LSTRAGGLG+NL +ADTV I+DSDWNPH D+QA  RAHRIGQ N+V + R +  +S+EE+I   A+ K+ +   V++ G+   K+T
Sbjct:  255 GGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIG-YKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFD----------NVAKEDQ---IKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRN--FEALNT--KGAQQVSLLNVMMELKKCCNHPYLFHAAALE-AK----RTQSGGYEPN----------SLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPGLGSNKAT 740          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 371.703 bits (953), Expect = 7.942e-107
Identity = 210/506 (41.50%), Postives = 293/506 (57.91%), Query Frame = 3
Query: 1704 TLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQ------------LKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVE----IEYAK-HVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQA 3170
            TL++YQL+G+ WL+  + N  N ILADEMGLGKTIQ+I  + + M+R  + GP L+I PLST+SNW  EFE W   +  ++Y GS   R  +Q                  KF VL+TTYE II D   LS V W+ +IIDE HR+KN +CKL + LN   +  +R+LLTGTPLQN + EL++LLNFL P+ F S   F              +E    +T   + +L ++L+P +LRRLK++VE  +  K E +I+ E++ +Q+K Y  I  +     +           L  N +M+LRK CNHP++    E     EY + HV                 + H   +  ASGK  L+ ++LPKLK   H+VL+F QM   +D++E YL +  + Y R+DG  +   R   +  F+KP+S+ F+F+L TRAGGLG+NL +ADTVIIFDSDWNP  DLQAQ R HRIGQ   V+V RLI  NS E ++   A  KL +D+ V+Q+
Sbjct:  228 TLREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFL-FEMQRYGIRGPNLVIAPLSTISNWQREFESWN-DINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQME-HRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAF-------------LMEFGDLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAFLAKGTSSTANVPNL-MNTMMELRKCCNHPFLITGAEEKILQEYGREHV-----------------DRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQS 699          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000039803.1 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:101161713])

HSP 1 Score: 971.459 bits (2510), Expect = 0.000e+0
Identity = 498/828 (60.14%), Postives = 636/828 (76.81%), Query Frame = 3
Query: 1617 NKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAIL---KSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI----GKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDES---------SKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            +++ +QSYY +AH+  E++ +Q+++LING LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  E +KW PSV KI YKG+P +R+ L  QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q  + IL    S    K     +   N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G DLYRASGKFELLDRILPKL    HRVL+FCQMT LM +ME Y  YR F YLRLDGTTKSEDR  LL  FN+  S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E  ++EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+  E +   +++      G R R++VDYSDAL E ++L+AI+D   EE  +  R +K KRKR+ ++ SS  E           +PPA                     +P   KL K+M  +++ VI+YRD  GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++++KYRS+ DLE D+ +LC+NAQT+N++GS I+EDSI+LQSV+ +AR+K+
Sbjct:  708 DQTSLQSYYGVAHAVIEKVDKQSTLLINGMLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSVVKIAYKGTPALRRGLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQ--KGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGYPNGI----------ISGPDLYRASGKFELLDRILPKLHATGHRVLLFCQMTTLMTIMEDYFGYRNFLYLRLDGTTKSEDRAALLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCSVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNEEEDEVPDDETLNQMIARNEDEFELFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTYEEEEEKMFGRGSRCRRDVDYSDALTEKQWLRAIEDGNLEEMEEEIRLKKRKRKRRQDKDSSSREEGGGKARKRRGRPPA------------------EKLSPNPPKLTKQMNTIIDTVINYRDGAGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRNHKYRSVGDLEKDVMLLCQNAQTFNLEGSQIYEDSIVLQSVFKSARQKI 1503          

HSP 2 Score: 167.162 bits (422), Expect = 5.188e-41
Identity = 117/188 (62.23%), Postives = 147/188 (78.19%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL +    L         +ELKALRLL  QR LRQ+++  M++DT+LETALN +AYRR K+QTLREAR TEKLEKQ K EQEK+RRQKHQE+LN++L HAK+F+E+HR+ + K  K+ R +  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  373 RIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYRRSKRQTLREARMTEKLEKQQKLEQEKKRRQKHQEYLNSILQHAKDFKEYHRSVSGKIQKITRSVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTALV 560          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000036279.1 (transcription activator BRG1 [Source:NCBI gene;Acc:101162023])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 433/647 (66.92%), Postives = 522/647 (80.68%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI 3542
            +QSYYA+AH+  E++++Q+++LING LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF ++E  +++H  +    G           + G DLYRASGKFE+LDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN P SE+FIF+LSTRAGGLGLNLQSADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+ARSEEEFE++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R RKEVDYSD+L E ++LKAI
Sbjct:  771 LQSYYAVAHAVTEKVEKQSTLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEH--LGFSGGI----------VQGPDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRTFKYLRLDGTTKAEDRGMLLKTFNSPESEYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARSEEEFELFMRMDLDRRREEARNPRRKPRLMEEDELPTWIMKDDA---EVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAI 1402          

HSP 2 Score: 166.777 bits (421), Expect = 6.981e-41
Identity = 117/188 (62.23%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETAL+ +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  427 RIAELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSMTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 614          

HSP 3 Score: 129.798 bits (325), Expect = 1.396e-29
Identity = 55/107 (51.40%), Postives = 92/107 (85.98%), Query Frame = 3
Query: 3735 LMKRMQMLLNIVIDYRDK-DGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKL 4052
            L K+M+ +++ VI Y+D   GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ ++YR++ DLE D+ +L +NAQT+N++GSLI+EDSI+LQSV+++ R+K+
Sbjct: 1471 LTKKMRKIVDAVIKYKDSASGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHRYRTLGDLERDVMLLFQNAQTFNLEGSLIYEDSIVLQSVFTSLRQKI 1577          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000004949.2 (transcription activator BRG1 [Source:NCBI gene;Acc:101162023])

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 433/647 (66.92%), Postives = 523/647 (80.83%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI 3542
            +QSYYA+AH+  E++++Q+++LING LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  EF+KW PSV K+ YKGSP  R+    QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP R+LLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MS+LQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHPYMF ++E  +++H+     +G           + G DLYRASGKFE+LDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN P SE+FIF+LSTRAGGLGLNLQSADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+ARSEEEFE++ RMD++R   E      K RL+  DE+P  I   D+   EV+++  +         G R RKEVDYSD+L E ++LKAI
Sbjct:  631 LQSYYAVAHAVTEKVEKQSTLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEHLGF---SGG---------IVQGPDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRTFKYLRLDGTTKAEDRGMLLKTFNSPESEYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARSEEEFELFMRMDLDRRREEARNPRRKPRLMEEDELPTWIMKDDA---EVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAI 1262          

HSP 2 Score: 166.777 bits (421), Expect = 6.158e-41
Identity = 117/188 (62.23%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETAL+ +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+   K  K+ + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  327 RIAELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSMTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 514          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:101163329])

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 435/647 (67.23%), Postives = 518/647 (80.06%), Query Frame = 3
Query: 1629 IQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILK--SVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI-------GKRNRKEVDYSDALMEHEFLKAI 3542
            +QSYYA+AH+  E++ +Q+S+LING LKQYQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGPFLIIVPLST+SNW  EF+KW PSV K+ YKGSP  R+     L++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPEKVEYVIKC+MSALQR +Y ++Q+K  +L   S    K     +   N +MQLRKICNHP+MF  +E  +++H  +    G           + G DLYRASGKFELLDRILPKL+   H+VL+FCQMT LM +ME Y  YR FKYLRLDGTTK+EDRG LL  FN P SE+FIF+LSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E +++EDE PDDET+NQM+ARSEEEFE + RMD++R   +      K RL+  D++P  I   D+   EV+++  +         G R RKEVDYSD+L E ++LKAI
Sbjct:  735 LQSYYAVAHAVTEKVDKQSSLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRINGPFLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPVARRLFVPILRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESFSEH--LGFSGGI----------VSGPDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRSFKYLRLDGTTKAEDRGMLLKTFNDPASEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSGYERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARSEEEFEQFMRMDLDRRREDARNPKRKPRLMEEDDLPNWILKDDA---EVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAI 1366          

HSP 2 Score: 169.088 bits (427), Expect = 1.113e-41
Identity = 118/188 (62.77%), Postives = 149/188 (79.26%), Query Frame = 3
Query:  630 RIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
            RI EL N    L+        IELKALRLL  QR LRQE++  M++DT+LETALN +AY+R K+Q+LREAR TEKLEKQ K EQE++RRQKHQE+LN++L HAK+F+E+HR+  +K  K  + +  Y ANTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT+LV
Sbjct:  390 RIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKIQKATKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELV 577          

HSP 3 Score: 144.436 bits (363), Expect = 4.283e-34
Identity = 59/107 (55.14%), Postives = 96/107 (89.72%), Query Frame = 3
Query: 3735 LMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLE 4055
            L K+M+ +++ VI Y+D +GR LSE F++LPSRK+LP+YY++I+KP+DF++I++R++ +KYRS++DLE D+ +LC+NAQT+N++GSLI+EDSI+LQSV+++ R+K+E
Sbjct: 1434 LTKKMKKIIDAVIKYKDSNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE 1540          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000025786.2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:101161713])

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 422/649 (65.02%), Postives = 518/649 (79.82%), Query Frame = 3
Query: 1617 NKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAIL---KSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYI----GKRNRKEVDYSDALMEHEFLKAI 3542
            +++ +QSYY +AH+  E++ +Q+++LING LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME K++NGP+LIIVPLST+SNW  E +KW PSV KI YKG+P +R+ L  QL++ KFNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT Y+AP RLLLTGTPLQNKLPELWALLNFLLP IFKS +TFEQWFNAPFA +GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLPEKVEYVIKC+MSA+Q+ +Y ++Q  + IL    S    K     +   N +MQL+KICNHPYMF  +E  +A+H  +   NG           I G DLYRASGKFELLDRILPKL    HRVL+FCQMT LM +ME Y  YR F YLRLDGTTKSEDR  LL  FN+  S++FIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRL  +NS+EEKILAAA++KLNVD+KVIQAGMFDQKS+  +R+ +L+A+L+ +E  ++EDE PDDET+NQM+AR+E+EFE++ RMD++R   +      K RL+  DE+P  I   D+  E +   +++      G R R++VDYSDAL E ++L+AI
Sbjct:  646 DQTSLQSYYGVAHAVIEKVDKQSTLLINGMLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSVVKIAYKGTPALRRGLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQ--KGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEH--LGYPNGI----------ISGPDLYRASGKFELLDRILPKLHATGHRVLLFCQMTTLMTIMEDYFGYRNFLYLRLDGTTKSEDRAALLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCSVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNEEEDEVPDDETLNQMIARNEDEFELFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTYEEEEEKMFGRGSRCRRDVDYSDALTEKQWLRAI 1280          

HSP 2 Score: 166.777 bits (421), Expect = 5.038e-41
Identity = 117/189 (61.90%), Postives = 147/189 (77.78%), Query Frame = 3
Query:  627 QRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLV 1193
             RI EL +    L         +ELKALRLL  QR LRQ+++  M++DT+LETALN +AYRR K+QTLREAR TEKLEKQ K EQEK+RRQKHQE+LN++L HAK+F+E+HR+ + K  K+ R +  +  NTER+++KE ER+E+ERMRRLMAEDEEGYRKLID+KKD RL YLLQQTDE++A LT LV
Sbjct:  339 HRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYRRSKRQTLREARMTEKLEKQQKLEQEKKRRQKHQEYLNSILQHAKDFKEYHRSVSGKIQKITRSVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTALV 527          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000076666.1 (SMESG000076666.1)

HSP 1 Score: 2480.29 bits (6427), Expect = 0.000e+0
Identity = 1447/1447 (100.00%), Postives = 1447/1447 (100.00%), Query Frame = 3
Query:   66 MYANNNGFGPNQPMSASPATCSNIQVINAPINNPITSMQIPNQINSNVNSGNYMPPVNNLPQNSMXXXXXXXXXXXXXNKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQADPATTTNSNNNDVLQRVQRDIKASCGKTLFKQAXXXXXXXXXXXXXXXXXXXXXXXXQRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYXXXXXXXXXXXXXXXXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLXXXXXXXXXXXXXXXXTINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIGKRNRKEVDYSDALMEHEFLKAIXXXXXXXXXXNQXXXXXXXXXXXXEGSSEDESSKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMMEINGXXXXXXXXXXXXXPDTLSEICEQSDTKIKEEGDEEDPSNALQQATSVGIAHKSAKIRPFDDELSQASDSLPPRSARKSVHKRLKKDEMKSXXXXXXXXXXXXXXXXXYYAN 4406
            MYANNNGFGPNQPMSASPATCSNIQVINAPINNPITSMQIPNQINSNVNSGNYMPPVNNLPQNSMQPEPSPASQPPVPNKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQADPATTTNSNNNDVLQRVQRDIKASCGKTLFKQARRPEALDPEELLRERENRIEARIIQRIDELTNKSAFLSNSQNMNLKIELKALRLLGLQRSLRQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTERDKRKEQERLERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVKDHKKEQIHRKKKEREEKRSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYDEVLEDDNDDDVHVGTEDDEYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLDQDESEDDEDECPDDETINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIGKRNRKEVDYSDALMEHEFLKAIDDAEAEEDADNQRNRKIKRKRKINEGSSEDESSKPPAPTPPIKRGRGRPPGSLSSTPSAPISSKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMMEINGSSSSKSHNKSTSKPDTLSEICEQSDTKIKEEGDEEDPSNALQQATSVGIAHKSAKIRPFDDELSQASDSLPPRSARKSVHKRLKKDEMKSDDDDIDGDNDDDEDDVDYYAN
Sbjct:    1 MYANNNGFGPNQPMSASPATCSNIQVINAPINNPITSMQIPNQINSNVNSGNYMPPVNNLPQNSMQPEPSPASQPPVPNKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQADPATTTNSNNNDVLQRVQRDIKASCGKTLFKQARRPEALDPEELLRERENRIEARIIQRIDELTNKSAFLSNSQNMNLKIELKALRLLGLQRSLRQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTERDKRKEQERLERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVKDHKKEQIHRKKKEREEKRSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYDEVLEDDNDDDVHVGTEDDEYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLDQDESEDDEDECPDDETINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIGKRNRKEVDYSDALMEHEFLKAIDDAEAEEDADNQRNRKIKRKRKINEGSSEDESSKPPAPTPPIKRGRGRPPGSLSSTPSAPISSKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSLIFEDSIILQSVWSNAREKLEMMEINGSSSSKSHNKSTSKPDTLSEICEQSDTKIKEEGDEEDPSNALQQATSVGIAHKSAKIRPFDDELSQASDSLPPRSARKSVHKRLKKDEMKSDDDDIDGDNDDDEDDVDYYAN 1447          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 548/846 (64.78%), Postives = 655/846 (77.42%), Query Frame = 3
Query:  300 NKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQA-DPATTTNSNNNDVLQRVQRDIKASCGKTLFKQAXXXXXXXXXXXXXXXXXXXXXXXXQRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEE-ESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYXXXXXXXXXXXXXX----XXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAIL-KSVDKDKKGR-TERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLM 2813
            N   F  NQL+QLRAQIN+YKLL+KS P+  ++I AAEGK  QL N  N+   D     N+N       + + +  S            ++LDP ELL +RE RI+ RI QRI ELT+KS        M   IELKAL+LL LQ+ +R EI+  MK+D  LE+ALNV+AYR+PK+QTL+E+RFTEKLEK++K++QEKR+RQKHQEFLNA + H+KEF+EFHRN N K  K+N+ ++NYF N+ER KRKEQER+ERERMRRLMAEDEEGYRKLIDEKKDMRLHYLL QTDEFIAGLTKLVK+HK++QI +KKKE + ++ + K + +   L++R   S++E+  I +++ AG     V  LP + HI I NP+T+++L +  +P   NL  W+KE++ W +   DE   E F  + EM   + V E+ N +D       GTEDDEYNK   Q+YY LAHS  EEI+EQ+S+L+NG LK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLME+K+VNGPFLIIVPLSTMSNWA+EFEKW PSV K+LYKGSP  RK +Q+QLK   FNVLLTTYEYIIKDK SLSK+KWKYMIIDEGHRMKNHHCKLTQILNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP+IF+SVNTFEQWFNAPFA SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKCEMSALQR +Y+++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MF  +E   A+H FM  H G  PP VPIP EI+G DLYR SGKFELLDRILPKLK A HR+L+FCQMT LM LM
Sbjct:   98 NDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGK--QLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGI----PGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLM 937          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050880.1 (SMESG000050880.1)

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 548/846 (64.78%), Postives = 655/846 (77.42%), Query Frame = 3
Query:  300 NKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQA-DPATTTNSNNNDVLQRVQRDIKASCGKTLFKQAXXXXXXXXXXXXXXXXXXXXXXXXQRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEE-ESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYXXXXXXXXXXXXXX----XXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAIL-KSVDKDKKGR-TERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLM 2813
            N   F  NQL+QLRAQIN+YKLL+KS P+  ++I AAEGK  QL N  N+   D     N+N       + + +  S            ++LDP ELL +RE RI+ RI QRI ELT+KS        M   IELKAL+LL LQ+ +R EI+  MK+D  LE+ALNV+AYR+PK+QTL+E+RFTEKLEK++K++QEKR+RQKHQEFLNA + H+KEF+EFHRN N K  K+N+ ++NYF N+ER KRKEQER+ERERMRRLMAEDEEGYRKLIDEKKDMRLHYLL QTDEFIAGLTKLVK+HK++QI +KKKE + ++ + K + +   L++R   S++E+  I +++ AG     V  LP + HI I NP+T+++L +  +P   NL  W+KE++ W +   DE   E F  + EM   + V E+ N +D       GTEDDEYNK   Q+YY LAHS  EEI+EQ+S+L+NG LK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLME+K+VNGPFLIIVPLSTMSNWA+EFEKW PSV K+LYKGSP  RK +Q+QLK   FNVLLTTYEYIIKDK SLSK+KWKYMIIDEGHRMKNHHCKLTQILNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP+IF+SVNTFEQWFNAPFA SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKCEMSALQR +Y+++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MF  +E   A+H FM  H G  PP VPIP EI+G DLYR SGKFELLDRILPKLK A HR+L+FCQMT LM LM
Sbjct:   98 NDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGK--QLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGI----PGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLM 937          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 508.064 bits (1307), Expect = 2.347e-160
Identity = 351/596 (58.89%), Postives = 439/596 (73.66%), Query Frame = 3
Query:  300 NKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQA-DPATTTNSNNNDVLQRVQRDIKASCGKTLFKQAXXXXXXXXXXXXXXXXXXXXXXXXQRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEE-ESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYXXXXXXXXXXXXXX----XXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVK 2069
            N   F  NQL+QLRAQIN+YKLL+KS P+  ++I AAEGK  QL N  N+   D     N+N       + + +  S            ++LDP ELL +RE RI+ RI QRI ELT+KS        M   IELKAL+LL LQ+ +R EI+  MK+D  LE+ALNV+AYR+PK+QTL+E+RFTEKLEK++K++QEKR+RQKHQEFLNA + H+KEF+EFHRN N K  K+N+ ++NYF N+ER KRKEQER+ERERMRRLMAEDEEGYRKLIDEKKDMRLHYLL QTDEFIAGLTKLVK+HK++QI +KKKE + ++ + K + +   L++R   S++E+  I +++ AG     V  LP + HI I NP+T+++L +  +P   NL  W+KE++ W +   DE   E F  + EM   + V E+ N +D       GTEDDEYNK   Q+YY LAHS  EEI+EQ+S+L+NG LK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLME+K+VNGPFLIIVPLSTMSNWA+EFEKW PSV K+LYKGSP  RK +Q+QLK   FNVLLTTYEYIIKDK SLSKV+
Sbjct:   98 NDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGK--QLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGI----PGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKVE 687          

HSP 2 Score: 250.751 bits (639), Expect = 6.665e-69
Identity = 125/175 (71.43%), Postives = 140/175 (80.00%), Query Frame = 3
Query: 2295 SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAIL-KSVDKDKKGRT-ERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLM 2813
            S  KVELNQEETLLIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKCEMSALQR +Y+++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MF  +E   A+H FM  H G  PP VPIP EI+G DLYR SGKFELLDRILPKLK A HR+L+FCQMT LM LM
Sbjct:  682 SLSKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLM 856          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050880.1 (SMESG000050880.1)

HSP 1 Score: 508.064 bits (1307), Expect = 2.347e-160
Identity = 351/596 (58.89%), Postives = 439/596 (73.66%), Query Frame = 3
Query:  300 NKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQA-DPATTTNSNNNDVLQRVQRDIKASCGKTLFKQAXXXXXXXXXXXXXXXXXXXXXXXXQRIDELTNKSAFLSNSQNMNLKIEXXXXXXXXXXXXXXQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVXXXXXXXXXXXXXXXXXXXSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEE-ESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYXXXXXXXXXXXXXX----XXXXXXYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVK 2069
            N   F  NQL+QLRAQIN+YKLL+KS P+  ++I AAEGK  QL N  N+   D     N+N       + + +  S            ++LDP ELL +RE RI+ RI QRI ELT+KS        M   IELKAL+LL LQ+ +R EI+  MK+D  LE+ALNV+AYR+PK+QTL+E+RFTEKLEK++K++QEKR+RQKHQEFLNA + H+KEF+EFHRN N K  K+N+ ++NYF N+ER KRKEQER+ERERMRRLMAEDEEGYRKLIDEKKDMRLHYLL QTDEFIAGLTKLVK+HK++QI +KKKE + ++ + K + +   L++R   S++E+  I +++ AG     V  LP + HI I NP+T+++L +  +P   NL  W+KE++ W +   DE   E F  + EM   + V E+ N +D       GTEDDEYNK   Q+YY LAHS  EEI+EQ+S+L+NG LK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLME+K+VNGPFLIIVPLSTMSNWA+EFEKW PSV K+LYKGSP  RK +Q+QLK   FNVLLTTYEYIIKDK SLSKV+
Sbjct:   98 NDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGK--QLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGI----PGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKVE 687          

HSP 2 Score: 250.751 bits (639), Expect = 6.665e-69
Identity = 125/175 (71.43%), Postives = 140/175 (80.00%), Query Frame = 3
Query: 2295 SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAIL-KSVDKDKKGRT-ERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLM 2813
            S  KVELNQEETLLIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKCEMSALQR +Y+++QSK  IL    +KDKKG+   R   N +MQLRKICNHP+MF  +E   A+H FM  H G  PP VPIP EI+G DLYR SGKFELLDRILPKLK A HR+L+FCQMT LM LM
Sbjct:  682 SLSKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLM 856          
The following BLAST results are available for this feature:
BLAST of Transcription activator BRG1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA41.868e-4161.17SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.868e-4161.17SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.869e-4161.10SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.869e-4161.10SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.869e-4161.10SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
swsn-43.174e-3454.30SWI/SNF nucleosome remodeling complex component; S... [more]
pqn-151.883e-1057.97Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
isw-11.222e-13146.06Chromatin-remodeling complex ATPase chain isw-1 [... [more]
let-4184.078e-11242.22pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-31.050e-10940.19Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brm0.000e+053.56gene:FBgn0000212 transcript:FBtr0075526[more]
brm0.000e+053.56gene:FBgn0000212 transcript:FBtr0075525[more]
brm0.000e+053.56gene:FBgn0000212 transcript:FBtr0075524[more]
brm0.000e+053.56gene:FBgn0000212 transcript:FBtr0075523[more]
brm0.000e+053.56gene:FBgn0000212 transcript:FBtr0333580[more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca21.952e-3960.27SWI/SNF related, matrix associated, actin dependen... [more]
smarca22.410e-3960.27SWI/SNF related, matrix associated, actin dependen... [more]
smarca22.552e-3960.27SWI/SNF related, matrix associated, actin dependen... [more]
smarca22.338e-3958.89SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA48.004e-4166.77transcription activator BRG1-like [Source:NCBI gen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA41.529e-4160.43SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.469e-4160.75SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.187e-4159.95SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.208e-4159.95SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA41.229e-4159.07SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarca44.601e-4259.93SWI/SNF related, matrix associated, actin dependen... [more]
Smarca44.669e-4261.05SWI/SNF related, matrix associated, actin dependen... [more]
Smarca44.711e-4260.98SWI/SNF related, matrix associated, actin dependen... [more]
Smarca23.454e-4060.31SWI/SNF related, matrix associated, actin dependen... [more]
Smarca23.287e-4059.03SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25439|BRM_DROME0.000e+053.56ATP-dependent helicase brm OS=Drosophila melanogas... [more]
sp|A7Z019|SMCA4_BOVIN7.164e-4160.98Transcription activator BRG1 OS=Bos taurus OX=9913... [more]
sp|Q8K1P7|SMCA4_RAT3.437e-4161.05Transcription activator BRG1 OS=Rattus norvegicus ... [more]
sp|Q3TKT4|SMCA4_MOUSE3.266e-4161.05Transcription activator BRG1 OS=Mus musculus OX=10... [more]
sp|Q6DIC0|SMCA2_MOUSE2.308e-3960.31Probable global transcription activator SNF2L2 OS=... [more]
back to top
BLAST of Transcription activator BRG1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4LZ020.000e+064.83Helicase, putative OS=Schistosoma mansoni OX=6183 ... [more]
A0A3Q0KR710.000e+064.86Helicase, putative OS=Schistosoma mansoni OX=6183 ... [more]
A0A4E0RV450.000e+064.14Global transcription activator snf2l2 OS=Fasciola ... [more]
A0A4Z2D6310.000e+064.40Putative global transcription activator SNF2L2 OS=... [more]
A0A0X3P6Q30.000e+061.67Putative global transcription activator SNF2L2 OS=... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca23.375e-4060.15probable global transcription activator SNF2L2 [So... [more]
smarca23.563e-4060.15probable global transcription activator SNF2L2 [So... [more]
smarca24.392e-4060.15probable global transcription activator SNF2L2 [So... [more]
ENSAMXT00000045183.11.927e-4059.27pep primary_assembly:Astyanax_mexicanus-2.0:13:200... [more]
smarca4a3.587e-4259.12SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA26.753e-4257.95SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000001164.11.037e-1569.68pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 ge... [more]
ENSPMAT00000001160.14.357e-769.68pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 ge... [more]
SMARCA51.324e-14046.32SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA52.809e-13645.33SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SNF24.342e-1255.97Catalytic subunit of the SWI/SNF chromatin remodel... [more]
STH13.255e-855.86ATPase component of the RSC chromatin remodeling c... [more]
ISW21.477e-13746.43ATP-dependent DNA translocase involved in chromati... [more]
ISW17.114e-12845.18ATPase subunit of imitation-switch (ISWI) class ch... [more]
CHD18.143e-12142.59Chromatin remodeler that regulates various aspects... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481160.000e+051.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407613.268e-13545.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466698.415e-12441.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395858.334e-11340.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472987.942e-10741.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039803.15.188e-4160.14probable global transcription activator SNF2L2 [So... [more]
ENSORLT00000036279.16.981e-4166.92transcription activator BRG1 [Source:NCBI gene;Acc... [more]
ENSORLT00000004949.26.158e-4166.92transcription activator BRG1 [Source:NCBI gene;Acc... [more]
smarca4a1.113e-4167.23SWI/SNF related, matrix associated, actin dependen... [more]
ENSORLT00000025786.25.038e-4165.02probable global transcription activator SNF2L2 [So... [more]
back to top
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076666.10.000e+0100.00SMESG000076666.1[more]
SMESG000050888.10.000e+064.78SMESG000050888.1[more]
SMESG000050880.10.000e+064.78SMESG000050880.1[more]
SMESG000050888.12.347e-16058.89SMESG000050888.1[more]
SMESG000050880.12.347e-16058.89SMESG000050880.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024863 ID=SMED30024863|Name=Transcription activator BRG1|organism=Schmidtea mediterranea sexual|type=transcript|length=4604bp
AATCTATATAAATCTTATATGGTGTAAAATCTTCGAATAATTAAGCAAGA
AAGTACCAGTCAATAATGTATGCAAACAACAATGGTTTTGGTCCAAATCA
ACCAATGTCTGCTTCTCCAGCTACTTGTTCTAATATTCAAGTTATAAATG
CACCTATTAATAATCCTATAACGTCTATGCAAATTCCAAATCAAATTAAT
TCTAACGTCAATTCTGGTAACTATATGCCGCCTGTAAACAATCTTCCCCA
AAATTCCATGCAGCCCGAACCTAGCCCAGCTTCTCAACCACCTGTTCCTA
ATAAAGGAATTTTTGATAACAATCAATTATTGCAACTACGTGCGCAAATT
AATGCTTATAAATTACTAGCAAAGTCCAATCCGGTATCAAATGCAGTTAT
AATGGCAGCTGAAGGTAAACTTAATCAGTTACAAAATATATCAAATCGAC
AAGCTGATCCAGCAACGACTACGAACTCTAATAATAATGATGTTTTACAA
AGGGTTCAGAGAGATATTAAAGCATCATGCGGTAAAACTTTATTTAAGCA
AGCTAGAAGACCAGAAGCATTAGATCCAGAAGAGTTGTTGAGGGAACGTG
AAAATAGAATTGAAGCTAGAATAATACAAAGAATAGATGAATTGACAAAC
AAATCAGCATTTCTATCAAATTCACAAAATATGAATCTCAAAATTGAGTT
AAAGGCATTACGGTTGTTGGGTTTGCAAAGAAGTTTAAGACAAGAAATAT
TAAATGTAATGAAAAAAGACACGTCATTAGAAACAGCGTTAAATGTGCGA
GCATATCGTCGACCTAAGAAACAAACTCTTAGAGAAGCACGATTTACAGA
AAAGTTGGAAAAGCAAATGAAACACGAACAAGAAAAACGTCGCCGCCAAA
AGCATCAAGAATTTCTCAATGCTGTTTTATTGCACGCAAAAGAATTCAGA
GAATTCCATAGAAATTGCAACTCAAAATCAAACAAAGTCAATCGAGGAAT
CATGAATTATTTTGCAAACACAGAACGCGACAAACGTAAAGAACAAGAGC
GATTAGAACGAGAAAGAATGAGAAGATTAATGGCTGAAGATGAAGAGGGA
TACAGAAAACTAATTGATGAAAAGAAAGATATGCGATTGCATTATTTATT
GCAACAAACCGATGAATTTATTGCTGGTCTAACAAAATTGGTTAAAGACC
ACAAGAAAGAACAAATTCATCGTAAAAAGAAAGAAAGAGAGGAAAAGCGA
TCCCAGATGAAGTATGACAGTATAATAGCGTATTTGACACAGAGATTCAA
TAAATCGCAAAACGAATTAAACAATATAACAAGAGACATAATCGCCGGTA
AATTGGAGTCTTATGTCGCATTGCTACCTCAGGATGAGCATATTCCGATA
TTTAATCCAACAACTCGCGAAAGACTCGAGGAAGAATCACCTCAAGCAAA
AAATCTCATTGCCTGGATTAAAGAACACGAAGAATGGCGATTGTCATTGA
AAGACGAACAAGGATTGGAAATATTTCAGGAAGACGAAGAAATGAAAGGC
TATGATGAAGTGTTAGAGGACGACAATGACGATGATGTCCATGTTGGAAC
TGAGGATGATGAGTACAACAAATCCCACATTCAATCGTATTATGCATTGG
CTCACTCACATCACGAGGAAATCAAGGAACAGGCATCGATCTTAATAAAC
GGAACTCTGAAACAGTATCAGTTGAAGGGCCTTGAATGGCTCGTCTCACT
CTACAATAACAATCTCAATGGTATATTGGCTGATGAAATGGGTCTGGGGA
AAACCATCCAGACTATCGGGTTGATAACGTACCTCATGGAACGCAAGAAG
GTCAATGGGCCGTTTCTTATTATTGTTCCGCTATCTACAATGTCAAATTG
GGCAATGGAATTTGAGAAATGGGGACCAAGTGTAAAGAAAATTTTATACA
AAGGTTCTCCTAAAATCCGTAAAGAATTGCAAGCTCAATTGAAAACCTCA
AAATTCAACGTTTTACTCACTACGTATGAATACATTATAAAAGATAAATC
TAGTTTGTCGAAGGTGAAATGGAAATATATGATTATCGACGAAGGACATC
GTATGAAAAATCACCACTGCAAATTAACACAAATATTAAACACCTTCTAT
ATTGCTCCTTACCGGCTGCTATTGACTGGAACACCTTTGCAAAACAAATT
ACCGGAGTTGTGGGCCCTTCTAAATTTCCTGTTGCCGAACATATTCAAAA
GCGTCAATACCTTTGAGCAATGGTTCAATGCTCCGTTTGCATCGAGTGGT
GAAAAAGTGGAATTAAACCAGGAAGAAACTCTATTGATTATTCGTCGATT
GCATAAAGTTCTCAGGCCGTTTCTGTTGAGACGCTTGAAAAAAGAAGTCG
AAAATCAACTGCCGGAAAAAGTCGAATATGTTATCAAGTGTGAAATGTCA
GCGCTACAGAGAAAAGTTTATTCCAATATCCAGTCAAAACGTGCAATTCT
GAAATCTGTGGACAAAGATAAAAAGGGCCGAACCGAGCGGTTGTGGTCCA
ACGTGTTGATGCAACTGAGAAAAATCTGTAATCACCCATATATGTTTCCT
GAGGTGGAAATCGAATATGCAAAGCACGTATTCATGAAAATGCATAACGG
AAATCCGCCACCAAATGTTCCCATTCCCAAAGAGATTCATGGTGCTGATC
TCTATCGAGCATCTGGGAAATTCGAACTGCTCGATCGTATTCTACCGAAA
TTGAAACGGGCCAAGCATCGAGTGTTGATGTTCTGTCAAATGACTCATTT
AATGGATCTGATGGAGCCTTATCTGGAGTATCGATGCTTCAAATATCTCA
GATTGGATGGAACGACTAAATCAGAAGATCGAGGAGACCTGTTATGCGCA
TTTAATAAGCCGAATTCAGAGTTTTTCATCTTCATGCTGTCAACCCGTGC
CGGAGGATTGGGTCTCAATTTGCAATCAGCTGACACCGTTATCATTTTCG
ATTCCGACTGGAATCCGCACCAGGATCTCCAGGCGCAAGATCGAGCTCAT
CGTATCGGTCAGCAGAATGAAGTTCGCGTTCTCAGATTGATCATGATCAA
TTCGATCGAGGAGAAAATCCTAGCGGCTGCCAGATTCAAATTGAATGTCG
ACGAAAAAGTCATCCAAGCGGGAATGTTCGATCAGAAATCCACAGATAAA
GATCGTAAAACCTATCTGAAAGCGCTGTTGGATCAGGATGAATCAGAAGA
CGATGAGGACGAGTGTCCCGATGATGAAACCATCAATCAAATGCTTGCTA
GAAGCGAAGAAGAATTCGAAATCTATCAACGAATGGATATTGAGCGGGAA
TTGGCGGAAAAGAATAAAGCCGTTCATAAGAATCGGCTATTGGTGGCAGA
CGAAATTCCAGAAAATATCGATTATCACGACAGTTTGGACGAGGAGGTCC
AGCAAGTGCAAGACGACTACATCGGAAAGAGGAATCGGAAAGAAGTCGAT
TATTCCGATGCTTTGATGGAGCATGAGTTCTTAAAAGCAATTGACGATGC
AGAAGCCGAAGAAGATGCCGATAACCAGAGAAATCGTAAAATAAAAAGGA
AAAGAAAAATCAATGAAGGAAGCTCAGAAGATGAATCCTCAAAGCCGCCC
GCTCCGACTCCTCCAATCAAACGCGGTCGAGGGCGTCCCCCAGGCAGCCT
AAGCTCTACCCCAAGTGCCCCAATATCGAGTAAACTGATGAAAAGGATGC
AAATGCTTCTCAATATTGTTATCGATTACCGTGATAAGGATGGAAGGATT
CTAAGCGAGCCATTTATGAAGCTTCCATCGCGCAAAGATCTTCCAGACTA
CTATGACATTATCAAGAAACCAATGGACTTTCAGAGAATTCGTCAGCGAT
TGAAGGACAACAAATATCGATCCATTGACGATTTGGAGTCGGATATATTT
GTACTGTGTAAAAATGCTCAAACCTACAACATGGACGGCAGTTTGATATT
TGAAGATTCTATCATTCTCCAGTCAGTTTGGTCGAATGCGCGCGAGAAAC
TAGAAATGATGGAAATCAATGGATCTTCTTCTTCAAAGTCCCACAACAAG
TCCACCAGTAAACCAGATACTCTTAGTGAAATTTGTGAGCAATCAGATAC
GAAAATCAAAGAAGAAGGCGATGAAGAAGACCCTTCCAACGCACTTCAAC
AAGCCACATCAGTTGGTATCGCTCACAAATCAGCTAAAATTCGACCTTTC
GATGACGAGTTATCTCAAGCTTCTGACAGTCTTCCTCCGAGATCCGCTCG
AAAAAGTGTTCATAAGCGACTGAAAAAAGACGAAATGAAAAGTGACGACG
ACGACATTGACGGTGACAATGATGACGACGAGGACGATGTCGATTATTAC
GCAAATTAATCAATTTACAAAACACATATTTCTTCGATATTGATTTTTTA
CTAGCCGAATTTTTTTAGCCGAAAGTAACTCCCGTATTTTGTCTGTAATT
ATATTGAAACATAAATGTCTTATGGAAATTATTAATTTTTATTGATATCG
ATTTTTGTCACGACTGTTATCTTTTAGGTAAATAAATTTTGACTTTCAAA
AAAA
back to top

protein sequence of SMED30024863-orf-1

>SMED30024863-orf-1 ID=SMED30024863-orf-1|Name=SMED30024863-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1448bp
MYANNNGFGPNQPMSASPATCSNIQVINAPINNPITSMQIPNQINSNVNS
GNYMPPVNNLPQNSMQPEPSPASQPPVPNKGIFDNNQLLQLRAQINAYKL
LAKSNPVSNAVIMAAEGKLNQLQNISNRQADPATTTNSNNNDVLQRVQRD
IKASCGKTLFKQARRPEALDPEELLRERENRIEARIIQRIDELTNKSAFL
SNSQNMNLKIELKALRLLGLQRSLRQEILNVMKKDTSLETALNVRAYRRP
KKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRN
CNSKSNKVNRGIMNYFANTERDKRKEQERLERERMRRLMAEDEEGYRKLI
DEKKDMRLHYLLQQTDEFIAGLTKLVKDHKKEQIHRKKKEREEKRSQMKY
DSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTT
RERLEEESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQEDEEMKGYDEVL
EDDNDDDVHVGTEDDEYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQ
YQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPF
LIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVL
LTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYR
LLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVEL
NQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRK
VYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIE
YAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAK
HRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPN
SEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQ
NEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTY
LKALLDQDESEDDEDECPDDETINQMLARSEEEFEIYQRMDIERELAEKN
KAVHKNRLLVADEIPENIDYHDSLDEEVQQVQDDYIGKRNRKEVDYSDAL
MEHEFLKAIDDAEAEEDADNQRNRKIKRKRKINEGSSEDESSKPPAPTPP
IKRGRGRPPGSLSSTPSAPISSKLMKRMQMLLNIVIDYRDKDGRILSEPF
MKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKN
AQTYNMDGSLIFEDSIILQSVWSNAREKLEMMEINGSSSSKSHNKSTSKP
DTLSEICEQSDTKIKEEGDEEDPSNALQQATSVGIAHKSAKIRPFDDELS
QASDSLPPRSARKSVHKRLKKDEMKSDDDDIDGDNDDDEDDVDYYAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037259BRK_sf
IPR038718SNF2-like_sf
IPR036427Bromodomain-like_sf
IPR030100BRG1
IPR001487Bromodomain
IPR029295SnAC
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR014012HSA_dom
IPR014978Gln-Leu-Gln_QLQ
IPR027417P-loop_NTPase
IPR000330SNF2_N
IPR018359Bromodomain_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042393histone binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0008094DNA-dependent ATPase activity
GO:0016787hydrolase activity
GO:0016817hydrolase activity, acting on acid anhydrides
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0022008neurogenesis
GO:0035172hemocyte proliferation
GO:0035329hippo signaling
GO:0036335intestinal stem cell homeostasis
GO:0043044ATP-dependent chromatin remodeling
GO:0043974histone H3-K27 acetylation
GO:0045088regulation of innate immune response
GO:0045742positive regulation of epidermal growth factor receptor signaling pathway
GO:0045893positive regulation of transcription, DNA-templated
GO:0048477oogenesis
GO:0048666neuron development
GO:0048813dendrite morphogenesis
GO:0070983dendrite guidance
GO:2000134negative regulation of G1/S transition of mitotic cell cycle
GO:2000648positive regulation of stem cell proliferation
GO:0006338chromatin remodeling
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006909phagocytosis
GO:0007275multicellular organism development
GO:0007406negative regulation of neuroblast proliferation
GO:0007409axonogenesis
GO:0007419ventral cord development
GO:0007474imaginal disc-derived wing vein specification
GO:0007480imaginal disc-derived leg morphogenesis
GO:0007517muscle organ development
GO:0008586imaginal disc-derived wing vein morphogenesis
GO:0008587imaginal disc-derived wing margin morphogenesis
GO:0016569covalent chromatin modification
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0035060brahma complex
GO:0070604PBAF complex
GO:0016514SWI/SNF complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1159..1179
NoneNo IPR availableCOILSCoilCoilcoord: 316..343
NoneNo IPR availableCOILSCoilCoilcoord: 261..281
NoneNo IPR availableCOILSCoilCoilcoord: 377..397
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 783..1029
e-value: 1.4E-175
score: 586.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1356..1372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1334..1447
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1162..1220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1334..1355
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1428..1447
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 165..1378
NoneNo IPR availableCDDcd17996DEXHc_SMARCA2_SMARCA4coord: 545..775
e-value: 1.00434E-159
score: 478.402
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 883..1009
e-value: 1.63704E-53
score: 181.521
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 1275..1293
score: 29.52
coord: 1259..1275
score: 55.75
coord: 1293..1312
score: 30.43
IPR001487BromodomainSMARTSM00297bromo_6coord: 1221..1331
e-value: 1.7E-34
score: 130.6
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 1245..1314
e-value: 7.7E-20
score: 70.8
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 1242..1312
score: 21.483
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 544..736
e-value: 4.7E-41
score: 152.4
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 560..725
score: 25.611
IPR014978Glutamine-Leucine-Glutamine, QLQSMARTSM00951QLQ_2coord: 81..117
e-value: 1.2E-7
score: 41.4
IPR014978Glutamine-Leucine-Glutamine, QLQPFAMPF08880QLQcoord: 83..114
e-value: 6.6E-7
score: 29.0
IPR014978Glutamine-Leucine-Glutamine, QLQPROSITEPS51666QLQcoord: 82..117
score: 13.571
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 914..998
e-value: 1.7E-20
score: 84.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 885..998
e-value: 6.3E-18
score: 65.1
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 888..1055
score: 16.146
IPR014012Helicase/SANT-associated domainSMARTSM00573bromneu2coord: 268..340
e-value: 2.2E-16
score: 70.4
IPR014012Helicase/SANT-associated domainPFAMPF07529HSAcoord: 271..339
e-value: 9.7E-16
score: 57.9
IPR014012Helicase/SANT-associated domainPROSITEPS51204HSAcoord: 268..340
score: 17.992
IPR029295Snf2, ATP coupling domainSMARTSM01314SnAC_2coord: 1092..1156
e-value: 2.4E-6
score: 37.1
IPR029295Snf2, ATP coupling domainPFAMPF14619SnACcoord: 1093..1156
e-value: 2.2E-6
score: 28.2
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 560..844
e-value: 2.3E-72
score: 243.7
IPR037259BRK domain superfamilyGENE3DG3DSA:2.20.28.130coord: 436..480
e-value: 4.0E-5
score: 25.1
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 541..782
e-value: 1.4E-175
score: 586.1
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 1218..1335
e-value: 1.7E-36
score: 126.3
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 1203..1329
IPR030100SWI/SNF complex subunit BRG1PANTHERPTHR10799:SF76TRANSCRIPTION ACTIVATOR BRG1coord: 165..1378
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 1247..1304
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 775..1100
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 524..773