SMED30024852

Overview
NameSMED30024852
Smed IDSMED30024852
Length (bp)2016
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024852 (SMED30024852) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024852 (SMED30024852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024852 (SMED30024852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024852 (SMED30024852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024852SMESG000069801.1 SmedASXL_007381SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024852SMESG000069801.1 dd_Smed_v6_28385_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30024852 vs. TrEMBL
Match: A0A564YQA6 (Bravo_FIGEY domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8748 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.623e-13
Identity = 99/440 (22.50%), Postives = 190/440 (43.18%), Query Frame = 1
Query:  184 SNTHSIQDNEYH--------NVLPNNKLKIYSKVLPKQFDCGI----IALNSSSYDNFQYHYPEMLWHSCYIRDRYEMKVYECLSTRKLQIAFQMNKDYFQYR---NGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIID------PSSVRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLRVL-DLQKKEKHLVNITATNPAGKVQLSGVIEVLDRP----KWKNLSVISLGHNKTQYQ--CEIFEDVFIRLGIRIKYAWIVNDRQISEIGI 1419
            SNT  +QD + +        +V P  +  +     P  F+CG     + L + + D F   Y   +W  C      ++++ +C   R   I      +YF++    NGT+I+     D  P  G+ CT  +  N + S Y  D      P +             +PLY  V +  G    +   L A Y A     V+  W+KDG +I   F  N +   FP +I+    G Y L +      +++YF + V++   PT+K       H+    G    ++ EF+G   +  LLIN ++++  + +  R+++  L   + Y  +++ E+         +++Y   +L  L +      H V++  TN  G V+ + +I VL +P    +  + S +    N+T ++  C+I  ++   +G+R+   W ++ + ++ + +
Sbjct:  165 SNTIEVQDLDSYISAFLKRKSVGPILRGPLVGSSFPVSFECGSSLDNLELPNWAKDTFPAPY---VWAVCESEPGVQLEMRDCYD-RHRPIG-----EYFEHTVLPNGTLIIHDLVKDYRP-LGIICTTNYLYNKVFSVYFQDDDGKGVPFTYIPGTYPGQVIPKSPLYNRVSIRGGWHARDVITLNALYTANPQT-VSASWSKDGGSIPIQFTANRHSLVFPQDIKSSFAGTYVLALKGPY--ETVYFKYEVVIEQPPTVKEA--PPRHLIVSQGNMAQISTEFDGRLSSRSLLINGMQIDTLSSANYRETLRMLGDAFPYIRDLNPEIEFPSE---NSIRYTVRDLTFLPNSPYGSSHTVSMVGTNALGSVRTNTLIRVLPKPEVIRQLSDYSCLEDCFNQTMHRFYCDI--ELAPYVGLRVIKTWELDGQDLARLDL 584          
BLAST of SMED30024852 vs. TrEMBL
Match: A0A0R3TVF5 (Btz domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11790 PE=4 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 4.042e-13
Identity = 98/430 (22.79%), Postives = 191/430 (44.42%), Query Frame = 1
Query:  217 HNVLPNNKLKIYSKVLPKQFDCGI----IALNSSSYDNFQYHYPEMLWHSCYIRDRYEMKVYECLSTRKLQIAFQMNKDYFQY---RNGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYI--IDPSSVRTSNTKDIF--EIL--TPLYTDVYVHQGSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEG------FDINLI-----LLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLRVL-DLQKKEKHLVNITATNPAGKVQLSGVIEVLDRP----KWKNLSVISLGHNKTQYQ--CEIFEDVFIRLGIRIKYAWIVNDRQISEI 1413
            ++V P+ +  +     P  F+CG     + L + + D F   Y   +W  C      ++ + +C    K         +YF++    NGT+I+ +   D  P  G+ CT  +  N + S Y    D   V  + T  ++  +I+  +PLY  + +  G    +   L A Y A    +V+ +WTKDG +I   F    +   FP +I+    G Y L +      + +YF ++V++   PT+K        + +  G    ++AEF+G      F   +      LLIN +E++  + S  R+S+  L   + Y  +++ E+         +++Y   +L  L +      H V++  TN  G V+ + +I VL +P    +  + S +    N+T ++  C+I  ++   +G+R+   W ++ + ++ +
Sbjct:  628 NSVGPSLRGPLIGSSFPMYFECGSSSDSLELPNWAKDTFPAPY---VWAVCESEPGVQLGMRDCYDHHKPI------GEYFEHTVLSNGTLIIHELVKDYRP-LGIICTTNYLHNKIFSAYFQNDDDKGVPFTYTPGVYPNKIIPKSPLYNYISIRGGWHARDVITLNALYTANPQ-NVSAKWTKDGGSIPFQFTATRHSLIFPQDIKFSFAGTYALALEG--PFEPVYFQYDVVITKPPTIKEAPPRYLIVPQ--GNVAQISAEFDGRLTSRNFMATIAVFLQSLLINGMEIDALSSSNYRESLRMLGDAFPYIRDLNPEIEFPSD---NSIRYTVRDLTFLPNSPYGSSHTVSMVGTNALGSVRTNTLIRVLPKPEVIRQLSDYSCLEECFNQTTHRFYCDI--ELAPYVGLRVIKTWELDGQDLARL 1037          
BLAST of SMED30024852 vs. TrEMBL
Match: A0A158QDH3 (Bravo_FIGEY domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3002 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.065e-12
Identity = 98/440 (22.27%), Postives = 190/440 (43.18%), Query Frame = 1
Query:  184 SNTHSIQDNEYH--------NVLPNNKLKIYSKVLPKQFDCGI----IALNSSSYDNFQYHYPEMLWHSCYIRDRYEMKVYECLSTRKLQIAFQMNKDYFQYR---NGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIID------PSSVRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLRVL-DLQKKEKHLVNITATNPAGKVQLSGVIEVLDRP----KWKNLSVISLGHNKTQYQ--CEIFEDVFIRLGIRIKYAWIVNDRQISEIGI 1419
            SNT  +QD + +        +V P  +  +     P  F+CG     + L + + D F   Y   +W  C      ++++ +C   R   I      +YF++    NGT+I+     D  P  G+ CT  +  N + S Y  D      P +             +PLY  + +  G    +   L A Y A     V+  W+KDG +I   F  N +   FP +I+    G Y L +      +++YF + V++   PT+K       H+    G    ++ EF+G   +  LLIN ++++  + +  R+++  L   + Y  +++ E+         +++Y   +L  L +      H V++  TN  G V+ + +I VL +P    +  + S +    N+T ++  C+I  ++   +G+R+   W ++ + ++ + +
Sbjct:  652 SNTIEVQDLDSYISAFLKRKSVGPILRGPLVGSSFPVSFECGSSLDNLELPNWAKDTFPAPY---VWAVCESEPGVQLEMRDCYD-RHRPIG-----EYFEHTVLPNGTLIIHDLVKDYRP-LGIICTTNYLYNKVFSVYFQDDDGKGVPFTYIPGTYPGQVIPKSPLYNRISIRGGWHARDVITLNALYTANPQT-VSASWSKDGGSIPIQFTANRHSLVFPQDIKSSFAGTYVLALKGPY--ETVYFKYEVVIEQPPTVKEA--PPRHLIVSQGNMAQISTEFDGRLSSRSLLINGMQIDTLSSANYRETLRMLGDAFPYIRDLNPEIEFPSE---NSIRYTVRDLTFLPNSPYGSSHTVSMVGTNALGSVRTNTLIRVLPKPEVIRQLSDYSCLEDCFNQTMHRFYCDI--ELAPYVGLRVIKTWELDGQDLARLDL 1071          
BLAST of SMED30024852 vs. TrEMBL
Match: A0A158R937 (Bravo_FIGEY domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6594 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.574e-12
Identity = 95/415 (22.89%), Postives = 176/415 (42.41%), Query Frame = 1
Query:  247 IYSKVLPKQFDCGI----IALNSSSYDNFQYHYPEMLWHSCYIRDRYEMKVYECLSTRKLQIAFQMNKDYFQYR---NGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIIDPSSVRTSNTKDI-FEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLD-----------VTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLR-VLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPK-WKNLSVIS-----LGHNKTQYQCEIFEDVFIRLGIRIKYAWIVNDRQISEI 1413
            I     P   +CG     + L + +   F   Y    W +C      ++++ +C   R   IA     +YF++    NGT+I+     D  P  G+ CT     N + S Y  D      ++ K + F  +   Y D  + + S  HN+ +L  G+ AR  +            V+  WTKD  ++   F  N +   FP +I+  + G+Y L++        + F + VIV   PT++       HI    G    + A+F G   +  LLIN ++++  +    R+S+  L+  + Y  +++ E+        T+++Y   +L    +      H+V +  TN  G V+ + +I VL +P   + LS  S       H   ++ C+I  ++    G+R+   W ++ + +  +
Sbjct:  137 IVGSSFPMSLECGGSMDHVELPNWAKQTFPVPYD---WVACEAEADSQLEIRKCYD-RSRSIA-----EYFEHTVLPNGTLIIHDLVKDWRP-IGILCTTSIVRNKIFSAYFQD------NDGKAVPFTYIPGTYPDQIIPR-SPQHNRVELRGGWHARDIITLNAFYTANPKTVSTTWTKDDSSLPIQFTSNRHSLVFPQDIKPSYAGMYVLSLENPHG--QLRFEYEVIVEQPPTIEEA--PPRHIIVPQGNQAQVIAKFSGRLTSRSLLINGIQIDAVSPVRYRESLRLLQESFPYMGDLNPEIEFPSD---TSIRYTVRDLAFAPNSPYGSSHIVTMVVTNALGSVRTNTLIRVLPKPDVIRQLSDYSCVEDCFNHTTHRFYCDI--EMAPYTGLRVVKTWELDGQDLERL 525          
BLAST of SMED30024852 vs. TrEMBL
Match: A0A0R3X0N7 (Bravo_FIGEY domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS6697 PE=4 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 3.624e-12
Identity = 95/415 (22.89%), Postives = 175/415 (42.17%), Query Frame = 1
Query:  247 IYSKVLPKQFDCGI----IALNSSSYDNFQYHYPEMLWHSCYIRDRYEMKVYECLSTRKLQIAFQMNKDYFQYR---NGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIIDPSSVRTSNTKDI-FEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLD-----------VTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLR-VLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPK-WKNLSVIS-----LGHNKTQYQCEIFEDVFIRLGIRIKYAWIVNDRQISEI 1413
            I     P   +CG     + L + +   F   Y    W +C      ++ +  C   R   IA      YF++    NGT+I+     D  P  G+ CT     N + S Y  D      ++ K + F  +   Y +  + + S   N+  L +G+ AR  +            VT  WTKD  ++   F  N +   FP +I+  + G+Y L++ +    + + F + VIV   PT+K       HI    G    + A+F G   +  LLIN ++++  + +  R+S+  L+  + Y  +++ E+        ++++Y   +L    +      H+V +  TN  G V+ + +I VL +P   + LS  S       H   ++ C+I  +V    G+R+   W ++ + +  +
Sbjct:  185 IVGSSFPMSLECGGYMDHVELPNWAKQTFPVPYD---WVACEAEADSQLDIRMCYD-RSRSIA-----GYFEHTVLPNGTLIIHDLVKDWRP-IGILCTTSIVRNKIFSAYFQD------NDGKAVPFTYIPGTYPNQIIPR-SPQDNRVALRSGWHARDTITLNAFYTANPKTVTAMWTKDDSSLPIQFTSNRHSLVFPQDIKPTYAGLYVLSLKSPH--EQLLFKYEVIVEQPPTIKEA--PPRHIIIPQGNQAQVIADFSGGLTSRSLLINGIQIDVVSSARYRESLRLLQESFPYVGDLNPEIEFPSD---SSIRYTVRDLAFAPNSPYGSSHIVTMVVTNALGSVRTNTLIRVLPKPDVIRQLSDYSCVEDCFNHTTHRFYCDI--EVAPYTGLRVVKTWELDGQDLERL 573          
BLAST of SMED30024852 vs. Planmine SMEST
Match: SMESG000069801.1 (SMESG000069801.1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 378/402 (94.03%), Postives = 384/402 (95.52%), Query Frame = 1
Query:  379 MKVYECLSTRKLQIAFQMNKDYFQYRNGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIIDPSSVRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLRVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPKWKNLSVISLGHNKTQYQCEIFEDVFIRLGIRIKYAWIVNDRQISEIGIINASYKVNSTKLILYSFSDSKTFNITCEVTLLDPTVNSTVIYSMRQIFSRNNTQA 1584
            MKV ECLS R++QIAFQMNKDYFQYRNGTIILS QFIDNHPKFGL CTLQHDPNTLLSQY+ID SSVRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNE FFPDEIEI HHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLRVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLD PKWK LSVISLGHNKTQYQCEIFEDVFIRLGIRI+YAWIVNDR ISEIGI+NASY VN TKLILYSFSDSKTFNITCEVTLL+     TVIYSMR IFSRNNTQA
Sbjct:    1 MKVSECLSNRQIQIAFQMNKDYFQYRNGTIILSHQFIDNHPKFGLLCTLQHDPNTLLSQYMIDLSSVRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNELFFPDEIEIRHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNLRVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDPPKWKILSVISLGHNKTQYQCEIFEDVFIRLGIRIEYAWIVNDRPISEIGILNASYMVNRTKLILYSFSDSKTFNITCEVTLLE-----TVIYSMRHIFSRNNTQA 397          
BLAST of SMED30024852 vs. Planmine SMEST
Match: SMESG000064379.1 (SMESG000064379.1)

HSP 1 Score: 102.449 bits (254), Expect = 3.219e-22
Identity = 107/414 (25.85%), Postives = 188/414 (45.41%), Query Frame = 1
Query:  223 VLPNNKLKIYSKVLPKQFDCGIIALNSSSYDNFQYHYPEMLWHSC--YIRDRYEMKVYECLSTRKLQIAFQMNKDYF---QYRNGTIILSQQFIDNHPKFGLFCTLQ-HDPNTLLSQYIIDPSS-------VRTSNTKDIFEILTPLYTDVYVHQGSVPHN-QYKLLAGYRARKD-LDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDF--NLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNL-RVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPKW----KNLSVISLGHNKTQ--YQCEIFEDVFIRLGIRIKYAWIVN 1392
            +L  N +  Y K +PK  +          YD F     ++ W  C  + R+R       CL   +    F   +D+F   Q+ NG+I+L      ++ + GL C++   D    LS+Y     +          ++ +   + LT    ++   +G   +  ++KL A Y +  D   + Y+W KD   + S F    +E  FP EI     G+Y+LTVS ++   +  F + V +   P LK    ST     +  +DF   L+  FE    NL L IN++ ++  +++ K   + RL  KY + + +    N SV      ++Y+  NL + L+  + + H+V   A NP G  ++S +I +L+ PK+    K+ S I+   N+ +  ++C I E  + ++G   KY W +N
Sbjct:  202 ILCCNAILKYEKNVPKWLN----------YDLFS---QQLEWRFCRPFHRNR------RCLMNNEANYTFL--EDFFHCYQFPNGSIVLMGLKRTDYRESGLLCSIDTSDDPQYLSEYFFKNETRWQYIYYYALNSYRRKIKFLTETDFNITTREGIYDNKTRFKLYALYVSNPDPKSIAYEWRKDNARLPSTFTGTSHELLFPIEIYDSDSGLYELTVSQSKPPDNATFRYKVTISCPPKLK--DRSTRPSVIYSLDDFFPRLSLSFERDITNLSLEINNIPIDVLSETNKENDLKRLFLKYEFLTGIDISANISVSQ--GLIEYEVKNLTKNLNTSEGKTHIVTFIAENPTGVSKISYLIRILENPKFIHYLKDFSCINNCSNQDKHIFKCAIEELEYKKIGFLTKYVWSLN 590          
BLAST of SMED30024852 vs. Planmine SMEST
Match: SMESG000064379.1 (SMESG000064379.1)

HSP 1 Score: 102.064 bits (253), Expect = 3.409e-22
Identity = 107/414 (25.85%), Postives = 188/414 (45.41%), Query Frame = 1
Query:  223 VLPNNKLKIYSKVLPKQFDCGIIALNSSSYDNFQYHYPEMLWHSC--YIRDRYEMKVYECLSTRKLQIAFQMNKDYF---QYRNGTIILSQQFIDNHPKFGLFCTLQ-HDPNTLLSQYIIDPSS-------VRTSNTKDIFEILTPLYTDVYVHQGSVPHN-QYKLLAGYRARKD-LDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDF--NLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNL-RVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPKW----KNLSVISLGHNKTQ--YQCEIFEDVFIRLGIRIKYAWIVN 1392
            +L  N +  Y K +PK  +          YD F     ++ W  C  + R+R       CL   +    F   +D+F   Q+ NG+I+L      ++ + GL C++   D    LS+Y     +          ++ +   + LT    ++   +G   +  ++KL A Y +  D   + Y+W KD   + S F    +E  FP EI     G+Y+LTVS ++   +  F + V +   P LK    ST     +  +DF   L+  FE    NL L IN++ ++  +++ K   + RL  KY + + +    N SV      ++Y+  NL + L+  + + H+V   A NP G  ++S +I +L+ PK+    K+ S I+   N+ +  ++C I E  + ++G   KY W +N
Sbjct:  206 ILCCNAILKYEKNVPKWLN----------YDLFS---QQLEWRFCRPFHRNR------RCLMNNEANYTFL--EDFFHCYQFPNGSIVLMGLKRTDYRESGLLCSIDTSDDPQYLSEYFFKNETRWQYIYYYALNSYRRKIKFLTETDFNITTREGIYDNKTRFKLYALYVSNPDPKSIAYEWRKDNARLPSTFTGTSHELLFPIEIYDSDSGLYELTVSQSKPPDNATFRYKVTISCPPKLK--DRSTRPSVIYSLDDFFPRLSLSFERDITNLSLEINNIPIDVLSETNKENDLKRLFLKYEFLTGIDISANISVSQ--GLIEYEVKNLTKNLNTSEGKTHIVTFIAENPTGVSKISYLIRILENPKFIHYLKDFSCINNCSNQDKHIFKCAIEELEYKKIGFLTKYVWSLN 594          
BLAST of SMED30024852 vs. Planmine SMEST
Match: SMESG000064374.1 (SMESG000064374.1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.288e-21
Identity = 95/409 (23.23%), Postives = 178/409 (43.52%), Query Frame = 1
Query:  439 DYFQYRNGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIIDPSS----------VRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKD-LDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNL-RVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPKWK------NLSVISLGHNKTQYQCEIFEDVFIRLGIRIKYAWIVNDRQISEIG---IINASYKVNST---------------KLILYSFSDSKTFNITCEVTLLDPTVNSTVIYSMRQ 1557
            DY+Q+ NGT +L     +++ K GLFC L+     + S Y++   +          V   N K   + L+   T++ + +G    +++KL A Y    D   +  +W KD +++ S F++   +  FP EI   + G Y L +  +E   ++ F +NV V+ +P LK  +      +    +   ++  FE     L L +N++ ++  T   K +S+  L  K+ + + +    N S+      + Y+  NL +  +  + + H V   A N  G  ++S +I V + P +       N +   +   +  ++C I E  + + G  IKY W +N   +  +     I +  +VN+                K +L  FS S   N++C V ++  +  S   YS  Q
Sbjct:  268 DYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKK--IKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNE--GMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKS---NLSCRVDIVPTSNPSETFYSTDQ 669          
BLAST of SMED30024852 vs. Planmine SMEST
Match: SMESG000064374.1 (SMESG000064374.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.650e-21
Identity = 95/409 (23.23%), Postives = 178/409 (43.52%), Query Frame = 1
Query:  439 DYFQYRNGTIILSQQFIDNHPKFGLFCTLQHDPNTLLSQYIIDPSS----------VRTSNTKDIFEILTPLYTDVYVHQGSVPHNQYKLLAGYRARKD-LDVTYQWTKDGFAIDSNFERNGNEFFFPDEIEIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPGEDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNMSFEMNKSVGTYFTAVQYQTTNL-RVLDLQKKEKHLVNITATNPAGKVQLSGVIEVLDRPKWK------NLSVISLGHNKTQYQCEIFEDVFIRLGIRIKYAWIVNDRQISEIG---IINASYKVNST---------------KLILYSFSDSKTFNITCEVTLLDPTVNSTVIYSMRQ 1557
            DY+Q+ NGT +L     +++ K GLFC L+     + S Y++   +          V   N K   + L+   T++ + +G    +++KL A Y    D   +  +W KD +++ S F++   +  FP EI   + G Y L +  +E   ++ F +NV V+ +P LK  +      +    +   ++  FE     L L +N++ ++  T   K +S+  L  K+ + + +    N S+      + Y+  NL +  +  + + H V   A N  G  ++S +I V + P +       N +   +   +  ++C I E  + + G  IKY W +N   +  +     I +  +VN+                K +L  FS S   N++C V ++  +  S   YS  Q
Sbjct:  267 DYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKK--IKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNE--GMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKS---NLSCRVDIVPTSNPSETFYSTDQ 668          
The following BLAST results are available for this feature:
BLAST of SMED30024852 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YQA62.623e-1322.50Bravo_FIGEY domain-containing protein OS=Hymenolep... [more]
A0A0R3TVF54.042e-1322.79Btz domain-containing protein OS=Rodentolepis nana... [more]
A0A158QDH31.065e-1222.27Bravo_FIGEY domain-containing protein OS=Hymenolep... [more]
A0A158R9371.574e-1222.89Bravo_FIGEY domain-containing protein OS=Taenia as... [more]
A0A0R3X0N73.624e-1222.89Bravo_FIGEY domain-containing protein OS=Hydatigen... [more]
back to top
BLAST of SMED30024852 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024852 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069801.10.000e+094.03SMESG000069801.1[more]
SMESG000064379.13.219e-2225.85SMESG000064379.1[more]
SMESG000064379.13.409e-2225.85SMESG000064379.1[more]
SMESG000064374.12.288e-2123.23SMESG000064374.1[more]
SMESG000064374.12.650e-2123.23SMESG000064374.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024852 ID=SMED30024852|Name=SMED30024852|organism=Schmidtea mediterranea sexual|type=transcript|length=2016bp
TGCCAAAATTTGAATTTAGGTTAATTTTTATAGCTCTATATATTAAATAT
GAGATTCTATTTTCATATAACGATAATTTTTATATTACTTCACAATTTTG
GCGTAGTATCATGTACTAATTCAACAAACTATTTAAAGTTTATTCCATCA
AATTTAAGTTTTGAAGCTCCCTTATTACCAGTATCTAATACACATTCAAT
ACAAGATAATGAATATCATAATGTACTTCCAAATAACAAATTAAAAATCT
ATTCAAAAGTGCTACCCAAGCAGTTTGATTGTGGAATTATTGCGTTGAAC
AGCTCGAGTTATGACAATTTTCAATACCATTATCCCGAAATGTTGTGGCA
CAGTTGCTACATTCGTGACCGATATGAAATGAAGGTTTATGAATGTTTGT
CAACTCGGAAATTACAGATTGCATTCCAAATGAATAAAGATTACTTTCAA
TATCGGAACGGAACAATTATTTTGTCACAGCAATTTATTGACAACCATCC
GAAATTCGGATTATTTTGCACTTTGCAACATGATCCAAATACATTATTAT
CTCAATACATAATTGATCCCTCATCAGTTAGAACTTCAAATACAAAGGAC
ATATTTGAAATACTAACGCCTCTTTATACAGATGTTTATGTCCATCAGGG
TTCGGTACCTCACAACCAATATAAGCTTCTTGCTGGATATCGCGCACGTA
AGGATTTAGATGTTACATATCAATGGACCAAAGACGGATTTGCCATAGAT
TCAAATTTTGAAAGAAATGGCAATGAATTCTTTTTCCCAGATGAAATAGA
AATATGGCATCACGGAATATATAAGCTGACAGTATCAACAACTGAGTCTG
GGAAAAGTATTTATTTTACTTTCAATGTTATCGTTATTGGGACTCCAACA
TTAAAATTTGGAGTTAATTCGACTTTTCATATTTTCAAATTTCCAGGAGA
AGATTTTAATTTAACTGCTGAATTTGAAGGATTTGATATAAATTTGATCC
TTCTTATTAATGACGTGGAAATGAATTTCCAAACTCAAAGTTTAAAAAGA
CAAAGTATAGACAGATTAAAAGCCAAATATAATTACTTTTCAAATATGTC
ATTTGAAATGAATAAATCTGTCGGGACATATTTTACTGCAGTCCAATACC
AGACGACAAATTTGCGTGTTCTTGACCTGCAAAAGAAAGAGAAACATTTA
GTGAACATAACTGCCACAAACCCTGCTGGAAAAGTGCAATTGAGTGGAGT
TATTGAAGTGTTGGATCGACCGAAGTGGAAGAATTTGTCTGTTATTTCTC
TCGGCCACAACAAAACTCAATATCAATGCGAAATATTTGAAGACGTGTTC
ATTAGACTAGGAATCCGCATTAAATACGCATGGATAGTGAATGATCGCCA
AATCAGTGAAATTGGGATTATAAATGCTTCATATAAGGTTAACAGCACAA
AACTAATTTTATATTCATTTTCCGATTCGAAAACTTTTAATATTACTTGC
GAAGTTACATTATTGGATCCAACTGTCAACTCAACGGTAATATATTCAAT
GCGTCAAATATTCTCTCGAAATAATACACAAGCAGACTCGCCTTTTACTT
CTAACGTATTAATAATCATATTAATATTCGTGGCTGTGATCATCATCATC
ATCATTGTGCTCATCTTCATTTACTTCAAACCATTATCAGTGATGACTAA
ATTGTGGAAAAAACACGAATCCGGGCCAAATACGCCAAATACGTCAAATC
CTAGGTATTCAGGTCTTTCTACAAATGCGGATTCTATAGGTTCTCCTACG
TGTGCAGTTGTGTATCAAAGTCCGTTATTTCAATTGTTGTGAAATTCGTA
ACATTCTCATCAAGTCAAAAATCTAAATTTTATAAAATTTATTGCTTTAA
TATTTCTGAATTAATATAATCCTGAATTCATATCATTTTTTTTATGACTT
TGTATTTTCTCATTTTTGAATTTGATAACTTATTTTACATTTCGTATCAG
ATAATTACATTTCGAT
back to top

protein sequence of SMED30024852-orf-1

>SMED30024852-orf-1 ID=SMED30024852-orf-1|Name=SMED30024852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=598bp
MRFYFHITIIFILLHNFGVVSCTNSTNYLKFIPSNLSFEAPLLPVSNTHS
IQDNEYHNVLPNNKLKIYSKVLPKQFDCGIIALNSSSYDNFQYHYPEMLW
HSCYIRDRYEMKVYECLSTRKLQIAFQMNKDYFQYRNGTIILSQQFIDNH
PKFGLFCTLQHDPNTLLSQYIIDPSSVRTSNTKDIFEILTPLYTDVYVHQ
GSVPHNQYKLLAGYRARKDLDVTYQWTKDGFAIDSNFERNGNEFFFPDEI
EIWHHGIYKLTVSTTESGKSIYFTFNVIVIGTPTLKFGVNSTFHIFKFPG
EDFNLTAEFEGFDINLILLINDVEMNFQTQSLKRQSIDRLKAKYNYFSNM
SFEMNKSVGTYFTAVQYQTTNLRVLDLQKKEKHLVNITATNPAGKVQLSG
VIEVLDRPKWKNLSVISLGHNKTQYQCEIFEDVFIRLGIRIKYAWIVNDR
QISEIGIINASYKVNSTKLILYSFSDSKTFNITCEVTLLDPTVNSTVIYS
MRQIFSRNNTQADSPFTSNVLIIILIFVAVIIIIIIVLIFIYFKPLSVMT
KLWKKHESGPNTPNTSNPRYSGLSTNADSIGSPTCAVVYQSPLFQLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 515..537