Nudix hydrolase domain-containing protein

Overview
NameNudix hydrolase domain-containing protein
Smed IDSMED30024846
Length (bp)1156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nudix hydrolase domain-containing protein (SMED30024846) t-SNE clustered cells

Violin plots show distribution of expression levels for Nudix hydrolase domain-containing protein (SMED30024846) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nudix hydrolase domain-containing protein (SMED30024846) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nudix hydrolase domain-containing protein (SMED30024846) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024846

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024846SMESG000064369.1 SmedASXL_011359SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30024846SMESG000064369.1 dd_Smed_v4_11761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024846SMESG000064369.1 dd_Smed_v6_11761_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: CG12567 (gene:FBgn0039958 transcript:FBtr0344847)

HSP 1 Score: 199.134 bits (505), Expect = 2.293e-60
Identity = 116/283 (40.99%), Postives = 161/283 (56.89%), Query Frame = 2
Query:  116 IVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDT--HNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKH---GNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDD 949
            I+++K NN  +SG        F V    VG+I  +V K+L ++P+VF         + ++++ P    + E++  + KV   LR      AL+ WR+EY+ V  + R  ALLK+ERAA+ L GV KYGV +NGY   +H   G C  +W+ QRS TK T+PG  DNM GGGL+  + + + A  E  EEAS+P DL+  L S G +S +FE  +G+ P   Y +DL LP  F P N+DGEV  F  +   +         FK TSA V+IDFLIRHG IT DD
Sbjct:   13 ILAQKFNNFYLSGIHKCDIRPFVVEGKQVGLIKSDVLKHLEKYPEVFCIRACEQTKQGLVELNPAFRDYNERTEQLEKVLRNLRSEGLFPALQGWRDEYFEVKADCR--ALLKMERAATPLFGVRKYGVDINGYV--RHPTLGLC--IWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFELLTAKDCVERVFTSDFKTTSAPVVIDFLIRHGHITADD 289          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: CG12567 (gene:FBgn0039958 transcript:FBtr0113704)

HSP 1 Score: 199.134 bits (505), Expect = 2.293e-60
Identity = 116/283 (40.99%), Postives = 161/283 (56.89%), Query Frame = 2
Query:  116 IVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDT--HNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKH---GNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDD 949
            I+++K NN  +SG        F V    VG+I  +V K+L ++P+VF         + ++++ P    + E++  + KV   LR      AL+ WR+EY+ V  + R  ALLK+ERAA+ L GV KYGV +NGY   +H   G C  +W+ QRS TK T+PG  DNM GGGL+  + + + A  E  EEAS+P DL+  L S G +S +FE  +G+ P   Y +DL LP  F P N+DGEV  F  +   +         FK TSA V+IDFLIRHG IT DD
Sbjct:   13 ILAQKFNNFYLSGIHKCDIRPFVVEGKQVGLIKSDVLKHLEKYPEVFCIRACEQTKQGLVELNPAFRDYNERTEQLEKVLRNLRSEGLFPALQGWRDEYFEVKADCR--ALLKMERAATPLFGVRKYGVDINGYV--RHPTLGLC--IWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFELLTAKDCVERVFTSDFKTTSAPVVIDFLIRHGHITADD 289          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: CG12567 (gene:FBgn0039958 transcript:FBtr0300704)

HSP 1 Score: 193.356 bits (490), Expect = 3.224e-58
Identity = 112/277 (40.43%), Postives = 156/277 (56.32%), Query Frame = 2
Query:  179 FFVGSYHVGIILPEVAKYLLQFPDVFITDT--HNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKH---GNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKL 994
            F V    VG+I  +V K+L ++P+VF         + ++++ P    + E++  + KV   LR      AL+ WR+EY+ V  + R  ALLK+ERAA+ L GV KYGV +NGY   +H   G C  +W+ QRS TK T+PG  DNM GGGL+  + + + A  E  EEAS+P DL+  L S G +S +FE  +G+ P   Y +DL LP  F P N+DGEV  F  +   +         FK TSA V+IDFLIRHG IT DD   ++     +H  L
Sbjct:   26 FVVEGKQVGLIKSDVLKHLEKYPEVFCIRACEQTKQGLVELNPAFRDYNERTEQLEKVLRNLRSEGLFPALQGWRDEYFEVKADCR--ALLKMERAATPLFGVRKYGVDINGYV--RHPTLGLC--IWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFELLTAKDCVERVFTSDFKTTSAPVVIDFLIRHGHITADDVVDFTQIVELLHVPL 296          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: CG12567 (gene:FBgn0039958 transcript:FBtr0300702)

HSP 1 Score: 192.971 bits (489), Expect = 3.578e-58
Identity = 110/262 (41.98%), Postives = 151/262 (57.63%), Query Frame = 2
Query:  179 FFVGSYHVGIILPEVAKYLLQFPDVFITDT--HNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKH---GNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDD 949
            F V    VG+I  +V K+L ++P+VF         + ++++ P    + E++  + KV   LR      AL+ WR+EY+ V  + R  ALLK+ERAA+ L GV KYGV +NGY   +H   G C  +W+ QRS TK T+PG  DNM GGGL+  + + + A  E  EEAS+P DL+  L S G +S +FE  +G+ P   Y +DL LP  F P N+DGEV  F  +   +         FK TSA V+IDFLIRHG IT DD
Sbjct:   20 FVVEGKQVGLIKSDVLKHLEKYPEVFCIRACEQTKQGLVELNPAFRDYNERTEQLEKVLRNLRSEGLFPALQGWRDEYFEVKADCR--ALLKMERAATPLFGVRKYGVDINGYV--RHPTLGLC--IWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFELLTAKDCVERVFTSDFKTTSAPVVIDFLIRHGHITADD 275          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Match: tpk2 (thiamin pyrophosphokinase 2 [Source:ZFIN;Acc:ZDB-GENE-060503-173])

HSP 1 Score: 224.557 bits (571), Expect = 1.287e-70
Identity = 125/303 (41.25%), Postives = 169/303 (55.78%), Query Frame = 2
Query:   86 MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKL 994
            M + +E++  ++ ++ NN  + GS L  C  F V    VG I P+VA  L +FP VF        + I    +L TF  +S AV +V   LR   +   L  WR+E Y V        L+ +ERAA++L GV +YGVHVNGYT D  GN   MW+ +RSLTK TYPG +DNMA GGL     V      EC+EEA +P  L    + VGT+S  +ED  G+ PE  + +DL LP +F+P   DGEV  F      ++K L V E FKP  A+V++DFLIRH  I PD +P+Y  +   +H  L
Sbjct:    1 MASWSEKMLQLL-RRMNNFHLPGSILESCLRFEVAGEQVGWISPKVASVLGRFPSVF----RPYGSAITFCSSLDTFASRSVAVDEVLQELRREASFTCLIGWRDEQYAVMPRYCDPPLMYMERAATSLFGVKRYGVHVNGYTRDSSGNLN-MWLARRSLTKQTYPGRLDNMAAGGLAAGCSVRHTMVKECEEEACIPPGLAEQARPVGTVSYTYEDDEGIFPECQFVFDLELPLNFQPHIGDGEVQAFYYYPIEKVKDLLVSEEFKPNCAMVVLDFLIRHAIIEPDSEPYYHEFVAGLHRSL 297          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|P47173|YJ9J_YEAST (Uncharacterized protein YJR142W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJR142W PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 4.332e-42
Identity = 94/295 (31.86%), Postives = 150/295 (50.85%), Query Frame = 2
Query:  167 MCTHFFVGSYHVGIILPEVAKYLLQ-----FPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLL----------AYLKSVGTLSL--FFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPF 1000
            MCTH       +G +L      +       F + F  D   +E   K +     F+ ++  + ++   +   ++L+ +K WRNE Y V+V  +   L  VERA + +LG++ YG+H+NGY +D        W+ +RS TK T+P ++DN+  GGL + Y + +    E  EEA++   ++          +YL   G +S+  F ++   +  EV Y YDL L     P  +DGEV  F      E  +    + FKP  ALV++DFLIRHG+ITP+++P+Y      MH +LPF
Sbjct:   53 MCTH---DGTKIGFVLKFAINEMETVCSEIFEETFQLDESRHELRFKSE----DFDHRNNLIDQLARKMYLESSLSGVKGWRNEKYAVWVNKKPYVL--VERAVAGVLGIITYGIHINGYVLDPKSKKVQFWVPRRSKTKQTWPLMLDNIIAGGLGYPYGIYETVLKESMEEANLEKSVIEDNIKATGSVSYLYFTGDISVTKFNKESDFIVGEVQYVYDLKLSEDIIPKPNDGEVESFNLFSLQETINALRKKEFKPNCALVMVDFLIRHGYITPENEPNYLELVTRMHRRLPF 338          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C026|NUD24_ARATH (Nudix hydrolase 24, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT24 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.030e-41
Identity = 98/283 (34.63%), Postives = 142/283 (50.18%), Query Frame = 2
Query:  128 KCNNAIIS-GSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDER-FKPTSALVLIDFLIRHGFITPDDDPHYSAY 970
            +CN  +   G  +P    F +    VG I     KYL  F D+F    +     + +   L   EE++ AVA V  IL    N   +   RNE Y V     + A   +ERAA+   G+  Y +HVNGY V++ G  +++WIG+RSL K TYPG +D++  GGL     V +    EC+EEA +   L     +VG +S    D      +V++CYDL LP  F P N DGEV  F  +  +++ ++      FK + +LV+IDFL RHG I P+   +   Y
Sbjct:   85 RCNRGLEKLGEFIP----FVIEEQIVGYIHKGFTKYLRDFNDIFTFSQYGGHVTLNMM--LDKPEERTRAVAHVIKIL---GNKGIIPGIRNELYPVKPSFNAPAFFSIERAAAPYFGLKGYAIHVNGY-VERDGQ-KFLWIGKRSLAKSTYPGKLDHLVAGGLPHGISVCENLVKECEEEAGISKVLADRAIAVGVVSYMDIDRYCFTRDVLFCYDLELPQDFVPTNQDGEVDSFRLIPVAQVANVVRKTSFFKDSCSLVIIDFLFRHGLIRPESPGYLDLY 356          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VXZ0|NUD20_ARATH (Nudix hydrolase 20, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT20 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 5.204e-39
Identity = 93/273 (34.07%), Postives = 140/273 (51.28%), Query Frame = 2
Query:  179 FFVGSYHVGIILPEVAKYLLQFPDVFITDTHNN-----ETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARN---ECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDER-FKPTSALVLIDFLIRHGFITPDDDPHYSAY 970
            F +    VG I     +YL +F D+F    + +     +  + +   L   E+++ AVA V  IL D   +  +   RNE Y V     +     +ERAA+   G+  YGVH+NGY V++ G  + +WIG+RSL+K TYPG++D++  GGL      + C  N   EC+EEA +   +     +VG +S    D      +V++CYDL LP  F P N DGEV  F  +  +++  +      FK   +LV+IDFL RHGFI P+   +   Y
Sbjct:  101 FVIEEQIVGYIHKRFTEYLREFHDIFTFSQNGSCPDRVDGYVTLNLMLQKPEDRTRAVADVIKILGDKGIIPGI---RNELYPVKPSFNAPVFFSLERAAAPYFGIKGYGVHMNGY-VERDGQ-KLLWIGKRSLSKSTYPGMLDHLVAGGLPHG---ISCGGNLVKECEEEAGISRAIADRAIAVGAVSYLDIDQYCFKRDVLFCYDLELPEDFVPKNQDGEVESFKLIPVAQVASVIKKTSFFKANCSLVIIDFLFRHGFIRPESSGYLDLY 365          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|P41888|TNR3_SCHPO (Thiamine pyrophosphokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tnr3 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.530e-30
Identity = 90/284 (31.69%), Postives = 137/284 (48.24%), Query Frame = 2
Query:  149 SGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLS-LFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLP 997
            +G  +P    F      +G + P V + L++  +      +     I+I  N STFE+++  +AKV    R          WRNE Y V+ +++ K +L VER    L G +  GVH   Y      +   +W+ +RS TK T+P  +DN   GG+     V+     E  EEA++ +  +  L   GT+S +  E    + PE+ Y +DL +     P  +DGEV+ F  +  +++ H    + FKP  ALVL+DFLIRHG ITP   P Y      +H  LP
Sbjct:   25 NGEFVPGTIPFRANGAAIGYVTPLVLEILIKADNFKFNWVYVPGEYIEI--NASTFEKRTDILAKVLEHWRHNNTFGIADQWRNELYTVYGKSK-KPVLAVERGGFWLFGFLSTGVHCTMYIPATKEHPLRIWVPRRSPTKQTWPNYLDNSVAGGIAHGDSVIGTMIKEFSEEANLDVSSMN-LIPCGTVSYIKMEKRHWIQPELQYVFDLPVDDLVIPRINDGEVAGFSLLPLNQVLHELELKSFKPNCALVLLDFLIRHGIITP-QHPQYLQTLERIHRPLP 303          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: Q5D8P4 (Nudix hydrolase 20 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_011171 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 3.482e-90
Identity = 148/328 (45.12%), Postives = 198/328 (60.37%), Query Frame = 2
Query:  107 LWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTH--NNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDK-----------HGNCE----------------YMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 1003
            L ++V  KCNN +++GSS   C  F +  Y VG I P V  +LL++  VF+  +H  + +  + +   L+  +++S AVA+V   LR T+   ALK WRNE YGV++ NR K LLK+ER+AS LLGV++YGVHVNG+   +           +GN                  +MW+G RS+ K T+PG++DNMA GGL +  D ++CAR ECQEEASVP  +L  L  V  LS  FED RG+ P++ YC+DL LP  F PV+SDGEV  F  V  SE+K L  DERFK  SALV++DFL RH FI  D DP ++     MH  LP D
Sbjct:    9 LRNLVLNKCNNFLLAGSSRDKCYKFLLDGYFVGFIQPGVLDWLLKYAKVFVKISHPQHGDQCVTVHQTLTNVKDRSDAVAEVMQDLRATSPFKALKGWRNEDYGVYIHNREKLLLKIERSASNLLGVIRYGVHVNGFFSSRCNYYQKSDRVTNGNLHSSDDPKSLDQTDPDNVFMWLGIRSMNKPTWPGMLDNMAAGGLTYGLDAVECARKECQEEASVPAHMLDKLTLVNQLSYIFEDERGVCPQIEYCFDLELPPDFIPVSSDGEVDSFQLVSISEIKQLIFDERFKSNSALVVLDFLYRHKFIDKDSDPRHAEIQSLMHVNLPLD 336          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A504YE52 (Nudix hydrolase 20 chloroplastic OS=Fasciola gigantica OX=46835 GN=FGIG_03962 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 5.671e-90
Identity = 151/346 (43.64%), Postives = 199/346 (57.51%), Query Frame = 2
Query:   92 NINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFI--TDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGY-----------------------------TVDKHG-----------NCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 1003
            N    LW + S+KCNN ++ GSS   C  F V  + VG++ P+V   LL +P VF+        E  I + P+LSTF+ +S+AVA V   LR      AL+ WRNE YGV++ +R + LL++ER+AS+LLGVV+YGVHVNGY                             TV K             +   MW+G RSL K T+PG++DN+A GGL F  D L CAR ECQEEASVP +LL  + +VG LS  FED RG+ P+V YC+DL LP+ F PV +DGEV  F  V  +++K L   +RFK  SALV++DFL RH FI P  DP ++     MH +  FD
Sbjct:    4 NTFSNLWKLASQKCNNFLLPGSSRCSCCKFLVDGHFVGLVRPDVIPSLLTYPTVFVWAVQPDTGERCITLHPSLSTFDARSSAVADVMLDLRSKKTFRALEGWRNEDYGVYIGDRQQPLLRLERSASSLLGVVRYGVHVNGYFIKCSSELNGINNSKSNGSAVGNGKSPSSTVSKTSVRDQPLSEHDPSSVMMWLGMRSLNKPTWPGMLDNIAAGGLTFGLDALSCARKECQEEASVPEELLNTMSAVGRLSYVFEDERGVCPQVEYCFDLELPADFVPVGADGEVDSFQLVSIAQVKELIFSDRFKANSALVILDFLYRHKFIDPLSDPRHAEIQSLMHMQFEFD 349          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A0V0J957 (Uncharacterized protein YJR142W OS=Schistocephalus solidus OX=70667 GN=YJ9J PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 5.546e-87
Identity = 138/336 (41.07%), Postives = 201/336 (59.82%), Query Frame = 2
Query:  107 LWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFIT--DTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYT--------------------------------VDKHGNCEY---MWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 1003
            +W ++++KCNN  +SGS+  +C  FFV  Y VG+I PE    LLQ P+VF+   D  + +  +++ PNL+ F E++ AV  V   LRD  +  +L+ WRNE+YGVFV  R++ALL VERAAS +LGV ++ VH+ GYT                                  K  N      +WI +RSL++  +PGL+DN+A GGL +   V++CA+ E  EEA +P DLL+ L+  G +S  ++D  G+   + +C+D+ LP  FEP N DGEV+ F  V   E+  L    +FKPTSALV++DFL+RHG+++P+D+P Y  +  WMH KLPFD
Sbjct:    8 VWKMLTQKCNNFFLSGSTSEVCVKFFVDKYFVGLIHPEFCGTLLQHPEVFVEGLDPSSEKPCVRLNPNLTNFAERTAAVENVMRNLRDCPSFPSLRGWRNEHYGVFVNGRTEALLSVERAASRVLGVNRHNVHITGYTFLNGAMSSAERQTGLSDVLDMNLEEEEEENEPELKLSNVPRNLRLWIAKRSLSRPKHPGLLDNLAAGGLTYGLTVMECAKKESMEEAGIPEDLLSSLRPGGCVSFAYDDEDGVAAGIDFCFDIELPPHFEPTNVDGEVAEFHLVSLPEVAKLIGCPQFKPTSALVMLDFLVRHGYVSPEDNPFYEKWLQWMHLKLPFD 343          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A3Q0KR39 (Thiamin pyrophosphokinase-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.117e-86
Identity = 140/328 (42.68%), Postives = 195/328 (59.45%), Query Frame = 2
Query:  107 LWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTH--NNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCE---------------------------YMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 1003
            L ++V  KCNN ++ GSS   C  F +  Y VG I P    +LL++ +VF+  +H  + +  I +   +    ++S AVA+V   LR T+   ALK WRNE YGV++ +R + LL++ER+AS+LLG+ +YGVHVNG++++++   +                           +MW+G RS+ K T PG++DNMA GGL +  DV++CAR ECQEEASVP  +L  L  V  +S  FED RG+ P++ YC+DL LP  F PV+SDGEV  F     SE+K L  DE FK  SALV +DFL RH FI  D DP ++     MH  LPFD
Sbjct:    9 LRNLVLNKCNNFLLPGSSRDKCYKFLLDGYFVGFIHPMFLDWLLKYANVFVKTSHPQHGDHCITVHQAIINVNDRSNAVAEVMQDLRATSPFKALKGWRNEDYGVYIHDREEVLLRIERSASSLLGITRYGVHVNGFSLNRYNYSKKSDRIVNGSSHNSNDSNSLAQIDPDNVFMWLGLRSINKPTSPGMLDNMAAGGLTYGLDVMECARKECQEEASVPEHMLGKLTLVNQISYIFEDERGVCPQIEYCFDLELPPDFIPVSSDGEVDSFRLASISEIKQLIFDEHFKSNSALVALDFLYRHKFIDKDSDPRHAEVQSLMHVNLPFD 336          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: G7Y8Y3 (Nudix hydrolase 20 OS=Clonorchis sinensis OX=79923 GN=NUDT20 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 6.621e-86
Identity = 143/326 (43.87%), Postives = 193/326 (59.20%), Query Frame = 2
Query:  104 RLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFI--TDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTV--------------------DKHGNCE----YMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 1003
            RLW +VS++CNN ++ GSS   C  F V  + +G+I  +    LL +P+VF+  +D    E  I + P+L+T  E+++AV+     LR    + ALK WRNE YGV+  NR K L  +ER+AS LLG+ +YG H+NG+ V                    D  G  +     MW+G RS +K T+PG++DNMA GGL F  D ++CAR ECQEEASVP  LL  L  V  LS  FED RG+ P+V YC+DL LP  F PV++DGEV  F  V  S++K L + E+FK  SA+V++DFL RH FI P+ DP +      MH K  FD
Sbjct:    8 RLWTLVSQRCNNFLLPGSSRSSCFKFVVDGFFLGLIRHDALSTLLSYPEVFVWTSDPITGEQCITLHPSLNTPYERTSAVSDAMLDLRAAGTVPALKGWRNEDYGVYAHNRGKTLFCIERSASALLGITRYGCHINGFVVLPETVNGIDQISTHEKLQLKDSFGQIDASRVMMWLGVRSSSKPTWPGMLDNMAAGGLTFGLDPMECARKECQEEASVPEALLGPLTPVSRLSYIFEDDRGVCPQVEYCFDLELPCDFVPVSADGEVDSFRLVSISQVKELILSEQFKANSAMVVLDFLYRHKFIDPESDPLHKDIISLMHVKFDFD 333          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: tpk2 (nudix hydrolase 20, chloroplastic-like [Source:NCBI gene;Acc:103029024])

HSP 1 Score: 218.779 bits (556), Expect = 1.576e-68
Identity = 118/303 (38.94%), Postives = 165/303 (54.46%), Query Frame = 2
Query:   86 MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKL 994
            M + +ER+  ++ ++ N+  + GSS+  C  F VG   VG +   VA  L +FP+VF      +   + + P L + E +S A+  V   LR       L  WRNE Y V        L+ +ERAA++L GV +YGVHVNG++ D  GN   MW+ +RS TK TYPG +DN+A GGL     V      EC+EEA +P  L      VGT+S  +ED  G+ PE  + +DL LP+ F+P   DGEV  F       +K L   E FKP  A+V++DFLIRH  I PD +P+Y  +   +H  L
Sbjct:    1 MNSWSERVLQLL-RRMNSFHLPGSSIERCLRFEVGGQQVGWVPESVASVLGRFPEVFCPP---HTGTVSLCPGLDSLERRSEAMEAVLQDLRGGATFTCLSGWRNEKYAVMPRYCDPPLMHMERAATSLFGVKRYGVHVNGFSRDGSGNLS-MWVARRSKTKQTYPGKLDNLAAGGLAAGCSVKHTLVKECEEEACIPSSLAERATPVGTISYTYEDEDGVFPECQFVFDLELPTDFKPKIGDGEVQDFYYYPIETVKELLASEEFKPNCAMVVLDFLIRHSVIHPDSEPYYQEFVAGLHRSL 298          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: tpk2 (nudix hydrolase 20, chloroplastic-like [Source:NCBI gene;Acc:103029024])

HSP 1 Score: 206.838 bits (525), Expect = 1.728e-63
Identity = 111/267 (41.57%), Postives = 146/267 (54.68%), Query Frame = 2
Query:  146 ISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPD 946
            +SGSS+  C  F VG   VG +   VA  L +FP+VF      +   + + P L + E +S A+  V   LR       L  WRNE Y V        L+ +ERAA++L GV +YGVHVNG++ D  GN   MW+ +RS TK TYPG +DN+A GGL     V      EC+EEA +P  L      VGT+S  +ED  G+ PE  + +DL LP+ F+P   DGEV  F       +K L   E FKP  A+V++DFLIRH  I PD
Sbjct:   14 LSGSSIERCLRFEVGGQQVGWVPESVASVLGRFPEVFCPP---HTGTVSLCPGLDSLERRSEAMEAVLQDLRGGATFTCLSGWRNEKYAVMPRYCDPPLMHMERAATSLFGVKRYGVHVNGFSRDGSGNLS-MWVARRSKTKQTYPGKLDNLAAGGLAAGCSVKHTLVKECEEEACIPSSLAERATPVGTISYTYEDEDGVFPECQFVFDLELPTDFKPKIGDGEVQDFYYYPIETVKELLASEEFKPNCAMVVLDFLIRHSVIHPD 276          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Match: tpk2 (thiamin pyrophosphokinase 2 [Source:ZFIN;Acc:ZDB-GENE-060503-173])

HSP 1 Score: 138.272 bits (347), Expect = 1.011e-39
Identity = 75/178 (42.13%), Postives = 100/178 (56.18%), Query Frame = 2
Query:  464 STLLGVVKYGVHVNGYTV-DKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKL 994
            S L GV +YGVH+NGYT    HG C  +WIG+RS +K TYPG +DNMA GGL     + +    E  EEA +P  L      VGT+S   E+ RG+ PE  + YDL +P  F P  +DGE+  F      ++        FKP  ALV +DFLIRHG + P+ +P+Y  Y   +H  +
Sbjct:    1 SGLFGVKQYGVHMNGYTHHPSHGLC--LWIGRRSESKQTYPGKLDNMAAGGLAVGVGIKETLVKEAAEEAGIPACLAERAVPVGTVSYTHENERGIFPECQFVYDLEIPDGFTPHAADGEMQDFYLWPVDKVLEELASGDFKPNCALVTLDFLIRHGLVDPETEPYYHCYVEGIHRTI 176          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Yeast
Match: YJR142W_mRNA (8-oxo-dGTP diphosphatase of the Nudix hydrolase family; converts diphosphates of damaged forms of thiamin to monophosphates; GST fusion protein is a Dbf2p-Mob1p phosphorylation target in a proteome chip analysis; synthetic lethal with PH085 deletion; plays a role in restricting Ty1 transposition [Source:SGD;Acc:S000003903])

HSP 1 Score: 153.68 bits (387), Expect = 6.239e-44
Identity = 94/295 (31.86%), Postives = 150/295 (50.85%), Query Frame = 2
Query:  167 MCTHFFVGSYHVGIILPEVAKYLLQ-----FPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLL----------AYLKSVGTLSL--FFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPF 1000
            MCTH       +G +L      +       F + F  D   +E   K +     F+ ++  + ++   +   ++L+ +K WRNE Y V+V  +   L  VERA + +LG++ YG+H+NGY +D        W+ +RS TK T+P ++DN+  GGL + Y + +    E  EEA++   ++          +YL   G +S+  F ++   +  EV Y YDL L     P  +DGEV  F      E  +    + FKP  ALV++DFLIRHG+ITP+++P+Y      MH +LPF
Sbjct:   53 MCTH---DGTKIGFVLKFAINEMETVCSEIFEETFQLDESRHELRFKSE----DFDHRNNLIDQLARKMYLESSLSGVKGWRNEKYAVWVNKKPYVL--VERAVAGVLGIITYGIHINGYVLDPKSKKVQFWVPRRSKTKQTWPLMLDNIIAGGLGYPYGIYETVLKESMEEANLEKSVIEDNIKATGSVSYLYFTGDISVTKFNKESDFIVGEVQYVYDLKLSEDIIPKPNDGEVESFNLFSLQETINALRKKEFKPNCALVMVDFLIRHGYITPENEPNYLELVTRMHRRLPF 338          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Match: EDO49598 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFF7])

HSP 1 Score: 211.46 bits (537), Expect = 3.918e-66
Identity = 112/275 (40.73%), Postives = 160/275 (58.18%), Query Frame = 2
Query:  125 KKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVF-ITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPD 946
            ++ NN   +GSS   C  F V    VG ILP V   + ++PD+F +  T +++  + + P+L TFEE++  V +V    R       L+ WR+E Y V      +    +ER+A+ LLG+ +YGVH+NGY  D +G   +MW+ +RSL+K TYPG +D +  GG+    +  +    EC EEA +   L A  K VGT+S  FED RG+ PEV + YDL LP SF P  SDGEVS F     S++K +     +K  SALV++DFLIRHG ++PD
Sbjct:   15 QRLNNFHAAGSSKVHCKPFVVDGITVGTILPNVLTQIRKYPDIFAVIKTTDSDEHVTLVPSLLTFEERTQKVNEVVQEFRKKDLFVTLRGWRDEMYAVGRSFSDRPFFMMERSAACLLGITQYGVHLNGYHRDVNGML-FMWVARRSLSKPTYPGKLDQLVAGGIPCGSNTRETLIKECAEEALIAESLAANAKPVGTVSYVFEDERGVFPEVQFVYDLELPESFTPKASDGEVSDFYYWPISKVKEMIATNEYKFNSALVVLDFLIRHGEVSPD 288          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Match: EDO49616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFK4])

HSP 1 Score: 200.29 bits (508), Expect = 5.286e-62
Identity = 106/269 (39.41%), Postives = 148/269 (55.02%), Query Frame = 2
Query:  143 IISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETI--IKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITP 943
            I SGSS      F V    VG +LP V  +L   PDVF    +++ ++  + + P+L TFEE++  V  V    R       L+ WR E + V      +   K+ER+A+ LLGV +YGVH+NGY    + +  YMWI +RS  K T PG +D MA GG+ +   + +    EC+EEASVP  +  +   VG++S  FE  +G+ P V + YDL LP  F P  +DGEVS F      ++K   +   FKP  ALV++DFLIRHG I P
Sbjct:    5 IASGSSHTESKPFLVEGTRVGTVLPRVMPHLQSHPDVFTIVMNDDGSVEHVTLAPSLKTFEERTKGVNDVMEEFRKNDVFVTLRGWREEEFAVSRAFNERKFFKIERSAACLLGVTQYGVHINGYFRKANSDL-YMWIARRSANKPTGPGKLDQMAAGGITYSSTITETLIKECKEEASVPEHIARHAVPVGSVSFTFETEKGLFPGVQFIYDLCLPEDFTPSVNDGEVSDFYCWPIDKVKEKIITNEFKPNCALVVLDFLIRHGEINP 272          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Match: tpk2 (nudix hydrolase 20, chloroplastic [Source:NCBI gene;Acc:101173445])

HSP 1 Score: 207.994 bits (528), Expect = 3.090e-64
Identity = 117/303 (38.61%), Postives = 168/303 (55.45%), Query Frame = 2
Query:   86 MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKL 994
            M + +ER+  ++++  NN   +GS    C  F V    VG I P VA  L ++P VF   T      + +  +L ++E +S AV +V   LR   +L  L+ WR+E Y V        ++ +ERAA++L GV +YGVH+N YTV   G    MW+ +RS TK TYPGL+DNMA GGL     +      ECQEEA VP+D     +   T+S  +ED  G+ PE  + +DL +P+ F P   DGEV  F  +   ++K L   + FKP SA+V++DFLIRH  + PD +PHY  +   +H  L
Sbjct:    1 MPSWSERVLHLLNR-MNNFYSTGSCRASCLRFEVDGAQVGWIRPHVASLLSRYPQVF---TAPRGGAVSLCQSLDSYEGRSEAVHEVLLALRQEDSLTCLRGWRDERYSVMPRFSDPPVMWMERAATSLFGVKRYGVHLNAYTVSDGGEVS-MWLARRSSTKQTYPGLLDNMAAGGLAAGVGIKHTLVKECQEEACVPVDTAMTARPAATVSYTYEDEEGVFPESQFVFDLEVPAGFRPRVGDGEVQDFYLLPIEKVKELLATDDFKPNSAMVVLDFLIRHSLVEPDTEPHYQEFVAGLHQTL 298          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Match: tpk2 (nudix hydrolase 20, chloroplastic [Source:NCBI gene;Acc:101173445])

HSP 1 Score: 206.453 bits (524), Expect = 1.151e-63
Identity = 114/289 (39.45%), Postives = 159/289 (55.02%), Query Frame = 2
Query:  128 KCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKL 994
            + NN   +GS    C  F V    VG I P VA  L ++P VF   T      + +  +L ++E +S AV +V   LR   +L  L+ WR+E Y V        ++ +ERAA++L GV +YGVH+N YTV   G    MW+ +RS TK TYPGL+DNMA GGL     +      ECQEEA VP+D     +   T+S  +ED  G+ PE  + +DL +P+ F P   DGEV  F  +   ++K L   + FKP SA+V++DFLIRH  + PD +PHY  +   +H  L
Sbjct:   16 RMNNFYSTGSCRASCLRFEVDGAQVGWIRPHVASLLSRYPQVF---TAPRGGAVSLCQSLDSYEGRSEAVHEVLLALRQEDSLTCLRGWRDERYSVMPRFSDPPVMWMERAATSLFGVKRYGVHLNAYTVSDGGEVS-MWLARRSSTKQTYPGLLDNMAAGGLAAGVGIKHTLVKECQEEACVPVDTAMTARPAATVSYTYEDEEGVFPESQFVFDLEVPAGFRPRVGDGEVQDFYLLPIEKVKELLATDDFKPNSAMVVLDFLIRHSLVEPDTEPHYQEFVAGLHQTL 300          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000064369.1 (SMESG000064369.1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 2
Query:   86 MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 1003
            MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD
Sbjct:    1 MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYLLQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMHSKLPFD 306          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000051615.1 (SMESG000051615.1)

HSP 1 Score: 208.764 bits (530), Expect = 3.420e-65
Identity = 110/241 (45.64%), Postives = 146/241 (60.58%), Query Frame = 2
Query:  239 QFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAALKCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNCEY-MWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLDLLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFLKVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPH 958
            Q+ DVF  D  +   I+     L +  EK+ A+ K+FS +RD      LK WRNE Y ++ E+       +ER+A+ +LGVV+ GVHV GYT++   N +Y +WIG+RS+ K T+PG +DNM GGG N +Y + +    ECQEEA V   LL  LK  G +SL FEDYRG+ PE++YCYDL LP+ F P N DGEV  F+ +   E+  L     FK  SALV +DF  RHG I PD   H
Sbjct:    7 QYSDVFRIDDISKTVILN--EELKSSSEKTEAINKIFSEIRDKGTFPFLKKWRNENYAIYSEDLLTYWFDMERSATGILGVVRRGVHVTGYTIN---NGDYFIWIGKRSMNKETHPGKLDNMVGGGCNCNYSIWENVTKECQEEAGVNDGLLKALKPAGCISLMFEDYRGILPEIIYCYDLCLPNDFIPENKDGEVGEFMLMSVEEVGALLGKPCFKYDSALVTLDFYFRHGIIQPDSCEH 242          
The following BLAST results are available for this feature:
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG125672.293e-6040.99gene:FBgn0039958 transcript:FBtr0344847[more]
CG125672.293e-6040.99gene:FBgn0039958 transcript:FBtr0113704[more]
CG125673.224e-5840.43gene:FBgn0039958 transcript:FBtr0300704[more]
CG125673.578e-5841.98gene:FBgn0039958 transcript:FBtr0300702[more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpk21.287e-7041.25thiamin pyrophosphokinase 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P47173|YJ9J_YEAST4.332e-4231.86Uncharacterized protein YJR142W OS=Saccharomyces c... [more]
sp|P0C026|NUD24_ARATH6.030e-4134.63Nudix hydrolase 24, chloroplastic OS=Arabidopsis t... [more]
sp|Q8VXZ0|NUD20_ARATH5.204e-3934.07Nudix hydrolase 20, chloroplastic OS=Arabidopsis t... [more]
sp|P41888|TNR3_SCHPO2.530e-3031.69Thiamine pyrophosphokinase OS=Schizosaccharomyces ... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5D8P43.482e-9045.12Nudix hydrolase 20 isoform 2 OS=Schistosoma japoni... [more]
A0A504YE525.671e-9043.64Nudix hydrolase 20 chloroplastic OS=Fasciola gigan... [more]
A0A0V0J9575.546e-8741.07Uncharacterized protein YJR142W OS=Schistocephalus... [more]
A0A3Q0KR392.117e-8642.68Thiamin pyrophosphokinase-related OS=Schistosoma m... [more]
G7Y8Y36.621e-8643.87Nudix hydrolase 20 OS=Clonorchis sinensis OX=79923... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tpk21.576e-6838.94nudix hydrolase 20, chloroplastic-like [Source:NCB... [more]
tpk21.728e-6341.57nudix hydrolase 20, chloroplastic-like [Source:NCB... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpk21.011e-3942.13thiamin pyrophosphokinase 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YJR142W_mRNA6.239e-4431.868-oxo-dGTP diphosphatase of the Nudix hydrolase fa... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO495983.918e-6640.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496165.286e-6239.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tpk23.090e-6438.61nudix hydrolase 20, chloroplastic [Source:NCBI gen... [more]
tpk21.151e-6339.45nudix hydrolase 20, chloroplastic [Source:NCBI gen... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064369.10.000e+0100.00SMESG000064369.1[more]
SMESG000051615.13.420e-6545.64SMESG000051615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024846 ID=SMED30024846|Name=Nudix hydrolase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1156bp
ATTTAAGTTTTGAAATAAAATTAAATCTATAGCAGTTTTTTACGAATTTA
AGTTTCAAGATTATTTAGATTGTTTGTTTTAGAAAATGACTAATATTAAT
GAACGTCTATGGGATATTGTTTCCAAAAAGTGCAATAATGCAATAATTTC
AGGTTCTTCTTTGCCTATGTGTACACATTTTTTCGTTGGCTCATATCATG
TTGGTATTATATTACCTGAAGTAGCAAAATATTTACTTCAATTTCCTGAT
GTTTTCATCACAGACACGCATAATAATGAAACAATAATCAAAATTAAACC
AAACCTTAGTACTTTCGAAGAAAAAAGCACGGCTGTTGCTAAGGTCTTTT
CTATTTTAAGAGATACAACAAACTTGGCAGCCTTAAAGTGTTGGCGTAAT
GAATACTATGGAGTATTTGTTGAAAATAGAAGCAAAGCTCTGCTAAAAGT
TGAAAGGGCCGCTAGCACATTGTTAGGTGTTGTGAAATATGGAGTCCATG
TCAATGGGTACACCGTGGATAAACACGGAAATTGTGAATATATGTGGATT
GGACAGCGCTCTCTCACAAAATTAACCTATCCAGGATTAATGGATAACAT
GGCTGGTGGGGGATTGAATTTTGATTATGATGTACTCCAATGTGCCAGAA
ATGAGTGCCAAGAAGAGGCGTCAGTGCCATTAGATTTACTAGCTTATTTG
AAATCTGTGGGGACTCTCAGTTTATTTTTCGAAGATTACAGAGGAATGAA
TCCAGAAGTAATGTATTGTTACGATCTCATTTTACCCTCTTCCTTTGAAC
CAGTGAACTCCGATGGAGAAGTCAGTCATTTTCTTAAAGTTCATTGCAGT
GAGCTAAAACACCTCGCAGTTGATGAAAGATTCAAACCGACATCGGCATT
GGTGTTAATAGATTTTCTAATCAGACATGGTTTTATTACTCCTGATGACG
ATCCTCACTACTCAGCATATGGTTATTGGATGCATTCGAAATTGCCATTT
GATTAATTGATGTAGTTATCCATGCAGTTCATAATTCCATTTTTCTTATT
TTATTGTAATTTTTCTTTTGAAGAGAACATTTAGTTAATTATCTATTAAA
TTTTTTTTGTTTATTTTCTATTATGTAGGAAATATCAGTTTGTTTCGATA
TGGTTG
back to top

protein sequence of SMED30024846-orf-1

>SMED30024846-orf-1 ID=SMED30024846-orf-1|Name=SMED30024846-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MTNINERLWDIVSKKCNNAIISGSSLPMCTHFFVGSYHVGIILPEVAKYL
LQFPDVFITDTHNNETIIKIKPNLSTFEEKSTAVAKVFSILRDTTNLAAL
KCWRNEYYGVFVENRSKALLKVERAASTLLGVVKYGVHVNGYTVDKHGNC
EYMWIGQRSLTKLTYPGLMDNMAGGGLNFDYDVLQCARNECQEEASVPLD
LLAYLKSVGTLSLFFEDYRGMNPEVMYCYDLILPSSFEPVNSDGEVSHFL
KVHCSELKHLAVDERFKPTSALVLIDFLIRHGFITPDDDPHYSAYGYWMH
SKLPFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015797NUDIX_hydrolase-like_dom_sf
IPR031804DUF4743
IPR000086NUDIX_hydrolase_dom
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.750.160coord: 31..221
e-value: 7.2E-80
score: 270.0
NoneNo IPR availableGENE3DG3DSA:3.90.79.10coord: 132..293
e-value: 7.2E-80
score: 270.0
NoneNo IPR availablePANTHERPTHR13622:SF10SI:DKEY-6N6.2coord: 13..303
NoneNo IPR availablePANTHERPTHR13622THIAMIN PYROPHOSPHOKINASEcoord: 13..303
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
IPR000086NUDIX hydrolase domainPFAMPF00293NUDIXcoord: 137..261
e-value: 9.1E-7
score: 29.0
IPR000086NUDIX hydrolase domainPROSITEPS51462NUDIXcoord: 134..274
score: 11.906
IPR031804Domain of unknown function DUF4743PFAMPF15916DUF4743coord: 14..132
e-value: 5.0E-28
score: 97.5
IPR015797NUDIX hydrolase-like domain superfamilySUPERFAMILYSSF55811Nudixcoord: 119..282