Lactadherin

Overview
NameLactadherin
Smed IDSMED30024840
Length (bp)1992
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lactadherin (SMED30024840) t-SNE clustered cells

Violin plots show distribution of expression levels for Lactadherin (SMED30024840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lactadherin (SMED30024840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lactadherin (SMED30024840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024840SMESG000001686.1 dd_Smed_v4_5463_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lactadherin vs. Ensembl Human
Match: MFGE8 (milk fat globule-EGF factor 8 protein [Source:HGNC Symbol;Acc:HGNC:7036])

HSP 1 Score: 134.806 bits (338), Expect = 3.844e-34
Identity = 99/334 (29.64%), Postives = 159/334 (47.60%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHILSNK-----GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            EC  V PLG+  G+I + QI ASS       L+ W        ARL   NR     +W       + W+QV+L     ++GV+TQG  R    +++ +F ++YS +G  F +I D     K F GN +  +V  N F   + A++++ +  S H   +LR E+LGC+   C   LG+     P  +I +S S         +    +   +K      W A     +QW+Q+D+G    +T IIT+G  +     +V  Y+V++SN+S NW  Y++               +  +F GN D++S K N    P +AR+ RI P+ W  +I +R+
Sbjct:   25 EC--VEPLGLENGNIANSQIAASSVRVTFLGLQHWVPEL----ARL---NRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTG-----------SSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRL 338          

HSP 2 Score: 97.8265 bits (242), Expect = 1.652e-21
Identity = 62/156 (39.74%), Postives = 92/156 (58.97%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNC---KASQARLYLE-NRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG-RGDGA-QWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D+QITASS+  K+W  +      S ARL  + N  +W A      +WLQVDLG+   ++G++TQG R  G+ Q+V S+ ++YS D  N+   +D   GS K+F GN D+ S K N F   I AR+++    ++H   +LR+E+LGC
Sbjct:  189 PLGLKNNSIPDKQITASSS-YKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC 343          
BLAST of Lactadherin vs. Ensembl Human
Match: MFGE8 (milk fat globule-EGF factor 8 protein [Source:HGNC Symbol;Acc:HGNC:7036])

HSP 1 Score: 134.42 bits (337), Expect = 1.386e-33
Identity = 98/334 (29.34%), Postives = 158/334 (47.31%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHILSNK-----GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            E   V PLG+  G+I + QI ASS       L+ W        ARL   NR     +W       + W+QV+L     ++GV+TQG  R    +++ +F ++YS +G  F +I D     K F GN +  +V  N F   + A++++ +  S H   +LR E+LGC+   C   LG+     P  +I +S S         +    +   +K      W A     +QW+Q+D+G    +T IIT+G  +     +V  Y+V++SN+S NW  Y++               +  +F GN D++S K N    P +AR+ RI P+ W  +I +R+
Sbjct:   67 ETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHW----VPELARL---NRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTG-----------SSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRL 382          

HSP 2 Score: 97.4413 bits (241), Expect = 4.435e-21
Identity = 63/159 (39.62%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLE-NRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG-RGDGA-QWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D+QITASS+       L SW      S ARL  + N  +W A      +WLQVDLG+   ++G++TQG R  G+ Q+V S+ ++YS D  N+   +D   GS K+F GN D+ S K N F   I AR+++    ++H   +LR+E+LGC
Sbjct:  233 PLGLKNNSIPDKQITASSSYKTWGLHLFSW----NPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC 387          
BLAST of Lactadherin vs. Ensembl Human
Match: MFGE8 (milk fat globule-EGF factor 8 protein [Source:HGNC Symbol;Acc:HGNC:7036])

HSP 1 Score: 134.42 bits (337), Expect = 1.386e-33
Identity = 98/334 (29.34%), Postives = 158/334 (47.31%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHILSNK-----GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            E   V PLG+  G+I + QI ASS       L+ W        ARL   NR     +W       + W+QV+L     ++GV+TQG  R    +++ +F ++YS +G  F +I D     K F GN +  +V  N F   + A++++ +  S H   +LR E+LGC+   C   LG+     P  +I +S S         +    +   +K      W A     +QW+Q+D+G    +T IIT+G  +     +V  Y+V++SN+S NW  Y++               +  +F GN D++S K N    P +AR+ RI P+ W  +I +R+
Sbjct:   67 ETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHW----VPELARL---NRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTG-----------SSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRL 382          

HSP 2 Score: 97.4413 bits (241), Expect = 4.435e-21
Identity = 63/159 (39.62%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLE-NRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG-RGDGA-QWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D+QITASS+       L SW      S ARL  + N  +W A      +WLQVDLG+   ++G++TQG R  G+ Q+V S+ ++YS D  N+   +D   GS K+F GN D+ S K N F   I AR+++    ++H   +LR+E+LGC
Sbjct:  233 PLGLKNNSIPDKQITASSSYKTWGLHLFSW----NPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC 387          
BLAST of Lactadherin vs. Ensembl Human
Match: F8 (coagulation factor VIII [Source:HGNC Symbol;Acc:HGNC:3546])

HSP 1 Score: 137.117 bits (344), Expect = 1.344e-32
Identity = 100/337 (29.67%), Postives = 154/337 (45.70%), Query Frame = 3
Query:  114 YEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFH-YIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILS--------------NKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNG--TVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            Y  +C T  PLGM  G I+D QITAS  +   W        ARL Y  +  +W  K + FS W++VDL    +I G+ TQG      + ++  F+I YS DG  +  Y  +  G+  VF GN DS  +KHN FN  I AR+I+ H   +    +LR+E++GC    C   LG+                  T +  + ++ +              +  W  +  N  +W+Q+D  +   +T + T+G        YV E+ +S S +   W  +                QNG   VF+GN+DS +  +N L  P + R+ RIHP +W  +I +R+
Sbjct: 2036 YSNKCQT--PLGMASGHIRDFQITASG-QYGQWAPKL----ARLHYSGSINAWSTK-EPFS-WIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGM--------ESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLF---------------FQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRM 2340          

HSP 2 Score: 90.5077 bits (223), Expect = 6.628e-18
Identity = 58/156 (37.18%), Postives = 84/156 (53.85%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS---TELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ 590
            PLGM    I D QITASS       +W      S+ARL+L+ R  +W  +  +  EWLQVD      ++GV TQG      + +V  F+IS S DG  +     + G  KVFQGN+DSF+   N  +  +  R+++ H  S+    +LR+E+LGC+
Sbjct: 2196 PLGMESKAISDAQITASSYFTNMFATW----SPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQN-GKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCE 2346          
BLAST of Lactadherin vs. Ensembl Human
Match: EDIL3 (EGF like repeats and discoidin domains 3 [Source:HGNC Symbol;Acc:HGNC:3173])

HSP 1 Score: 130.954 bits (328), Expect = 8.438e-32
Identity = 99/329 (30.09%), Postives = 164/329 (49.85%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLG+  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L  +  ++GV+TQG  R    +++ S+ I+YS DG  +   K        VF+GN D+ +   N F   I+A++++ +      H +LR+E+LGC+   C E LG     +  Y    SS  +         E     L  +G    W +   +++QW+Q+D+  P+ +T IIT+G  D  H  +V  Y++++SN+ ++W  Y++  +           +   VF+GN D+++ + N +  P  AR  RI P +W  +I +R
Sbjct:  150 GPLGIEGGIISNQQITASSTHRALFGLQKWY----PYYARL---NKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQ-----------RKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLR 460          

HSP 2 Score: 89.3521 bits (220), Expect = 3.579e-18
Identity = 58/159 (36.48%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM  G I+D QITASS       ++ +W    +  +ARL  + +  +W +     S+WLQVDL     ++G++TQG  D    Q+V S+ ++YS DG ++   +D+   + KVFQGN D+ + + N  +  I AR I+   +S++G  +LR E+LGC
Sbjct:  312 PLGMKSGHIQDYQITASSIFRTLNMDMFTW----EPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGC 466          
BLAST of Lactadherin vs. Ensembl Celegans
Match: ddr-1 (Discoidin domain-containing receptor A [Source:UniProtKB/Swiss-Prot;Acc:Q18163])

HSP 1 Score: 58.5362 bits (140), Expect = 1.327e-8
Identity = 54/157 (34.39%), Postives = 75/157 (47.77%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLE-NRKSWCAKFKSFS---EWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHP-SLRVEILGCQ 590
            LGM  GDI D QITASS+  K    +     ARL+ E    +WC K +  S   E+LQV L    +I+ V TQGR   G G ++   +MI Y   G+ +   K+  G      GN D+ +      +  I A  I+F   S +     +R EI GC+
Sbjct:   29 LGMQNGDIADSQITASSSFDK---QSVGPQNARLHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHYMIDYLRPGSQWIRYKNRTG-HVYMDGNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCK 181          
BLAST of Lactadherin vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 53.1434 bits (126), Expect = 6.016e-7
Identity = 50/165 (30.30%), Postives = 78/165 (47.27%), Query Frame = 3
Query:  120 KECNTVGPLGMIQGDIKDQQITASST-ELKSWRDNCKASQARLYLEN-RKSWCAK--FKSFS-EWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYSTDGTN-FHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            +EC+    LGM    I+D+QI+ASS+ +L+S         AR + E+   +WC K    S S EWLQ+    + VI+ V TQGR   G G ++  +F I Y     N +   KDD+  + +   N    +++ +     I  R       +      +RVE+ GC
Sbjct:   23 RECS--HQLGMSNRKIRDEQISASSSFDLQS----TGPQHARAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGC 181          
BLAST of Lactadherin vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 49.2914 bits (116), Expect = 9.951e-6
Identity = 45/150 (30.00%), Postives = 71/150 (47.33%), Query Frame = 3
Query:  165 IKDQQITASST-ELKSWRDNCKASQARLYLEN-RKSWCAK--FKSFS-EWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYSTDGTN-FHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            I+D+QI+ASS+ +L+S         AR + E+   +WC K    S S EWLQ+    + VI+ V TQGR   G G ++  +F I Y     N +   KDD+  + +   N    +++ +     I  R       +      +RVE+ GC
Sbjct:    6 IRDEQISASSSFDLQS----TGPQHARAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGC 151          
BLAST of Lactadherin vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 49.2914 bits (116), Expect = 9.951e-6
Identity = 45/150 (30.00%), Postives = 71/150 (47.33%), Query Frame = 3
Query:  165 IKDQQITASST-ELKSWRDNCKASQARLYLEN-RKSWCAK--FKSFS-EWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYSTDGTN-FHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            I+D+QI+ASS+ +L+S         AR + E+   +WC K    S S EWLQ+    + VI+ V TQGR   G G ++  +F I Y     N +   KDD+  + +   N    +++ +     I  R       +      +RVE+ GC
Sbjct:    6 IRDEQISASSSFDLQS----TGPQHARAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGC 151          
BLAST of Lactadherin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 87.8113 bits (216), Expect = 1.857e-17
Identity = 68/309 (22.01%), Postives = 125/309 (40.45%), Query Frame = 3
Query:  237 ARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC------QPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNK----------------------------GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            ARL  E  R SW        ++L+++        GV+  G  +   +V  F I +S DG  +HY+ D+    ++F G  DS +     F   I A  ++ +   +HG  ++RVE+L C      +P   +  + P  +  +     +       +E G +  ++                             W     ++N++I+ D  +P  I+  +TKG  D     +VT Y+V FS     W            N  +       +F+ N D+ +E+ ++ + P + ++ +I P  W++ I MRI
Sbjct: 2107 ARLTKEQPRGSWSPSINDQMQYLELNFAKPEPFYGVVMAGSPEFDNYVTLFKILHSHDGIAYHYLVDETEKPQMFNGPLDSRAPVQTLFKIPIEASSLRIYPLKWHGSIAMRVELLICGDKEEPKPVPTVSTILPITERPARLVDLECIDLMGVDE-GKMYQDQVQSSSLWQQPNLGKKLQLLELLKLSTPLAWRPLANSQNEFIEFDFLEPRNISGFVTKGGPDG----WVTGYKVMFSKKKPTW------------NTVLSTDGQARIFEANHDAETERRHHFKNPILTQYIKIVPAYWEKNINMRI 2398          

HSP 2 Score: 50.447 bits (119), Expect = 6.223e-6
Identity = 27/108 (25.00%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  264 SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            +W     S +E+++ D      ISG +T+G  DG  WV  + + +S     ++ +    G  ++F+ N D+ + + ++F + I  ++IK     +  + ++R+E LGC
Sbjct: 2298 AWRPLANSQNEFIEFDFLEPRNISGFVTKGGPDG--WVTGYKVMFSKKKPTWNTVLSTDGQARIFEANHDAETERRHHFKNPILTQYIKIVPAYWEKNINMRIEPLGC 2403          
BLAST of Lactadherin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 87.8113 bits (216), Expect = 1.890e-17
Identity = 68/309 (22.01%), Postives = 125/309 (40.45%), Query Frame = 3
Query:  237 ARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC------QPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNK----------------------------GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            ARL  E  R SW        ++L+++        GV+  G  +   +V  F I +S DG  +HY+ D+    ++F G  DS +     F   I A  ++ +   +HG  ++RVE+L C      +P   +  + P  +  +     +       +E G +  ++                             W     ++N++I+ D  +P  I+  +TKG  D     +VT Y+V FS     W            N  +       +F+ N D+ +E+ ++ + P + ++ +I P  W++ I MRI
Sbjct: 2108 ARLTKEQPRGSWSPSINDQMQYLELNFAKPEPFYGVVMAGSPEFDNYVTLFKILHSHDGIAYHYLVDETEKPQMFNGPLDSRAPVQTLFKIPIEASSLRIYPLKWHGSIAMRVELLICGDKEEPKPVPTVSTILPITERPARLVDLECIDLMGVDE-GKMYQDQVQSSSLWQQPNLGKKLQLLELLKLSTPLAWRPLANSQNEFIEFDFLEPRNISGFVTKGGPDG----WVTGYKVMFSKKKPTW------------NTVLSTDGQARIFEANHDAETERRHHFKNPILTQYIKIVPAYWEKNINMRI 2399          

HSP 2 Score: 50.447 bits (119), Expect = 6.438e-6
Identity = 27/108 (25.00%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  264 SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            +W     S +E+++ D      ISG +T+G  DG  WV  + + +S     ++ +    G  ++F+ N D+ + + ++F + I  ++IK     +  + ++R+E LGC
Sbjct: 2299 AWRPLANSQNEFIEFDFLEPRNISGFVTKGGPDG--WVTGYKVMFSKKKPTWNTVLSTDGQARIFEANHDAETERRHHFKNPILTQYIKIVPAYWEKNINMRIEPLGC 2404          
BLAST of Lactadherin vs. Ensembl Fly
Match: Nrx-IV (gene:FBgn0013997 transcript:FBtr0075998)

HSP 1 Score: 69.3218 bits (168), Expect = 8.771e-12
Identity = 38/119 (31.93%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  702 NKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            N  W   +   N ++ +D+G P ++  I T GR  +    +VTEY V +S++ + W  Y  N  S P            +FKGN D NS   N    P +A++ RI+P  W ++I MR+
Sbjct:   76 NAAWTPVENTYNHFLTLDLGDPRMVRKIATMGRMHTDE--FVTEYIVQYSDDGEFWRSYV-NPTSEPQ-----------MFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRV 180          

HSP 2 Score: 61.6178 bits (148), Expect = 2.032e-9
Identity = 36/143 (25.17%), Postives = 70/143 (48.95%), Query Frame = 3
Query:  180 ITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEIL 608
            +TA+S+  +   D  +       L    +W     +++ +L +DLG   ++  + T GR    ++V  +++ YS DG  +    +     ++F+GN D  S+ +N F   I A++++ +   +H   S+RVE+ GC    E L
Sbjct:   57 LTATSSLTERGPDKAR-------LNGNAAWTPVENTYNHFLTLDLGDPRMVRKIATMGRMHTDEFVTEYIVQYSDDGEFWRSYVNPTSEPQMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRVELYGCDYISENL 192          
BLAST of Lactadherin vs. Ensembl Fly
Match: Nrx-IV (gene:FBgn0013997 transcript:FBtr0075999)

HSP 1 Score: 68.9366 bits (167), Expect = 1.311e-11
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 3
Query:  180 ITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEIL 608
            +TA+S+  +   D  +       L    SW AK   F + L +DLG    ++ +  QGR    ++V  + ISY      F   K+  G+ K+F+GN D  S+ +N F   I A++++ +   +H   S+RVE+ GC    E L
Sbjct:   57 LTATSSLTERGPDKAR-------LNAGTSWSAKNSDFDQRLIIDLGVVRNVTHIALQGRPHSNEYVTEYTISYGITDLEFADYKEPGGNVKMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRVELYGCDYISENL 192          

HSP 2 Score: 64.3142 bits (155), Expect = 3.129e-10
Identity = 41/116 (35.34%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  711 WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            W AK  + +Q + ID+G    +T I  +GR  S    YVTEY +S+      +  YKE       NV M        FKGN D NS   N    P +A++ RI+P  W ++I MR+
Sbjct:   79 WSAKNSDFDQRLIIDLGVVRNVTHIALQGRPHSNE--YVTEYTISYGITDLEFADYKEPG----GNVKM--------FKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRV 180          
BLAST of Lactadherin vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0340169)

HSP 1 Score: 67.0106 bits (162), Expect = 1.726e-11
Identity = 50/156 (32.05%), Postives = 75/156 (48.08%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-SWCAKF---KSFSEWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYS-FHGHPSLRVEILGC 587
            LGM  G I D QITASS        N     ARL ++N   +WC K    +  +E+LQVDL    ++S + TQGR   G G ++  +++I Y   G            ++V  GN +++S   N     + A  ++ + YS +     LR EI+GC
Sbjct:  110 LGMESGAIADFQITASSAHDMG---NVGPQHARLKIDNNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGC 262          
BLAST of Lactadherin vs. Ensembl Zebrafish
Match: edil3a (EGF-like repeats and discoidin I-like domains 3a [Source:ZFIN;Acc:ZDB-GENE-060503-366])

HSP 1 Score: 135.191 bits (339), Expect = 7.254e-34
Identity = 102/329 (31.00%), Postives = 164/329 (49.85%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQK-VFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++GV+TQG  R    ++V S+ ++YS DG  +   K     +  +F+GN D+ +   N F   I A++++ +      H +LR+E+LGC+   C E +G     +  Y    SS  +         E     L  +G    W +   +++QW+Q+D+ +P+ IT IIT+G  D  H  +V  Y+V++SNN + W  Y++  +           +   VF+GN D+++ + N +  P  ARF RI P +W  +I +R
Sbjct:   93 GPLGMEGGIISNQQITASSTHRALFGLQKWY----PYFARL---NKKGLVNAWTAAENDRWPWIQINLQRRMRVTGVITQGAKRIGSPEYVKSYKVAYSDDGKTWRTYKVKGTDEDIIFRGNIDNNTPFANSFTPPIEAQYVRIYPQVCRRHCTLRMELLGCELSGCSEPMGMKSGHIQDYQITASSIFRTLNMDMFTWEPGKARLDKQGKVNAWTSGHSDQSQWLQVDMLRPTKITGIITQGAKDFGHVQFVGSYKVAYSNNGERWLIYQDEKQ-----------KKDKVFQGNFDNDTHRKNVIDPPIYARFVRILPWSWYGRITLR 403          

HSP 2 Score: 89.3521 bits (220), Expect = 1.781e-18
Identity = 56/159 (35.22%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM  G I+D QITASS       ++ +W    +  +ARL  + +  +W +     S+WLQVD+     I+G++TQG  D    Q+V S+ ++YS +G  +   +D+   + KVFQGN D+ + + N  +  I ARF++   +S++G  +LR E+LGC
Sbjct:  255 PMGMKSGHIQDYQITASSIFRTLNMDMFTW----EPGKARLDKQGKVNAWTSGHSDQSQWLQVDMLRPTKITGIITQGAKDFGHVQFVGSYKVAYSNNGERWLIYQDEKQKKDKVFQGNFDNDTHRKNVIDPPIYARFVRILPWSWYGRITLRAELLGC 409          
BLAST of Lactadherin vs. Ensembl Zebrafish
Match: edil3a (EGF-like repeats and discoidin I-like domains 3a [Source:ZFIN;Acc:ZDB-GENE-060503-366])

HSP 1 Score: 135.576 bits (340), Expect = 7.483e-34
Identity = 102/329 (31.00%), Postives = 164/329 (49.85%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQK-VFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++GV+TQG  R    ++V S+ ++YS DG  +   K     +  +F+GN D+ +   N F   I A++++ +      H +LR+E+LGC+   C E +G     +  Y    SS  +         E     L  +G    W +   +++QW+Q+D+ +P+ IT IIT+G  D  H  +V  Y+V++SNN + W  Y++  +           +   VF+GN D+++ + N +  P  ARF RI P +W  +I +R
Sbjct:  116 GPLGMEGGIISNQQITASSTHRALFGLQKWY----PYFARL---NKKGLVNAWTAAENDRWPWIQINLQRRMRVTGVITQGAKRIGSPEYVKSYKVAYSDDGKTWRTYKVKGTDEDIIFRGNIDNNTPFANSFTPPIEAQYVRIYPQVCRRHCTLRMELLGCELSGCSEPMGMKSGHIQDYQITASSIFRTLNMDMFTWEPGKARLDKQGKVNAWTSGHSDQSQWLQVDMLRPTKITGIITQGAKDFGHVQFVGSYKVAYSNNGERWLIYQDEKQ-----------KKDKVFQGNFDNDTHRKNVIDPPIYARFVRILPWSWYGRITLR 426          

HSP 2 Score: 89.3521 bits (220), Expect = 2.091e-18
Identity = 56/159 (35.22%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM  G I+D QITASS       ++ +W    +  +ARL  + +  +W +     S+WLQVD+     I+G++TQG  D    Q+V S+ ++YS +G  +   +D+   + KVFQGN D+ + + N  +  I ARF++   +S++G  +LR E+LGC
Sbjct:  278 PMGMKSGHIQDYQITASSIFRTLNMDMFTW----EPGKARLDKQGKVNAWTSGHSDQSQWLQVDMLRPTKITGIITQGAKDFGHVQFVGSYKVAYSNNGERWLIYQDEKQKKDKVFQGNFDNDTHRKNVIDPPIYARFVRILPWSWYGRITLRAELLGC 432          
BLAST of Lactadherin vs. Ensembl Zebrafish
Match: edil3a (EGF-like repeats and discoidin I-like domains 3a [Source:ZFIN;Acc:ZDB-GENE-060503-366])

HSP 1 Score: 135.191 bits (339), Expect = 8.175e-34
Identity = 102/329 (31.00%), Postives = 164/329 (49.85%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQK-VFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++GV+TQG  R    ++V S+ ++YS DG  +   K     +  +F+GN D+ +   N F   I A++++ +      H +LR+E+LGC+   C E +G     +  Y    SS  +         E     L  +G    W +   +++QW+Q+D+ +P+ IT IIT+G  D  H  +V  Y+V++SNN + W  Y++  +           +   VF+GN D+++ + N +  P  ARF RI P +W  +I +R
Sbjct:  106 GPLGMEGGIISNQQITASSTHRALFGLQKWY----PYFARL---NKKGLVNAWTAAENDRWPWIQINLQRRMRVTGVITQGAKRIGSPEYVKSYKVAYSDDGKTWRTYKVKGTDEDIIFRGNIDNNTPFANSFTPPIEAQYVRIYPQVCRRHCTLRMELLGCELSGCSEPMGMKSGHIQDYQITASSIFRTLNMDMFTWEPGKARLDKQGKVNAWTSGHSDQSQWLQVDMLRPTKITGIITQGAKDFGHVQFVGSYKVAYSNNGERWLIYQDEKQ-----------KKDKVFQGNFDNDTHRKNVIDPPIYARFVRILPWSWYGRITLR 416          

HSP 2 Score: 88.9669 bits (219), Expect = 2.163e-18
Identity = 56/159 (35.22%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM  G I+D QITASS       ++ +W    +  +ARL  + +  +W +     S+WLQVD+     I+G++TQG  D    Q+V S+ ++YS +G  +   +D+   + KVFQGN D+ + + N  +  I ARF++   +S++G  +LR E+LGC
Sbjct:  268 PMGMKSGHIQDYQITASSIFRTLNMDMFTW----EPGKARLDKQGKVNAWTSGHSDQSQWLQVDMLRPTKITGIITQGAKDFGHVQFVGSYKVAYSNNGERWLIYQDEKQKKDKVFQGNFDNDTHRKNVIDPPIYARFVRILPWSWYGRITLRAELLGC 422          
BLAST of Lactadherin vs. Ensembl Zebrafish
Match: f8 (coagulation factor VIII, procoagulant component [Source:ZFIN;Acc:ZDB-GENE-090629-2])

HSP 1 Score: 136.346 bits (342), Expect = 1.367e-32
Identity = 103/349 (29.51%), Postives = 154/349 (44.13%), Query Frame = 3
Query:   63 LLSCVICVASVILIDAD---YEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG----RGDGAQWVVSFMISYSTDGTNFH-YIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHR---TCTEEYGHILSN---KGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            L+ C I    +  + A    Y  +CN   P+GM    I ++QITAS      +  + K   ARL L     +W     S + WLQVDL    ++ G+ TQG     G    + + + ISYS D  N+  Y  +       F GN D   +K N F+  I  R+I+ H  +F   P+LR+E+LGC    C   LG+       SS S     ++   + + +   I        W  K  N ++W+Q+D      +T +IT+G      P  VTE+ VS SN+  +W    E               +  +F+GN D+N E +N    P   RF R+HP  W   I +R+
Sbjct: 1047 LIECTIGEHQLAGMRAKLLVYNPQCNQ--PIGMQSRWITNKQITASD-----YYGDWKPELARLELTGSINAWMGS--SPNSWLQVDLLRPMILHGIQTQGAKTSMGLSEFFTILYSISYSNDQENWSVYRGNSTKPYYTFNGNMDGSRIKENLFSPPIVGRYIRIHPLTFQKQPTLRIELLGCDLNSCSLPLGMERRSIPNSSISASSFLNKWLLSWSPDLARIHQEGRANAWRPKSNNPHEWLQVDFASVKRVTGLITQGARSVLKPMMVTEFTVSVSNDGHSWSSVTEQG-----------TDSEQIFEGNSDNNEETLNIFDPPLFTRFIRVHPKGWVNDIALRL 1375          

HSP 2 Score: 77.7962 bits (190), Expect = 3.017e-14
Identity = 50/153 (32.68%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM +  I +  I+ASS  L  W  +     AR++ E R  +W  K  +  EWLQVD  +   ++G++TQG         V  F +S S DG ++  + +    S+++F+GN D+     N F+  +  RFI+ H   +    +LR+E LGC
Sbjct: 1229 PLGMERRSIPNSSISASSF-LNKWLLSWSPDLARIHQEGRANAWRPKSNNPHEWLQVDFASVKRVTGLITQGARSVLKPMMVTEFTVSVSNDGHSWSSVTEQGTDSEQIFEGNSDNNEETLNIFDPPLFTRFIRVHPKGWVNDIALRLEFLGC 1380          
BLAST of Lactadherin vs. Ensembl Zebrafish
Match: edil3b (EGF-like repeats and discoidin I-like domains 3b [Source:ZFIN;Acc:ZDB-GENE-090312-42])

HSP 1 Score: 131.339 bits (329), Expect = 1.838e-32
Identity = 99/330 (30.00%), Postives = 160/330 (48.48%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++ ++TQG  R    ++V SF ++YS DG  +   K        +F GN D+ S   N F+  I A++I+ +      H +LR+E+LGC+   C E +G     +  Y    SS  +         +     L  +G    W +   +++QW+QID+  P+ +T IIT+G  D  H  +V  ++++FSN+ + W  Y++  +               +F+GN D+ + + N +  P  ARF RI P +W  +I +R+
Sbjct:   97 GPLGMEGGIISNQQITASSTHRALFGLQKWF----PYFARL---NKKGLVNAWSAAEGDRYPWIQINLLRRMRVTALITQGAKRIGSPEYVKSFKVAYSEDGKAWSLFKVKGTDEDMIFTGNTDNSSPSVNSFSPPIEAQYIRVYPQICRKHCTLRMELLGCELTGCSEPMGMKTGHIQDYQLSSSSVFQTLSMDMFSWDPSKARLDKQGKVNAWTSAHNDQSQWLQIDLLIPTKVTGIITQGAKDFGHVQFVGSFKLAFSNDGEKWIIYQDEKQ-----------HKDKIFQGNFDNETHRKNVIDPPIYARFVRILPWSWYGRITVRM 408          

HSP 2 Score: 87.4261 bits (215), Expect = 8.034e-18
Identity = 53/159 (33.33%), Postives = 93/159 (58.49%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM  G I+D Q+++SS       ++ SW      S+ARL  + +  +W +     S+WLQ+DL     ++G++TQG  D    Q+V SF +++S DG  +   +D+   + K+FQGN D+ + + N  +  I ARF++   +S++G  ++R+E+LGC
Sbjct:  259 PMGMKTGHIQDYQLSSSSVFQTLSMDMFSW----DPSKARLDKQGKVNAWTSAHNDQSQWLQIDLLIPTKVTGIITQGAKDFGHVQFVGSFKLAFSNDGEKWIIYQDEKQHKDKIFQGNFDNETHRKNVIDPPIYARFVRILPWSWYGRITVRMELLGC 413          
BLAST of Lactadherin vs. Ensembl Xenopus
Match: mef2d (myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-GENE-483879])

HSP 1 Score: 142.51 bits (358), Expect = 2.337e-36
Identity = 104/331 (31.42%), Postives = 155/331 (46.83%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---------GHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            E +    LGM    I D QIT+SS       L+ W  N     ARL  +    +W A       W+QV+L  E  +SGV+TQG  R   A++V  F ++YS DG  F + K + G  K+F GN D+   K N F+  I ARFI+ +  +     +LR E+ GC+P  C + LG+                     + +           I     W A + N+ QW+QID+  P  I+ IIT+G  D  +  YV  ++V++S++   W  YK++             +   +F GN D+ S K N    PF ARF R+ P +W E+I +R+
Sbjct:   87 EISCANALGMEGRAISDAQITSSSMYHGFLGLQRWGPN----LARLNNKGMVNAWTANSLDQHPWIQVNLLREMRVSGVITQGASRMGTAEYVKEFKVAYSVDGHEFTFYKSE-GKDKLFPGNIDNDGRKANLFSPPISARFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSVYKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSR-----------TKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRM 401          

HSP 2 Score: 90.5077 bits (223), Expect = 9.903e-19
Identity = 67/186 (36.02%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   54 RFLLLSCVICVASVILIDADYEKECNTVG-PLGMIQGDIKDQQITASSTELKSWRDNC---KASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            RF+ +  V C  +  L    Y  E +    PLGM    I D+QI ASS   K+W  +        ARL  +    +W A   +  +WLQ+DL     ISG++TQG  D    Q+V SF ++YS DG  +   KD    + K+F GN D++S K N F+    ARF++    S+H   +LR+E+LGC
Sbjct:  222 RFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSV-YKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSRTKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRMELLGC 406          
BLAST of Lactadherin vs. Ensembl Xenopus
Match: mef2d (myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-GENE-483879])

HSP 1 Score: 142.895 bits (359), Expect = 2.869e-36
Identity = 104/331 (31.42%), Postives = 155/331 (46.83%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---------GHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            E +    LGM    I D QIT+SS       L+ W  N     ARL  +    +W A       W+QV+L  E  +SGV+TQG  R   A++V  F ++YS DG  F + K + G  K+F GN D+   K N F+  I ARFI+ +  +     +LR E+ GC+P  C + LG+                     + +           I     W A + N+ QW+QID+  P  I+ IIT+G  D  +  YV  ++V++S++   W  YK++             +   +F GN D+ S K N    PF ARF R+ P +W E+I +R+
Sbjct:  110 EISCANALGMEGRAISDAQITSSSMYHGFLGLQRWGPN----LARLNNKGMVNAWTANSLDQHPWIQVNLLREMRVSGVITQGASRMGTAEYVKEFKVAYSVDGHEFTFYKSE-GKDKLFPGNIDNDGRKANLFSPPISARFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSVYKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSR-----------TKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRM 424          

HSP 2 Score: 90.1225 bits (222), Expect = 1.584e-18
Identity = 67/186 (36.02%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   54 RFLLLSCVICVASVILIDADYEKECNTVG-PLGMIQGDIKDQQITASSTELKSWRDNC---KASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            RF+ +  V C  +  L    Y  E +    PLGM    I D+QI ASS   K+W  +        ARL  +    +W A   +  +WLQ+DL     ISG++TQG  D    Q+V SF ++YS DG  +   KD    + K+F GN D++S K N F+    ARF++    S+H   +LR+E+LGC
Sbjct:  245 RFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSV-YKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSRTKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRMELLGC 429          
BLAST of Lactadherin vs. Ensembl Xenopus
Match: mef2d (myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-GENE-483879])

HSP 1 Score: 142.124 bits (357), Expect = 5.251e-36
Identity = 106/334 (31.74%), Postives = 156/334 (46.71%), Query Frame = 3
Query:  120 KECN--TVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---------GHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            K CN      LGM    I D QIT+SS       L+ W  N     ARL  +    +W A       W+QV+L  E  +SGV+TQG  R   A++V  F ++YS DG  F + K + G  K+F GN D+   K N F+  I ARFI+ +  +     +LR E+ GC+P  C + LG+                     + +           I     W A + N+ QW+QID+  P  I+ IIT+G  D  +  YV  ++V++S++   W  YK++             +   +F GN D+ S K N    PF ARF R+ P +W E+I +R+
Sbjct:  108 KVCNIRCANALGMEGRAISDAQITSSSMYHGFLGLQRWGPN----LARLNNKGMVNAWTANSLDQHPWIQVNLLREMRVSGVITQGASRMGTAEYVKEFKVAYSVDGHEFTFYKSE-GKDKLFPGNIDNDGRKANLFSPPISARFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSVYKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSR-----------TKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRM 425          

HSP 2 Score: 90.8929 bits (224), Expect = 9.286e-19
Identity = 67/186 (36.02%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   54 RFLLLSCVICVASVILIDADYEKECNTVG-PLGMIQGDIKDQQITASSTELKSWRDNC---KASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            RF+ +  V C  +  L    Y  E +    PLGM    I D+QI ASS   K+W  +        ARL  +    +W A   +  +WLQ+DL     ISG++TQG  D    Q+V SF ++YS DG  +   KD    + K+F GN D++S K N F+    ARF++    S+H   +LR+E+LGC
Sbjct:  246 RFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSV-YKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSRTKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRMELLGC 430          
BLAST of Lactadherin vs. Ensembl Xenopus
Match: mef2d (myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-GENE-483879])

HSP 1 Score: 142.51 bits (358), Expect = 8.545e-36
Identity = 106/334 (31.74%), Postives = 156/334 (46.71%), Query Frame = 3
Query:  120 KECN--TVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---------GHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            K CN      LGM    I D QIT+SS       L+ W  N     ARL  +    +W A       W+QV+L  E  +SGV+TQG  R   A++V  F ++YS DG  F + K + G  K+F GN D+   K N F+  I ARFI+ +  +     +LR E+ GC+P  C + LG+                     + +           I     W A + N+ QW+QID+  P  I+ IIT+G  D  +  YV  ++V++S++   W  YK++             +   +F GN D+ S K N    PF ARF R+ P +W E+I +R+
Sbjct:  145 KVCNIRCANALGMEGRAISDAQITSSSMYHGFLGLQRWGPN----LARLNNKGMVNAWTANSLDQHPWIQVNLLREMRVSGVITQGASRMGTAEYVKEFKVAYSVDGHEFTFYKSE-GKDKLFPGNIDNDGRKANLFSPPISARFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSVYKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSR-----------TKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRM 462          

HSP 2 Score: 89.7373 bits (221), Expect = 2.467e-18
Identity = 67/186 (36.02%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   54 RFLLLSCVICVASVILIDADYEKECNTVG-PLGMIQGDIKDQQITASSTELKSWRDNC---KASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            RF+ +  V C  +  L    Y  E +    PLGM    I D+QI ASS   K+W  +        ARL  +    +W A   +  +WLQ+DL     ISG++TQG  D    Q+V SF ++YS DG  +   KD    + K+F GN D++S K N F+    ARF++    S+H   +LR+E+LGC
Sbjct:  283 RFIRIYPVTCRVACTLRFELYGCEPSGCSDPLGMKTQVISDKQIKASSV-YKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSRTKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRMELLGC 467          
BLAST of Lactadherin vs. Ensembl Xenopus
Match: mef2d (myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-GENE-483879])

HSP 1 Score: 140.584 bits (353), Expect = 2.066e-35
Identity = 106/340 (31.18%), Postives = 156/340 (45.88%), Query Frame = 3
Query:  120 KECN--TVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--------CKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---------GHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            K CN      LGM    I D QIT+SS       L+ W  N     ARL  +    +W A       W+QV+L  E  +SGV+TQG  R   A++V  F ++YS DG  F + K + G  K+F GN D+   K N F+  I ARFI+ +  +     +LR E+ GC+P        C + LG+                     + +           I     W A + N+ QW+QID+  P  I+ IIT+G  D  +  YV  ++V++S++   W  YK++             +   +F GN D+ S K N    PF ARF R+ P +W E+I +R+
Sbjct:  104 KVCNIRCANALGMEGRAISDAQITSSSMYHGFLGLQRWGPN----LARLNNKGMVNAWTANSLDQHPWIQVNLLREMRVSGVITQGASRMGTAEYVKEFKVAYSVDGHEFTFYKSE-GKDKLFPGNIDNDGRKANLFSPPISARFIRIYPVTCRVACTLRFELYGCEPSVYFNMVGCSDPLGMKTQVISDKQIKASSVYKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSR-----------TKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRM 427          

HSP 2 Score: 90.8929 bits (224), Expect = 1.023e-18
Identity = 68/190 (35.79%), Postives = 97/190 (51.05%), Query Frame = 3
Query:   51 MRFLLLSC-VICVASVILIDADYEKECNTVG---PLGMIQGDIKDQQITASSTELKSWRDNC---KASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            +R   ++C V C     L   +     N VG   PLGM    I D+QI ASS   K+W  +        ARL  +    +W A   +  +WLQ+DL     ISG++TQG  D    Q+V SF ++YS DG  +   KD    + K+F GN D++S K N F+    ARF++    S+H   +LR+E+LGC
Sbjct:  244 IRIYPVTCRVACTLRFELYGCEPSVYFNMVGCSDPLGMKTQVISDKQIKASSV-YKTWGIDAFTWHPHYARLDKIGKTNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYKDSRTKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRMELLGC 432          
BLAST of Lactadherin vs. Ensembl Mouse
Match: Mfge8 (milk fat globule-EGF factor 8 protein [Source:MGI Symbol;Acc:MGI:102768])

HSP 1 Score: 174.481 bits (441), Expect = 1.180e-47
Identity = 121/347 (34.87%), Postives = 177/347 (51.01%), Query Frame = 3
Query:   78 ICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHI--LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            IC   V       E  C+T   LGM  G I D QI+ASS       L+ W        ARLY      +W A       W+QV+L  +  +SGVMTQG  R   A+++ +F ++YS DG  F +I+D+ G  K F GN D+ S+K N FN  + A++IK +  S H   +LR E+LGC+   C E LG+     P  ++ +S S      R     Y H+  L N+G    W A+  +  +W+Q+D+G    +T IIT+G  D  H  YV  Y+V+ S++   W  Y+E   S              VF+GN D+NS K N   +PF+AR+ R+ P++W  +I +R+
Sbjct:   95 ICQCPVGYSGIHCETGCST--QLGMEGGAIADSQISASSVYMGFMGLQRW----GPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRA-FGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSS-------------KVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRL 421          

HSP 2 Score: 96.6709 bits (239), Expect = 9.034e-21
Identity = 60/155 (38.71%), Postives = 91/155 (58.71%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENR---KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D Q++ASS+  K+W          L  L+N+    +W A+  S  EWLQVDLGT+  ++G++TQG  D    Q+V S+ +++S DG  +  + ++ GS KVFQGN D+ S K N F     AR+++    S+H   +LR+E+LGC
Sbjct:  274 PLGLKNNTIPDSQMSASSS-YKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWT-VYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC 426          
BLAST of Lactadherin vs. Ensembl Mouse
Match: Mfge8 (milk fat globule-EGF factor 8 protein [Source:MGI Symbol;Acc:MGI:102768])

HSP 1 Score: 172.94 bits (437), Expect = 1.036e-46
Identity = 115/325 (35.38%), Postives = 170/325 (52.31%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHI--LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            LGM  G I D QI+ASS       L+ W        ARLY      +W A       W+QV+L  +  +SGVMTQG  R   A+++ +F ++YS DG  F +I+D+ G  K F GN D+ S+K N FN  + A++IK +  S H   +LR E+LGC+   C E LG+     P  ++ +S S      R     Y H+  L N+G    W A+  +  +W+Q+D+G    +T IIT+G  D  H  YV  Y+V+ S++   W  Y+E   S              VF+GN D+NS K N   +PF+AR+ R+ P++W  +I +R+
Sbjct:  152 LGMEGGAIADSQISASSVYMGFMGLQRW----GPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRA-FGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSS-------------KVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRL 458          

HSP 2 Score: 97.4413 bits (241), Expect = 6.678e-21
Identity = 60/155 (38.71%), Postives = 91/155 (58.71%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENR---KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D Q++ASS+  K+W          L  L+N+    +W A+  S  EWLQVDLGT+  ++G++TQG  D    Q+V S+ +++S DG  +  + ++ GS KVFQGN D+ S K N F     AR+++    S+H   +LR+E+LGC
Sbjct:  311 PLGLKNNTIPDSQMSASSS-YKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWT-VYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC 463          
BLAST of Lactadherin vs. Ensembl Mouse
Match: Edil3 (EGF-like repeats and discoidin I-like domains 3 [Source:MGI Symbol;Acc:MGI:1329025])

HSP 1 Score: 133.265 bits (334), Expect = 9.789e-33
Identity = 99/329 (30.09%), Postives = 166/329 (50.46%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLG+  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L  +  ++GV+TQG  R    +++ S+ I+YS DG  +   K      + VF+GN D+ +   N F   I+A++++ +      H +LR+E+LGC+   C E LG     +  Y    SS  +         E     L  +G    W +   +++QW+Q+D+  P+ +T IIT+G  D  H  +V  Y++++SN+ ++W  +++  +           +   VF+GN D+++ + N +  P  ARF RI P +W  +I +R
Sbjct:  160 GPLGIEGGIISNQQITASSTHRALFGLQKWY----PYYARL---NKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQICRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWMVHQDEKQ-----------RKDKVFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLR 470          

HSP 2 Score: 92.0485 bits (227), Expect = 3.454e-19
Identity = 59/159 (37.11%), Postives = 93/159 (58.49%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM  G I+D QITASS       ++ +W    +  +ARL  + +  +W +     S+WLQVDL     ++G++TQG  D    Q+V S+ ++YS DG ++   +D+   + KVFQGN D+ + + N  +  I ARFI+   +S++G  +LR E+LGC
Sbjct:  322 PLGMKSGHIQDYQITASSVFRTLNMDMFTW----EPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWMVHQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLRSELLGC 476          
BLAST of Lactadherin vs. Ensembl Mouse
Match: Edil3 (EGF-like repeats and discoidin I-like domains 3 [Source:MGI Symbol;Acc:MGI:1329025])

HSP 1 Score: 132.88 bits (333), Expect = 1.117e-32
Identity = 99/329 (30.09%), Postives = 166/329 (50.46%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLG+  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L  +  ++GV+TQG  R    +++ S+ I+YS DG  +   K      + VF+GN D+ +   N F   I+A++++ +      H +LR+E+LGC+   C E LG     +  Y    SS  +         E     L  +G    W +   +++QW+Q+D+  P+ +T IIT+G  D  H  +V  Y++++SN+ ++W  +++  +           +   VF+GN D+++ + N +  P  ARF RI P +W  +I +R
Sbjct:  150 GPLGIEGGIISNQQITASSTHRALFGLQKWY----PYYARL---NKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQICRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWMVHQDEKQ-----------RKDKVFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLR 460          

HSP 2 Score: 92.0485 bits (227), Expect = 3.856e-19
Identity = 59/159 (37.11%), Postives = 93/159 (58.49%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM  G I+D QITASS       ++ +W    +  +ARL  + +  +W +     S+WLQVDL     ++G++TQG  D    Q+V S+ ++YS DG ++   +D+   + KVFQGN D+ + + N  +  I ARFI+   +S++G  +LR E+LGC
Sbjct:  312 PLGMKSGHIQDYQITASSVFRTLNMDMFTW----EPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWMVHQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLRSELLGC 466          
BLAST of Lactadherin vs. Ensembl Mouse
Match: F8 (coagulation factor VIII [Source:MGI Symbol;Acc:MGI:88383])

HSP 1 Score: 134.806 bits (338), Expect = 5.226e-32
Identity = 99/335 (29.55%), Postives = 153/335 (45.67%), Query Frame = 3
Query:  114 YEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTN-FHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILS--------------NKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            Y K+C    PLGM  G I+D QITAS      W  N     ARL Y  +  +W  K + FS W++VDL    ++ G+ TQG      + ++  F+I YS DG     Y  +  G+  VF GN DS  +KHN FN  I AR+I+ H        +LR+E++GC    C   LG+                  T +  + ++ +                 W  +  +  QW+Q+D+ +   +T IIT+G        +V E+ +S S +  +W     N +               VF+GN+DS++  +N L  P + R+ RIHP  W+ +I +R+
Sbjct: 2004 YSKQCQI--PLGMASGSIRDFQITASG-HYGQWAPNL----ARLHYSGSINAWSTK-EPFS-WIKVDLLAPMIVHGIKTQGARQKFSSLYISQFIIMYSLDGKKWLSYQGNSTGTLMVFFGNVDSSGIKHNSFNPPIIARYIRLHPTHSSIRSTLRMELMGCDLNSCSIPLGM--------ESKVISDTQITASSYFTNMFATWSPSQARLHLQGRTNAWRPQVNDPKQWLQVDLQKTMKVTGIITQGVKSLFTSMFVKEFLISSSQDGHHWTQILYNGKV-------------KVFQGNQDSSTPMMNSLDPPLLTRYLRIHPQIWEHQIALRL 2308          

HSP 2 Score: 90.1225 bits (222), Expect = 5.578e-18
Identity = 64/189 (33.86%), Postives = 94/189 (49.74%), Query Frame = 3
Query:   45 SNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASS---TELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDY-GSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ 590
            S +R  L+ C +   S+               PLGM    I D QITASS       +W      SQARL+L+ R  +W  +     +WLQVDL     ++G++TQG      + +V  F+IS S DG   H+ +  Y G  KVFQGN+DS +   N  +  +  R+++ H   +    +LR+EILGC+
Sbjct: 2147 STLRMELMGCDLNSCSI---------------PLGMESKVISDTQITASSYFTNMFATW----SPSQARLHLQGRTNAWRPQVNDPKQWLQVDLQKTMKVTGIITQGVKSLFTSMFVKEFLISSSQDG--HHWTQILYNGKVKVFQGNQDSSTPMMNSLDPPLLTRYLRIHPQIWEHQIALRLEILGCE 2314          
BLAST of Lactadherin vs. UniProt/SwissProt
Match: sp|P21956|MFGM_MOUSE (Lactadherin OS=Mus musculus OX=10090 GN=Mfge8 PE=1 SV=3)

HSP 1 Score: 172.94 bits (437), Expect = 7.247e-46
Identity = 115/325 (35.38%), Postives = 170/325 (52.31%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHI--LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            LGM  G I D QI+ASS       L+ W        ARLY      +W A       W+QV+L  +  +SGVMTQG  R   A+++ +F ++YS DG  F +I+D+ G  K F GN D+ S+K N FN  + A++IK +  S H   +LR E+LGC+   C E LG+     P  ++ +S S      R     Y H+  L N+G    W A+  +  +W+Q+D+G    +T IIT+G  D  H  YV  Y+V+ S++   W  Y+E   S              VF+GN D+NS K N   +PF+AR+ R+ P++W  +I +R+
Sbjct:  152 LGMEGGAIADSQISASSVYMGFMGLQRW----GPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRA-FGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGSS-------------KVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRL 458          

HSP 2 Score: 97.4413 bits (241), Expect = 4.671e-20
Identity = 60/155 (38.71%), Postives = 91/155 (58.71%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENR---KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D Q++ASS+  K+W          L  L+N+    +W A+  S  EWLQVDLGT+  ++G++TQG  D    Q+V S+ +++S DG  +  + ++ GS KVFQGN D+ S K N F     AR+++    S+H   +LR+E+LGC
Sbjct:  311 PLGLKNNTIPDSQMSASSS-YKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGVQWT-VYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGC 463          
BLAST of Lactadherin vs. UniProt/SwissProt
Match: sp|P70490|MFGM_RAT (Lactadherin OS=Rattus norvegicus OX=10116 GN=Mfge8 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 8.857e-45
Identity = 120/348 (34.48%), Postives = 178/348 (51.15%), Query Frame = 3
Query:   78 ICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGS-QKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCTEEYGHI--LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            IC   V       E  C+T   LG+  G I D QI+ASS       L+ W        ARLY      +W A       W+QVD   +  +SGVMTQG  R   A+++ +F ++YS DG  F +I+D+ G+  K F GN+D+ S+K N FN  + A++I+ +  S H   +LR E+LGC+   C E LG+     P  +I +S S      R     Y H+  L N+G    W A+  +  +W+Q+D+G    +T IIT+G  D  H  YV  Y+V+ S++   W  Y+E   S              VF+GN D+NS K N   +PF+AR+ R+ P++W  +I +R+
Sbjct:   95 ICQCPVGYSGIHCELGCST--KLGLEGGAIADSQISASSVYMGFMGLQRW----GPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLRA-FGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGTS-------------KVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRL 422          

HSP 2 Score: 97.8265 bits (242), Expect = 2.082e-20
Identity = 61/155 (39.35%), Postives = 91/155 (58.71%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENR---KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I D QITASS+  K+W          L  L+N+    +W A+  S  EWLQVDLGT+  ++G++TQG  D    Q+V S+ +++S DG  +  + ++ G+ KVFQGN D+ S K N F     AR+++    S+H   +LR+E+LGC
Sbjct:  275 PLGLKNNTIPDSQITASSS-YKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWT-VYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRLELLGC 427          
BLAST of Lactadherin vs. UniProt/SwissProt
Match: sp|P79385|MFGM_PIG (Lactadherin OS=Sus scrofa OX=9823 GN=MFGE8 PE=1 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 1.121e-38
Identity = 105/332 (31.63%), Postives = 163/332 (49.10%), Query Frame = 3
Query:  126 CNTVGPLGMIQGDIKDQQITASSTEL-----KSWRDNCKASQARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKD-DYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEE------YGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            CN   PLGM  G I D QI+ASS  L     + W        ARL+      +W A     + W+QV+L     ++GV+TQG  R   A+++ +F ++YSTDG  F +I+  +    K+F GN D+  +K N F   +  ++++      H   +LR E+LGC+   C E LG+     I +        +RT          +   L N+G    W A+  + ++W+QID+G    +T IIT+G  D  H  YV  Y+V++S++  +W  Y++                G +F GN D+NS K N    PF+ RF RI P+ W  +I +R+
Sbjct:   91 CNA--PLGMETGAIADFQISASSMHLGFMGLQRW----APELARLHRAGIVNAWTASNYDRNPWIQVNLLRRMRVTGVVTQGASRAGSAEYMKTFKVAYSTDGRKFQFIQGAEESGDKIFMGNLDNSGLKVNLFEVPLEVQYVRLVPIICHRGCTLRFELLGCELSGCAEPLGL-KDNTIPNKQITASSFYRTWGLSAFSWYPFYARLDNQGKFNAWTAQSNSASEWLQIDLGSQRRVTGIITQGARDFGHIQYVAAYKVAYSDDGVSWTEYRDQGA-----------LEGKIFPGNLDNNSHKKNMFETPFLTRFVRILPVAWHNRITLRV 404          

HSP 2 Score: 88.9669 bits (219), Expect = 1.516e-17
Identity = 56/156 (35.90%), Postives = 91/156 (58.33%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKA---SQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I ++QITASS   ++W  +  +     ARL  + +  +W A+  S SEWLQ+DLG++  ++G++TQG  D    Q+V ++ ++YS DG ++   +D    + K+F GN D+ S K N F      RF++    ++H   +LRVE+LGC
Sbjct:  255 PLGLKDNTIPNKQITASSF-YRTWGLSAFSWYPFYARLDNQGKFNAWTAQSNSASEWLQIDLGSQRRVTGIITQGARDFGHIQYVAAYKVAYSDDGVSWTEYRDQGALEGKIFPGNLDNNSHKKNMFETPFLTRFVRILPVAWHNRITLRVELLGC 409          
BLAST of Lactadherin vs. UniProt/SwissProt
Match: sp|Q95114|MFGM_BOVIN (Lactadherin OS=Bos taurus OX=9913 GN=MFGE8 PE=1 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 8.525e-38
Identity = 107/347 (30.84%), Postives = 168/347 (48.41%), Query Frame = 3
Query:   78 ICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTEL-----KSWRDNCKASQARLYLEN-RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGV----FPYXXXXXXXXXXXXXHRTCT-EEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            IC   +  +    E  C +  PLGM  G I D QI+ASS  L     + W        ARL+      +W +     + W+QV+L  +  ++GV+TQG  R   A+++ +F ++YSTDG  F +I+       K+F GN ++  +K N F+  +  ++++      H   +LR E+LGC+   C E LG+     P  +I +S           +   Y   L N+G    W A+  + ++W+QID+G    +T IIT+G  D  H  YV  Y+V++ ++   W  YK+   S              +F GN D+NS K N    PF ARF RI P+ W  +I +R+
Sbjct:   93 ICKCPLGYVGIHCETTCTS--PLGMQTGAIADSQISASSMHLGFMGLQRW----APELARLHQTGIVNAWTSGNYDKNPWIQVNLMRKMWVTGVVTQGASRAGSAEYLKTFKVAYSTDGRQFQFIQVAGRSGDKIFIGNVNNSGLKINLFDTPLETQYVRLVPIICHRGCTLRFELLGCELNGCTEPLGLKDNTIPNKQITASSYYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGAS-----------ESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHNRITLRV 422          

HSP 2 Score: 95.5153 bits (236), Expect = 1.432e-19
Identity = 59/156 (37.82%), Postives = 92/156 (58.97%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKA---SQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+    I ++QITASS   K+W  +  +     ARL  + +  +W A+  S SEWLQ+DLG++  ++G++TQG  D    Q+V ++ ++Y  DG  +   KD   S+ K+F GN D+ S K N F    +ARF++    ++H   +LRVE+LGC
Sbjct:  273 PLGLKDNTIPNKQITASS-YYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHNRITLRVELLGC 427          
BLAST of Lactadherin vs. UniProt/SwissProt
Match: sp|O18806|FA8_CANLF (Coagulation factor VIII OS=Canis lupus familiaris OX=9615 GN=F8 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 6.565e-36
Identity = 108/337 (32.05%), Postives = 155/337 (45.99%), Query Frame = 3
Query:  114 YEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARL-YLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFH-YIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILS--------------NKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNG--TVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            Y K+C T  PLGM  G I+D QITAS  +   W        ARL Y  +  +W  K   FS W++VDL    +I G+MTQG      + +V  F+I YS DG  +H Y  +  G+  VF GN DS  +KHN FN  I A++I+ H   +    +LR+E+LGC    C   LG+                  T +     +L+                 W  +  N  +W+Q+D  +   +T I T+G        YV E+ +S S +  NW  +               +QNG   VF+GN DS++   N L  P VAR+ R+HP +W   I +R+
Sbjct: 2028 YSKKCQT--PLGMASGHIRDFQITASG-QYGQWAPKL----ARLHYSGSINAWSTK-DPFS-WIKVDLLAPMIIHGIMTQGARQKFSSLYVSQFIIMYSLDGNKWHSYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIAQYIRLHPTHYSIRSTLRMELLGCDFNSCSMPLGM--------ESKAISDAQITASSYLSSMLATWSPSQARLHLQGRTNAWRPQANNPKEWLQVDFRKTMKVTGITTQGVKSLLISMYVKEFLISSSQDGHNWTLF---------------LQNGKVKVFQGNRDSSTPVRNRLEPPLVARYVRLHPQSWAHHIALRL 2332          

HSP 2 Score: 100.138 bits (248), Expect = 2.802e-20
Identity = 62/152 (40.79%), Postives = 84/152 (55.26%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDG--AQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM    I D QITASS  L S       SQARL+L+ R  +W  +  +  EWLQVD      ++G+ TQG      + +V  F+IS S DG N+     + G  KVFQGNRDS +   N     + AR+++ H  S+  H +LR+E+LGC
Sbjct: 2188 PLGMESKAISDAQITASSY-LSSMLATWSPSQARLHLQGRTNAWRPQANNPKEWLQVDFRKTMKVTGITTQGVKSLLISMYVKEFLISSSQDGHNWTLFLQN-GKVKVFQGNRDSSTPVRNRLEPPLVARYVRLHPQSWAHHIALRLEVLGC 2337          
BLAST of Lactadherin vs. TrEMBL
Match: A0A4S2LLD7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006732 PE=4 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 4.345e-162
Identity = 267/679 (39.32%), Postives = 389/679 (57.29%), Query Frame = 3
Query:   36 FFFSNMRFLLLSCVICVASVIL-------------IDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXXXXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPS---------------------------ERRSQFMKN------------------------------------ANKAVDGHTQWEM---------------DADDQQDSTNV----RIDRRINRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDL-------VENVDKISVFVDQYNSKGTNQFRKTSDL--LCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
             F S +  L L+  IC+   +L             +      EC    PLGMI G I + QITASST   SW   C    AR +  N  +WCAKFKS SEWLQ+DLG  A+++G+MTQGRGDG++WV SFM+SYS DG  + +I D Y +QK+F+GN DSF VKHNY ++ I+ARF+K HTY++H HPSLRVE++GCQPCK++LG+ PY +  +S S+G++  R+C  EYGH LSNK WC+++Q+  QW+QID+G P+ IT +I KGRGD K P YVT +++S+SN+++ WY+YK+ +   P            +F+GN +   E+I+YL  PF+AR+ R+HPINW+ +I MR+G+LGC+ KG C  GF ++N+ S C+AN+AYKK AW+  +++   KRN+  S S                           ERR+  + N                                    A+ AVDG T  E+                +DD   +++V     ++R + R     +CTVL+Y+      P WYV+L EQT V+GV+IY       + +  + +  D         EN++++SV+V+     GT     ++    LCG VT+ N+A+  P++HI C+QP++G+FVY++A GV+ R   +F A+LCEVMVY
Sbjct:    1 MFGSQVLHLFLTGWICLQPGVLRLTAALEGEHDAHVPTPLPSECENDNPLGMISGTIANWQITASSTYPSSWAKGCSEHNARPFRPNGLAWCAKFKSSSEWLQIDLGVRALVTGIMTQGRGDGSEWVTSFMVSYSDDGNQWKFITDQYANQKIFEGNTDSFMVKHNYLDEPIKARFVKIHTYTWHNHPSLRVELVGCQPCKQLLGIPPYARFAASSSRGQRVQRSCMPEYGHYLSNKAWCSRQQDVQQWLQIDVGPPTQITGVILKGRGDYKRPQYVTRFKLSYSNDTRLWYFYKDATPLDPR-----------LFEGNNELVPERIHYLTSPFIARYVRVHPINWRNRIAMRVGLLGCRQKGPCTTGFFRINNESSCVANLAYKKSAWLNPDSSNPQKRNLPTSLSSINHSYQKDAASPEEASTVVRGPVHRQERRAPMLANHRIGETQTSSSKSMLHFWSANGIRSSPLSGETGDPMASLAVDGWTGEELFTRNSTLTLRSSEGVMSDDPSPTSSVDKHANVERGLERGAVRHSCTVLEYRWPFVELPSWYVDLREQTEVSGVVIYTAGHGRAASQGSHWSPADTDDKLKATSENLERLSVYVESEPRSGTGTALSSTSTSNLCGFVTRLNDAIFNPRLHIPCRQPLLGRFVYVEARGVRGRWSQEFSALLCEVMVY 668          
BLAST of Lactadherin vs. TrEMBL
Match: A0A4S2LJG8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006732 PE=4 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 3.541e-161
Identity = 269/692 (38.87%), Postives = 395/692 (57.08%), Query Frame = 3
Query:   36 FFFSNMRFLLLSCVICVASVIL-------------IDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMW---WIQN----------GTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXXXXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPS---------------------------ERRSQFMKN------------------------------------ANKAVDGHTQWEM---------------DADDQQDSTNV----RIDRRINRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDL-------VENVDKISVFVDQYNSKGTNQFRKTSDL--LCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
             F S +  L L+  IC+   +L             +      EC    PLGMI G I + QITASST   SW   C    AR +  N  +WCAKFKS SEWLQ+DLG  A+++G+MTQGRGDG++WV SFM+SYS DG  + +I D Y +QK+F+GN DSF VKHNY ++ I+ARF+K HTY++H HPSLRVE++GCQPCK++LG+ PY +  +S S+G++  R+C  EYGH LSNK WC+++Q+  QW+QID+G P+ IT +I KGRGD K P YVT +++S+SN+++ WY+YK+ +   P +  +W   W+ +            +F+GN +   E+I+YL  PF+AR+ R+HPINW+ +I MR+G+LGC+ KG C  GF ++N+ S C+AN+AYKK AW+  +++   KRN+  S S                           ERR+  + N                                    A+ AVDG T  E+                +DD   +++V     ++R + R     +CTVL+Y+      P WYV+L EQT V+GV+IY       + +  + +  D         EN++++SV+V+     GT     ++    LCG VT+ N+A+  P++HI C+QP++G+FVY++A GV+ R   +F A+LCEVMVY
Sbjct:    1 MFGSQVLHLFLTGWICLQPGVLRLTAALEGEHDAHVPTPLPSECENDNPLGMISGTIANWQITASSTYPSSWAKGCSEHNARPFRPNGLAWCAKFKSSSEWLQIDLGVRALVTGIMTQGRGDGSEWVTSFMVSYSDDGNQWKFITDQYANQKIFEGNTDSFMVKHNYLDEPIKARFVKIHTYTWHNHPSLRVELVGCQPCKQLLGIPPYARFAASSSRGQRVQRSCMPEYGHYLSNKAWCSRQQDVQQWLQIDVGPPTQITGVILKGRGDYKRPQYVTRFKLSYSNDTRLWYFYKDATPLDPRST-VWSYEWVHHVEEDGHTKELEKLFEGNNELVPERIHYLTSPFIARYVRVHPINWRNRIAMRVGLLGCRQKGPCTTGFFRINNESSCVANLAYKKSAWLNPDSSNPQKRNLPTSLSSINHSYQKDAASPEEASTVVRGPVHRQERRAPMLANHRIGETQTSSSKSMLHFWSANGIRSSPLSGETGDPMASLAVDGWTGEELFTRNSTLTLRSSEGVMSDDPSPTSSVDKHANVERGLERGAVRHSCTVLEYRWPFVELPSWYVDLREQTEVSGVVIYTAGHGRAASQGSHWSPADTDDKLKATSENLERLSVYVESEPRSGTGTALSSTSTSNLCGFVTRLNDAIFNPRLHIPCRQPLLGRFVYVEARGVRGRWSQEFSALLCEVMVY 691          
BLAST of Lactadherin vs. TrEMBL
Match: G4VIR1 (Putative dock OS=Schistosoma mansoni OX=6183 GN=Smp_211020 PE=4 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.104e-150
Identity = 243/577 (42.11%), Postives = 370/577 (64.12%), Query Frame = 3
Query:  120 KECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMW---W----------IQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXXXXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNI-GYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRRINR---------KQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIY------NGNDILFSEKSENRAERDLVENVDKISVFVD-QYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
            KEC    PLGMI G I D QIT+SST   SW   C+   ARL+  N  +WCAKFKS SEWLQ+DLG +A+    MTQGRGDG++WV SFM+SYS D  ++ ++ D Y +QK+F+GN DS+SVKHNYF++ IRARF+K HTY++H HPSLRVE++GCQ CK+I+G+ PY +  +S S+GK+  R+CT EYGH LSNK WCA++Q+  QW+QID+G P+LIT +I K RGD K+  YVT +++S+SN+++ WY+YK+ +   P +  +W   W          I++  +F+GN +  +E+I+YL  PF+AR+ RIHP+ W+ +I MR+G+LGCK KG C  GF ++N+ S C+  +    + ++   ++ M    + G++  E     +KN+  +     +   DA D +  TN  ++++  +         ++   +CT+L+Y+      P WYV+L E   V GV+IY      +G  +L S        +   EN++++S++V+ +     T    ++S  LCG VT+ N+A+  P++HI C+QP++G++VY++A GV+ R   +F A+LCEVMVY
Sbjct:   45 KECENDDPLGMISGSIADWQITSSSTYPSSWVKGCEEKNARLFRTNGLAWCAKFKSSSEWLQIDLGVQAL----MTQGRGDGSEWVTSFMVSYSDDAMHWKFVTDQYANQKIFEGNSDSYSVKHNYFDEPIRARFVKIHTYTWHNHPSLRVELVGCQSCKQIIGIPPYARFAASSSRGKRSQRSCTPEYGHYLSNKAWCAQRQDALQWLQIDVGPPTLITGVILKSRGDVKNSQYVTRFKLSYSNDTRLWYFYKDAAPLDPRST-VWSFEWSQKMKESDDKIKSDKIFEGNNEQITERIHYLATPFIARYVRIHPVIWRSRIAMRVGLLGCKQKGSCSAGFFRINNESSCVNGMI--NEQFVGESSDGMALLAVDGWTGEE---ILLKNSTLSTRSSERLMNDAPDNKQLTNDSLNKKTIQNVVHTTFVTQKSAHSCTILEYRWPFVELPSWYVDLREHIEVKGVVIYTAGHGRDGRYLLSSLFGSEEKTKFNSENLERLSIYVESEPRHHDTKTLSRSSSSLCGFVTRINDAIFSPRLHIPCRQPLIGRYVYVEARGVRGRWSQEFAALLCEVMVY 611          
BLAST of Lactadherin vs. TrEMBL
Match: R7T411 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223186 PE=4 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 2.399e-144
Identity = 250/582 (42.96%), Postives = 351/582 (60.31%), Query Frame = 3
Query:  126 CNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYM-------W-WIQNGTV-------------------------FKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXXXXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMK-NANKAVDGHTQWEMDADDQQDSTNVRIDRRINRKQHMRTCTVLQYKTSSNY---NPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
            C+  GPLGMI GDI+D QITASST    W   C    AR+Y  N   WC+K+KS SEWLQ+DLG  A I+GVMTQGRGDG +WV SFM+SYS D  ++ Y+ D YG+Q+VF+GN DS++VKH+Y +D I ARFIKFHT  ++ HPS+RVEI+GCQ CK  + + PYGK+ +S  K  KK  +C  E G++L+NKGWCAK  N NQW+Q D+G P+L+T I+TKGRGD+    +VT +++++SN+++ WYYYK+ S   P   YM       W W ++GT                          F GN D + E+ +YL  PF ARF R HPI+W+  I MR G++GC   G+C  GF+++N  +PC+ N+A+KK++WI     + +KR+I       R+Q+M  +A +AVDG        DD Q                + +CT+L      N+    PIW V+LG++  +NGV I          +    + RD + N+DK+ V+VD   SKG  +     + +CG +++ N+AL KP +H+ C  PM G++VYI+A GV +R    F A+LCEV VY
Sbjct:   38 CDLTGPLGMISGDIQDWQITASSTYPSEWDKGCHERYARVYQPNGLGWCSKYKSSSEWLQIDLGVAAKITGVMTQGRGDGVEWVTSFMVSYSMDAFHWQYVSDQYGNQRVFEGNTDSYAVKHSYLDDAIVARFIKFHTVHWNRHPSMRVEIIGCQVCKAPIALPPYGKLTASSVKPYKKGSSCMAEDGYLLTNKGWCAKHNNANQWLQFDVGPPTLVTGIVTKGRGDTGRKHWVTRFRIAYSNDTRVWYYYKDASHLDP-KFYMLAMSQRHWSWRRSGTAPNTTADTNATAMFMIPDRESPEGLEFGGNMDKSIERFHYLNSPFTARFIRFHPIDWENHISMRAGLIGCPFTGECTDGFMRINKYTPCVENLAFKKESWIN--NRRHYKRHI-------RNQWMHGHAGRAVDG--------DDDQS---------------LHSCTILD-----NFYVEKPIWMVDLGKKADINGVRIVTWQG---QGQDPRTSYRDYMYNLDKLVVYVD---SKGGKEQVDLEENMCGFISRLNDALFKPTLHVQCTSPMQGRYVYIEAWGVPNRWSRLFSAVLCEVQVY 575          
BLAST of Lactadherin vs. TrEMBL
Match: K1QRH0 (Lactadherin OS=Crassostrea gigas OX=29159 GN=CGI_10015187 PE=4 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 3.594e-144
Identity = 244/563 (43.34%), Postives = 342/563 (60.75%), Query Frame = 3
Query:  126 CNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKE--NSESGPNNVYMW---------------WIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXX-XXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRRINRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
            C T GPLGMI G I+D QITASST    W   C    AR+YL N+  WCAK+KS SEWL+VDLG  A ++GVMTQGRGDG +WV SF +SYS D  N  Y+ D Y + +VF+GN D++SVKH Y +  I AR+IKFHT  +H HPS+RVEILGCQ CKE +G+ PYG+I +S +   K+  +C  E G+ILS KGWCAK+ N NQW+QID+G P+LIT ++TKGRGDSK   +VT +++S+SN+++ WY YK+  + +  P N ++W               +  +G +F GN D ++ +++Y+  PFVARF R HP+ W  KI MR G+LG     G CG+ F++VND +PC+ N+AYKK+AWI  +  K  KR++  SP   R       +KAVDG   +++ A                       CT+L         P+W V+LG +T+V+G+IIY   +       E  A +D + N+D++ ++VD  N          S  +CG V+K N AL   K+H+ C +P  G++V ++A G  +     F A+LCEV+VY
Sbjct:   18 CVTNGPLGMITGSIQDWQITASSTYPHEWDKKCAEKYARVYLPNKYGWCAKYKSSSEWLKVDLGVAARVTGVMTQGRGDGKEWVTSFKVSYSMDDYNELYVTDQYSNHRVFEGNTDAYSVKHTYLDRPIIARYIKFHTVHWHRHPSMRVEILGCQLCKESIGLPPYGRITTSSNGKNKRKDSCQPEDGNILSKKGWCAKRNNVNQWLQIDVGPPTLITGVMTKGRGDSKKKHWVTRFKISYSNDTQRWYQYKDAHSVDPRPQNPWLWNPLFNRTTAQLIPDIYTDDGLLFGGNNDKDTVRVHYINSPFVARFIRFHPLEWNGKISMRAGLLGCPHTAGNCGESFMRVNDDTPCVENLAYKKEAWINGKNPK--KRHV--SPKIDRGH----PDKAVDGKIDFDLHA-----------------------CTILDNLYGD--TPVWTVDLGAKTSVSGIIIYTWQESEGQMVKEGTAMKDYLNNLDRLVIYVD--NKSKAEDASSVSGNMCGYVSKLNGALLSHKIHVQCVRPQKGRYVLVEAWGSHNSWSRLFSAVLCEVLVY 545          
BLAST of Lactadherin vs. Ensembl Cavefish
Match: edil3b (EGF-like repeat and discoidin I-like domain-containing protein 3 [Source:NCBI gene;Acc:103036235])

HSP 1 Score: 149.058 bits (375), Expect = 2.124e-38
Identity = 107/346 (30.92%), Postives = 171/346 (49.42%), Query Frame = 3
Query:   93 VILIDADYEK-ECNTVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCT------EEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            +IL     E+  C   GPLGM  G I +QQITASST      L+ W     A  ARL   NR+    +W       + WLQV+L     ++G++TQG  R    ++V S+ ++YS DG  +  +K  +     +F GN D+ S   ++F+  I A++I+ +  S   H +LR E+LGC+   C E +G+   G I          H+T        +     L  +G    W   + +++QW+Q+D+  P+ +T IIT+G  D  H  +V  +++ FSN+ + W  Y++ S+               +F+GN D+ + + N +  P  ARF RI P +W  +I MR
Sbjct:  118 LILTPPTKERCACECSGPLGMEGGIISNQQITASSTLHALFGLQKWH----AHLARL---NRRGLINAWSPAESDRAPWLQVNLERRLRVTGLITQGAKRIGSPEFVKSYKVAYSDDGKTWSTVKLKNTEEDMIFTGNTDNNSPAESHFSPPIEAQYIRIYPQSCRKHCTLRAELLGCELTGCSEPMGM-KTGHIQDDQISSSSVHQTLNINMFSWQPSKARLDKQGKVNAWTPAQNDQSQWLQVDLLLPTKVTGIITQGAKDFGHVQFVGSFKLGFSNDGEKWSIYQDESQ-----------HRDKIFQGNSDNETHRKNVIDPPIYARFLRIIPWSWYGRITMR 444          

HSP 2 Score: 90.5077 bits (223), Expect = 9.033e-19
Identity = 57/167 (34.13%), Postives = 92/167 (55.09%), Query Frame = 3
Query:  126 CNTVG---PLGMIQGDIKDQQITASSTE------LKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            C   G   P+GM  G I+D QI++SS        + SW    + S+ARL  + +  +W       S+WLQVDL     ++G++TQG  D    Q+V SF + +S DG  +   +D+   + K+FQGN D+ + + N  +  I ARF++   +S++G  ++R E+LGC
Sbjct:  288 CELTGCSEPMGMKTGHIQDDQISSSSVHQTLNINMFSW----QPSKARLDKQGKVNAWTPAQNDQSQWLQVDLLLPTKVTGIITQGAKDFGHVQFVGSFKLGFSNDGEKWSIYQDESQHRDKIFQGNSDNETHRKNVIDPPIYARFLRIIPWSWYGRITMRAELLGC 450          
BLAST of Lactadherin vs. Ensembl Cavefish
Match: edil3b (EGF-like repeat and discoidin I-like domain-containing protein 3 [Source:NCBI gene;Acc:103036235])

HSP 1 Score: 144.821 bits (364), Expect = 4.539e-37
Identity = 108/353 (30.59%), Postives = 171/353 (48.44%), Query Frame = 3
Query:  102 IDADYEKEC-----------NTVGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCT------EEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            + ADY  EC              GPLGM  G I +QQITASST      L+ W     A  ARL   NR+    +W       + WLQV+L     ++G++TQG  R    ++V S+ ++YS DG  +  +K  +     +F GN D+ S   ++F+  I A++I+ +  S   H +LR E+LGC+   C E +G+   G I          H+T        +     L  +G    W   + +++QW+Q+D+  P+ +T IIT+G  D  H  +V  +++ FSN+ + W  Y++ S+               +F+GN D+ + + N +  P  ARF RI P +W  +I MR
Sbjct:  103 LAADYSCECPREYAGKNCQYKCSGPLGMEGGIISNQQITASSTLHALFGLQKWH----AHLARL---NRRGLINAWSPAESDRAPWLQVNLERRLRVTGLITQGAKRIGSPEFVKSYKVAYSDDGKTWSTVKLKNTEEDMIFTGNTDNNSPAESHFSPPIEAQYIRIYPQSCRKHCTLRAELLGCELTGCSEPMGM-KTGHIQDDQISSSSVHQTLNINMFSWQPSKARLDKQGKVNAWTPAQNDQSQWLQVDLLLPTKVTGIITQGAKDFGHVQFVGSFKLGFSNDGEKWSIYQDESQ-----------HRDKIFQGNSDNETHRKNVIDPPIYARFLRIIPWSWYGRITMR 436          

HSP 2 Score: 88.9669 bits (219), Expect = 2.777e-18
Identity = 55/159 (34.59%), Postives = 90/159 (56.60%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTE------LKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM  G I+D QI++SS        + SW    + S+ARL  + +  +W       S+WLQVDL     ++G++TQG  D    Q+V SF + +S DG  +   +D+   + K+FQGN D+ + + N  +  I ARF++   +S++G  ++R E+LGC
Sbjct:  288 PMGMKTGHIQDDQISSSSVHQTLNINMFSW----QPSKARLDKQGKVNAWTPAQNDQSQWLQVDLLLPTKVTGIITQGAKDFGHVQFVGSFKLGFSNDGEKWSIYQDESQHRDKIFQGNSDNETHRKNVIDPPIYARFLRIIPWSWYGRITMRAELLGC 442          
BLAST of Lactadherin vs. Ensembl Cavefish
Match: f5 (venom prothrombin activator omicarin-C non-catalytic subunit [Source:NCBI gene;Acc:103032429])

HSP 1 Score: 136.346 bits (342), Expect = 1.217e-32
Identity = 101/322 (31.37%), Postives = 148/322 (45.96%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIK-DDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHI-------LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            PLG+I G +KD QITAS +     R     S ARL+   + +  +  KS  EW+QVD     VIS V TQG      + +V+++ ISYSTD   + + K D   ++K F+GNR++  VK N F   I  RFI+ H    +  P++R+E  GC+   C   LG+    +               T  Y          L  +G    W AK  +   W+QI++     IT I+T+G        +VT Y + +S +   W  Y ++ +               +F GN D+N    NY+  P  +RF RI P  W+  I MRI
Sbjct: 1737 PLGLISGTVKDSQITASDS-----RSYWLPSLARLHNTGKYNAWSTTKS-GEWIQVDFQRPVVISKVATQGAKQFLTSHYVLNYTISYSTDRKRWIFYKADSKAARKTFEGNREAHEVKENIFFPPIIGRFIRLHPSHSYNFPTVRMEFYGCELDGCSVPLGM----QRNVIQDHQITASSVSTSWYSGPWHPWFARLDKQGSVNAWQAKSNDMQPWLQIELKAVKKITGIVTQGAKSLGTEMFVTAYVLEYSEDGNRWIKYTDDED-----------YEQKIFTGNTDNNGHVKNYIYPPIFSRFIRIIPKRWQNSITMRI 2037          

HSP 2 Score: 78.5666 bits (192), Expect = 1.549e-14
Identity = 52/153 (33.99%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG-RGDGAQ-WVVSFMISYSTDGTN-FHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM +  I+D QITASS     +        ARL  +    +W AK      WLQ++L     I+G++TQG +  G + +V ++++ YS DG     Y  D+   QK+F GN D+     NY    I +RFI+     +    ++R+E+LGC
Sbjct: 1890 PLGMQRNVIQDHQITASSVSTSWYSGPWHPWFARLDKQGSVNAWQAKSNDMQPWLQIELKAVKKITGIVTQGAKSLGTEMFVTAYVLEYSEDGNRWIKYTDDEDYEQKIFTGNTDNNGHVKNYIYPPIFSRFIRIIPKRWQNSITMRIELLGC 2042          
BLAST of Lactadherin vs. Ensembl Cavefish
Match: f8 (coagulation factor VIII, procoagulant component [Source:ZFIN;Acc:ZDB-GENE-090629-2])

HSP 1 Score: 135.961 bits (341), Expect = 1.365e-32
Identity = 101/330 (30.61%), Postives = 146/330 (44.24%), Query Frame = 3
Query:  114 YEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQ----WVVSFMISYSTDGTNFH-YIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSN-------KGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            Y   C  V PLGM  G I D QIT S         N +A  ARL L     +W    +    W+QVDL    V+ G+ TQG     +    + V F ISYS D   +  Y  +   +   F GN D + +K N+FN  I  R+I+ H  +F   P+LR+E+LGC    C   LG+     I +S       H+     +   L+          W  K  N ++W+Q+D+     +T I+T+G         VTE+ VS S++ + W    E                  +F+GN D+ +EK+N L  P   RF R+HP  W   I +R+
Sbjct: 1401 YNPRC--VQPLGMQSGWIDDDQITESDH-----YGNWEARLARLELSGSINAWIGNGQG--SWMQVDLLRPMVVHGIQTQGVKTSMRLSEMFAVIFTISYSLDQETWKTYRGNSSEAAYKFNGNMDGYRIKDNFFNPPIIGRYIRIHPLTFGTRPALRLELLGCDLNSCSLPLGM-ERRLIQNSRISASSFHQNWMLSWSPDLARLKQEGRANAWRPKSNNPHEWLQVDLEVVKRVTGILTQGAKSMLTHMMVTEFTVSVSDDGRTWSPVTEQG-----------THREQIFEGNSDAYAEKLNLLEPPLFTRFIRLHPKGWINDIALRL 1709          

HSP 2 Score: 78.1814 bits (191), Expect = 1.791e-14
Identity = 50/153 (32.68%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM +  I++ +I+ASS   ++W  +     ARL  E R  +W  K  +  EWLQVDL     ++G++TQG         V  F +S S DG  +  + +     +++F+GN D+++ K N     +  RFI+ H   +    +LR+E LGC
Sbjct: 1563 PLGMERRLIQNSRISASSFH-QNWMLSWSPDLARLKQEGRANAWRPKSNNPHEWLQVDLEVVKRVTGILTQGAKSMLTHMMVTEFTVSVSDDGRTWSPVTEQGTHREQIFEGNSDAYAEKLNLLEPPLFTRFIRLHPKGWINDIALRLEFLGC 1714          
BLAST of Lactadherin vs. Ensembl Cavefish
Match: mfge8b (lactadherin-like [Source:NCBI gene;Acc:103047215])

HSP 1 Score: 123.635 bits (309), Expect = 1.094e-29
Identity = 91/350 (26.00%), Postives = 162/350 (46.29%), Query Frame = 3
Query:  102 IDADYEKECNT-----------VGPLGMIQGDIKDQQITASST-----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFH-YIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYG-----HILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            +D D+  +C++           +  +GM  G I + QI+ASS       L+ W        ARL  +    +W +     + W+Q+++  +   +G++TQG  R   A+++ SF ++ S DG  +  Y  +   +  +F GN D+ S K N F+  I A++I+          +LR+E++GC+   C E LG                      E +        L  +G    W A   +K++W+Q+D+  P  IT IIT+G  D  +  +V+ +++++S++ ++W   K++             +   +F GN D+N  K N    PF ARF R+ P  W E+I +R+
Sbjct:  132 LDGDFTCKCSSPFVGKHCQLRCISLMGMEGGGIAESQISASSVYYGILGLQRW----GPELARLNNKGLVNAWTSATHDKNPWIQINMQRKMRFTGIITQGASRMGSAEFIRSFKVASSLDGRTYTLYRAEGKKTDTIFAGNVDNDSTKTNLFDPPIIAQYIRILPVVCRKACTLRMELVGCELNGCSEPLGFKSRLISDRQLVSSSSFSTWGIEAFTWHPHYARLDKQGKTNAWTAATNSKSEWLQVDLLSPKRITGIITQGAKDFGNVQFVSAFKIAYSDDGQHWTVVKDDK-----------TRTDKIFPGNSDNNVHKKNVFEPPFYARFVRVLPWAWHERITLRM 466          

HSP 2 Score: 89.7373 bits (221), Expect = 1.627e-18
Identity = 59/159 (37.11%), Postives = 89/159 (55.97%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG     I D+Q+ +SS+      E  +W  +     ARL  + +  +W A   S SEWLQVDL +   I+G++TQG  D    Q+V +F I+YS DG ++  +KDD   + K+F GN D+   K N F     ARF++   +++H   +LR+E+LGC
Sbjct:  317 PLGFKSRLISDRQLVSSSSFSTWGIEAFTWHPH----YARLDKQGKTNAWTAATNSKSEWLQVDLLSPKRITGIITQGAKDFGNVQFVSAFKIAYSDDGQHWTVVKDDKTRTDKIFPGNSDNNVHKKNVFEPPFYARFVRVLPWAWHERITLRMELLGC 471          
BLAST of Lactadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007561.1 (pep scaffold:Pmarinus_7.0:GL479407:10781:33713:1 gene:ENSPMAG00000006808.1 transcript:ENSPMAT00000007561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 6.682e-27
Identity = 91/333 (27.33%), Postives = 152/333 (45.65%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASSTEL-KSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQG----RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ----PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILS-NKGWCAKKQNK---NQWIQIDIGQPSLITAIITKG-RGD------SKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINW-KEKIGMRI 1058
            +CN   PLGM  G ++  +I ASST   + W    +  QARL+      W        EW+QVDLG+  ++SGV TQG          +V SF +  S+ G ++  ++    + K F GN D+ SV  N   + +  RF++    ++ G  +LR E+ GC     PC E LGV       ++ S   +           +L+  +GW          ++W+Q+D+G    +  +I +G RGD       + P +V +++V FS +   W+   ++  S P            +F G+ + +  ++    EP  AR  R++P  W    IG+R+
Sbjct:  201 QCNQ--PLGMESGKVEVDRIVASSTHSSRMW----QPWQARLH-NPINGWTPSRDDPREWIQVDLGSLKLLSGVATQGAVSHESQIGYFVSSFRLEVSSLGADWTVLRGSR-AVKAFAGNVDATSVVENRLAEPVLTRFVRIRPQTWEGGIALRFELYGCSLADFPCLETLGVGQGHVPDNALSASSQWSPPWGAHAARLLAPQRGWAPHMAGLFSFDEWLQVDLGSLFTVRGVILQGVRGDLGTQDKPEGPLFVKKFRVGFSEDGDTWHMVTDDESSQPK-----------IFNGSSNVDLPEMRKF-EPVEARLVRVYPERWSPHGIGLRL 513          

HSP 2 Score: 83.1889 bits (204), Expect = 8.832e-17
Identity = 60/164 (36.59%), Postives = 86/164 (52.44%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWC---AKFKSFSEWLQVDLGTEAVISGVMTQG-RGD--------GAQWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHT--YSFHGHPSLRVEILGCQ 590
            LG+ QG + D  ++ASS     W     A  ARL L  ++ W    A   SF EWLQVDLG+   + GV+ QG RGD        G  +V  F + +S DG  +H + DD  SQ K+F G+ +    +   F + + AR ++ +   +S HG   LR+E+LGCQ
Sbjct:  363 LGVGQGHVPDNALSASS----QWSPPWGAHAARL-LAPQRGWAPHMAGLFSFDEWLQVDLGSLFTVRGVILQGVRGDLGTQDKPEGPLFVKKFRVGFSEDGDTWHMVTDDESSQPKIFNGSSNVDLPEMRKF-EPVEARLVRVYPERWSPHGI-GLRLELLGCQ 519          
BLAST of Lactadherin vs. Ensembl Sea Lamprey
Match: EDIL3 (EGF like repeats and discoidin domains 3 [Source:HGNC Symbol;Acc:HGNC:3173])

HSP 1 Score: 106.686 bits (265), Expect = 9.281e-25
Identity = 96/352 (27.27%), Postives = 145/352 (41.19%), Query Frame = 3
Query:  102 IDADYEKECN-----------TVGPLGMIQGDIKDQQITASS-----TELKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDY-GSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILGVFPYXXXXXXXXXXXXXHRTCT----EEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            +DADY  EC               PLG+  GDI+D QITASS       L+ W      S ARL   NR     +W    +    W+QV+L     ++GV+TQG  R   A++V +F +++S DG N+   +D   G  KVF GN+D+ S + N  +  I A  ++    +     +LR+E+LGC+   C E LG+       +  S              E +   L  +G    W A K + NQW+Q+ +        +  + R            Q+                                 F GN D+NS K N    P +AR+ R+ P +W  +I +R+
Sbjct:  147 LDADYSCECTGEFMGKDCHLRCWSPLGLEGGDIRDDQITASSLLVAVMGLQRW----LPSLARL---NRAGIVNAWTPAQRDSQPWIQVNLERRLRVTGVVTQGASRFGSAEYVRTFKLAHSGDGRNWTVYRDAATGRDKVFLGNQDNGSPRSNTLSPPIVASLVRLMPLTCRRRCTLRMELLGCETNGCSEPLGLKSGLVGDTQISASSVFQTLLPCWTWEPHLARLDRQGRINAWSAAKGDPNQWLQVCV--------LEAQKRTCCFVCVCFFFLQI---------------------------------FAGNYDNNSHKKNMFNPPIIARYVRVLPYSWYRRITLRV 450          
BLAST of Lactadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004027.1 (pep scaffold:Pmarinus_7.0:GL481210:3001:5030:1 gene:ENSPMAG00000003685.1 transcript:ENSPMAT00000004027.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 8.323e-22
Identity = 60/157 (38.22%), Postives = 88/157 (56.05%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST----ELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGA--QWVVSFMISYSTDGTNFHYIKDDYGSQ-KVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLG+  G + D QI+ASS      L  W    +   ARL  + R  +W A     ++WLQ+DLG    I+G++TQG  D    Q+V S+ ++ S DG  +   KDD   + K+F GN D+ S K N FN  I AR+++   YS++   +LRVE++GC
Sbjct:    5 PLGLKSGLVGDTQISASSVFQTLGLPCW--TWEPHLARLDRQGRINAWSAAKGDPNQWLQIDLGEARKITGIVTQGARDLGHMQFVRSYRVASSEDGAAWTVYKDDETRRDKIFAGNYDNNSHKKNMFNPPIIARYVRVLPYSWYRRITLRVELIGC 159          

HSP 2 Score: 84.3445 bits (207), Expect = 2.654e-19
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  708 GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
             W A K + NQW+QID+G+   IT I+T+G  D  H  +V  Y+V+ S +   W  YK++             +   +F GN D+NS K N    P +AR+ R+ P +W  +I +R+
Sbjct:   49 AWSAAKGDPNQWLQIDLGEARKITGIVTQGARDLGHMQFVRSYRVASSEDGAAWTVYKDDE-----------TRRDKIFAGNYDNNSHKKNMFNPPIIARYVRVLPYSWYRRITLRV 154          
BLAST of Lactadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001939.1 (pep scaffold:Pmarinus_7.0:GL476444:333387:405756:1 gene:ENSPMAG00000001736.1 transcript:ENSPMAT00000001939.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 9.503e-22
Identity = 81/319 (25.39%), Postives = 145/319 (45.45%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASST-ELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGR----GDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ----PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNK-GWCAKKQNK-----NQWIQIDIGQPSLITAIITKGRGDSKHP---TYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHP 1025
            +CN   PLGM   +I+D+QITASS    K W       QARL      +W     S  EW+Q DLG   ++SG+ TQG        + +V S+ +  S++G ++  +K+   +  + + N D+ S+  N F++ +  RF++    S+    +LR E+ GC     PC  +LG+              ++          +LS+  GW     +       +W+Q+++G    +  II +G      P    +V +++++ S + + W    E+    P            +F+GN + ++ ++    EP VA + RI+P
Sbjct:  192 KCNQ--PLGMESLEIRDEQITASSMYPNKEWMPK----QARLN-NPVHAWTPAADSNKEWIQADLGYLKILSGIATQGAISKDSKKSYYVTSYKMEVSSNGDDWMMLKEGI-TIIILRNNSDASSLVENKFSEPVLTRFVRVRPRSWENGIALRFELYGCHISDYPCSGMLGMLSGRIQDGQLQSSSQRGLNWAPSSARLLSSAYGWAPMPPHGASHPVGEWLQVELGGRHTVRGIILQGAKSGTVPDNRLHVRKFRLATSLDGETWEMISEDDSDLPK-----------LFEGNSNYDTPELRKF-EPVVASWVRIYP 490          

HSP 2 Score: 62.003 bits (149), Expect = 2.722e-10
Identity = 34/118 (28.81%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  711 WCAKKQNKNQWIQIDIGQPSLITAIITKG--RGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            W     +  +WIQ D+G   +++ I T+G    DSK   YVT Y++  S+N  +W   KE                  + + N D++S   N   EP + RF R+ P +W+  I +R 
Sbjct:  234 WTPAADSNKEWIQADLGYLKILSGIATQGAISKDSKKSYYVTSYKMEVSSNGDDWMMLKEGITI-------------IILRNNSDASSLVENKFSEPVLTRFVRVRPRSWENGIALRF 338          
BLAST of Lactadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003059.1 (pep scaffold:Pmarinus_7.0:GL476485:229541:264028:1 gene:ENSPMAG00000002790.1 transcript:ENSPMAT00000003059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 1.589e-21
Identity = 86/345 (24.93%), Postives = 149/345 (43.19%), Query Frame = 3
Query:  111 DYEKECNTVGPLGMIQGDIKDQQITASST-ELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGR----GDGAQ-WVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ----PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG---WCAKKQNKNQWIQIDIGQPSLITAIITKG---------------RGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKE-KIGMRI 1058
            D   E   + PLGM  G+I D+QI+AS     + WR    A Q RL+        A  +S  EWLQVDL    ++  V TQG       G   +V +F + YST G+++   +D     KV QGNRD   V  + F + + AR+++     +HG   LR+E+ GC     PC E+LG+          S    +            + +     C    NK  W+ +D+G    ++ ++ +G                 +++   +V  +++  S + ++W   ++ + +              +F GN +++  ++  +    +ARF R+ P  W    IG+R+
Sbjct:  235 DRHGEGACMRPLGMESGEILDEQISASPGFYAEQWR----AEQTRLHRAGAACIHAPTESAREWLQVDLRFVRLLGAVATQGALASNSTGVPCFVTAFRLEYSTSGSDWTVYRD-VEKNKVIQGNRDDGGVALHRFAEAVVARYVRVKPVRWHGGLGLRLELYGCHISDAPCSEMLGLVSGEIGDRQLSASSSRDARWAPPLAPPAAGRSLLFLCQFYLNKF-WLNVDLGTTRQVSGLLLQGAKIGPTKRRRPPLRLPLETESKVFVRSFRLQLSLDGESWAGVQDPAGA------------DKIFPGNSNADKPELRQINAT-LARFLRLFPEKWSTNGIGVRL 560          

HSP 2 Score: 62.3882 bits (150), Expect = 2.210e-10
Identity = 49/168 (29.17%), Postives = 80/168 (47.62%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQ-ARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQ-----------------WVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKF--HTYSFHGHPSLRVEILGC 587
            LG++ G+I D+Q++ASS+    W          R  L   + +  KF     WL VDLGT   +SG++ QG   G                   +V SF +  S DG ++  ++D  G+ K+F GN ++   +    N  + ARF++     +S +G   +R+E+LGC
Sbjct:  405 LGLVSGEIGDRQLSASSSRDARWAPPLAPPAAGRSLLFLCQFYLNKF-----WLNVDLGTTRQVSGLLLQGAKIGPTKRRRPPLRLPLETESKVFVRSFRLQLSLDGESWAGVQDPAGADKIFPGNSNADKPELRQINATL-ARFLRLFPEKWSTNGI-GVRLEVLGC 565          
BLAST of Lactadherin vs. Ensembl Nematostella
Match: EDO29609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T356])

HSP 1 Score: 160.999 bits (406), Expect = 1.123e-42
Identity = 109/322 (33.85%), Postives = 166/322 (51.55%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-------SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ-----PCKEILGVFPYXXXXXXXXXXXXXH-----RTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            LG+  G IKD Q+TASS     W +N  A+ ARL   NR+       +W AK  +  +WLQVDLG  + +  V TQGR D  QWV ++ ++YS DG  F Y        KV  GN+D  +V   +    I AR+++F+  ++HGH S+RVE+ GC+     P  +          +++ S+    H     R  T   GH +    W A+  N  QW+QID+G+ + +TAI+T+GR D     +VT+Y++ +S N  +++ Y                 +G VF+GN D NS+  + L+   +AR+ R+ P  W   I MR+
Sbjct:  214 LGVQSGFIKDAQMTASSI----WDNNHGAANARL---NRQKIGARTGAWSAKHNNRLQWLQVDLGKLSKVVKVATQGRQDLNQWVTTYKLAYSRDGVLFKYFP------KVLSGNKDRNTVV-THSVGPIYARYVRFYPQTWHGHISMRVELYGCRRGFVDPLVKCAAPLKKKTKVTASSQWDANHSPERSRLDTIRQGHKIG--AWSARHNNIAQWLQIDLGKATKVTAIVTQGRSDLDQ--WVTQYKLEYSQNRVHFHSY----------------LSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHISMRV 501          

HSP 2 Score: 129.798 bits (325), Expect = 5.791e-32
Identity = 94/316 (29.75%), Postives = 149/316 (47.15%), Query Frame = 3
Query:  168 KDQQITASSTELKSWRDNCKASQARL--YLENRK--SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ---------PCKEILGV---FPYXXXXXXXXXXXXXHRTCTEEYGH--ILSNKG-WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            K  ++TASS     W  N    ++RL    +  K  +W A+  + ++WLQ+DLG    ++ ++TQGR D  QWV  + + YS +  +FH     Y S KVFQGN D  S   +     I AR+I+    ++H H S+RV + GC+          CK  LGV   F     +++ S     H           I +  G W AK  N+ QW+Q+D+G+ S +  + T+GR D     +VT Y++++S +   + Y+ +                  V  GN+D N+  + +   P  AR+ R +P  W   I MR+
Sbjct:   63 KKTKVTASS----QWDANHSPERSRLDTIRQGHKIGAWSARHNNIAQWLQIDLGKATKVTAIVTQGRSDLDQWVTQYKLEYSQNRVHFH----SYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHISMRVGLYGCRKGFKPPPLWSCKHTLGVQSGFIKDAQMTASSIWDNNHGAANARLNRQKIGARTGAWSAKHNNRLQWLQVDLGKLSKVVKVATQGRQDLNQ--WVTTYKLAYSRDGVLFKYFPK------------------VLSGNKDRNTV-VTHSVGPIYARYVRFYPQTWHGHISMRV 349          

HSP 3 Score: 89.3521 bits (220), Expect = 1.011e-18
Identity = 54/157 (34.39%), Postives = 83/157 (52.87%), Query Frame = 3
Query:  135 VGPLGMIQGDIKDQ-QITASSTELKSWRDNCKASQARL--YLENRK--SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ 590
            V PL      +K + ++TASS     W  N    ++RL    +  K  +W A+  + ++WLQ+DLG    ++ ++TQGR D  QWV  + + YS +  +FH     Y S KVFQGN D  S   +     I AR+I+    ++H H S+RV + GC+
Sbjct:  359 VDPLVKCAAPLKKKTKVTASS----QWDANHSPERSRLDTIRQGHKIGAWSARHNNIAQWLQIDLGKATKVTAIVTQGRSDLDQWVTQYKLEYSQNRVHFH----SYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHISMRVGLYGCR 507          
BLAST of Lactadherin vs. Ensembl Nematostella
Match: EDO46788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP38])

HSP 1 Score: 160.614 bits (405), Expect = 2.188e-41
Identity = 110/322 (34.16%), Postives = 165/322 (51.24%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-------SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ-----PCKEILGVFPYXXXXXXXXXXXXXH-----RTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            LG+  G IKD Q+TASS     W +N  A+ ARL   NR+       +W AK     +WLQVDLG  + +  V TQGR D  QWV ++ ++YS DG  F Y        KV  GN+D  +V  +     I AR+++FH  ++HGH S+RVE+ GC+     P  +          +++ S+    H     R  T   GH +    W A+  N  QW+QID+G+ + +TAI+T+GR D     +VT+Y++ +S N  +++ Y                 +G VF+GN D NS+  + L+   +AR+ R+ P  W   I MR+
Sbjct:  293 LGVQSGFIKDAQMTASSI----WDNNHGAANARL---NRQKIGAITGAWSAKQNDRLQWLQVDLGKLSKVVKVATQGRQDLNQWVTTYKLAYSRDGVLFKYFP------KVLSGNKDRNTVVTHSVGT-IYARYVRFHPQTWHGHISMRVELYGCRRGFVAPPVKCAAPLEKKNKVTASSQWDANHSPERSRLDTIRQGHKIG--AWSARHNNIAQWLQIDLGKATKVTAIVTQGRSDLDQ--WVTQYKLEYSQNRVHFHSY----------------LSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHTHISMRV 580          

HSP 2 Score: 129.413 bits (324), Expect = 2.957e-31
Identity = 97/330 (29.39%), Postives = 156/330 (47.27%), Query Frame = 3
Query:  135 VGPLGMIQGDIKDQ-QITASSTELKSWRDNCKASQARL--YLENRK--SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ---------PCKEILGV---FPYXXXXXXXXXXXXXH-----RTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            V PL      +K + ++TASS     W  N    ++RL    +  K  +W A+  + ++WLQ+DLG    ++ ++TQGR D  QWV  + + YS +  +FH     Y S KVFQGN D  S   +     I AR+I+    ++H H S+RV + GC+          CK  LGV   F     +++ S     H     R   ++ G I     W AK+ ++ QW+Q+D+G+ S +  + T+GR D     +VT Y++++S +   + Y+ +                  V  GN+D N+  + +      AR+ R HP  W   I MR+
Sbjct:  130 VDPLVKCAAPLKKKTKVTASS----QWDANHSPERSRLDTIRQGHKIGAWSARHNNIAQWLQIDLGKATKVTAIVTQGRSDLDQWVTQYKLEYSQNRVHFH----SYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHISMRVGLYGCRKGFKPPPLWSCKHTLGVQSGFIKDAQMTASSIWDNNHGAANARLNRQKIGAITG--AWSAKQNDRLQWLQVDLGKLSKVVKVATQGRQDLNQ--WVTTYKLAYSRDGVLFKYFPK------------------VLSGNKDRNTV-VTHSVGTIYARYVRFHPQTWHGHISMRV 428          

HSP 3 Score: 125.946 bits (315), Expect = 4.466e-30
Identity = 93/316 (29.43%), Postives = 148/316 (46.84%), Query Frame = 3
Query:  168 KDQQITASSTELKSWRDNCKASQARL--YLENRK--SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ---------PCKEILGV---FPYXXXXXXXXXXXXXHRTCTEEYGH--ILSNKG-WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            K  ++TASS     W  N    ++RL    +  K  +W A+  + ++WLQ+DLG    ++ ++TQGR D  QWV  + + YS +  +FH     Y S KVFQGN D  S   +     I AR+I+    ++H H S+RV + GC+          CK  LGV   F     +++ S     H           I +  G W AK  ++ QW+Q+D+G+ S +  + T+GR D     +VT Y++++S +   + Y+ +                  V  GN+D N+  + +      AR+ R HP  W   I MR+
Sbjct:  450 KKNKVTASS----QWDANHSPERSRLDTIRQGHKIGAWSARHNNIAQWLQIDLGKATKVTAIVTQGRSDLDQWVTQYKLEYSQNRVHFH----SYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHTHISMRVGLYGCRKGFKPPPLWSCKHTLGVQSGFIKDAQMTASSIWDNNHGAANARLNRQKIGARTGAWSAKHNDRLQWLQVDLGKLSKVVKVATQGRQDLNQ--WVTTYKLAYSRDGVLFKYFPK------------------VLSGNKDRNTV-VTHSVGTIYARYVRFHPQTWHGHISMRV 736          

HSP 4 Score: 103.219 bits (256), Expect = 7.406e-23
Identity = 64/156 (41.03%), Postives = 88/156 (56.41%), Query Frame = 3
Query:  144 LGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK-------SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ 590
            LG+  G IKD Q+TASS     W +N  A+ ARL   NR+       +W AK     +WLQVDLG  + +  V TQGR D  QWV ++ ++YS DG  F Y        KV  GN+D  +V  +     I AR+++FH  ++HGH S+RVE+ GC+
Sbjct:  601 LGVQSGFIKDAQMTASSI----WDNNHGAANARL---NRQKIGARTGAWSAKHNDRLQWLQVDLGKLSKVVKVATQGRQDLNQWVTTYKLAYSRDGVLFKYFP------KVLSGNKDRNTVVTHSVGT-IYARYVRFHPQTWHGHISMRVELYGCR 742          
BLAST of Lactadherin vs. Ensembl Nematostella
Match: EDO48080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK12])

HSP 1 Score: 153.68 bits (387), Expect = 5.394e-40
Identity = 101/323 (31.27%), Postives = 155/323 (47.99%), Query Frame = 3
Query:  117 EKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNF-HYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILGVFPYXXXXXXXXXXXXXHRTCT----EEYGHILSNKG--WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
             K CN   P+GM +  I + +ITASS   + +  N    QA         W  +  +  +WLQVD G  + I  + +QG  D   WV  F +S S D  +F  Y+  ++ + K F GNRD  SV  N FN  IRAR+I+ H Y +    ++RVE  GC    C   +G+               ++  C+      +G     +G  WCA+  N+ QWIQ+D G  + +T ++T+GR +S    +V  Y V++S+N  N+  YKEN +               +F+GN D      N  + P   R+ R+HP++W  +I MR+
Sbjct:  206 RKMCNL--PMGMEKRGISNARITASSQYNRYFAANRGRLQAARQGRYLGGWRPRVNNRYQWLQVDFGKPSKIVRIASQGHRDYDYWVTRFSVSSSVDLVHFVQYM--EFSAIKYFTGNRDRNSVVPNVFNPSIRARYIRVHPYGWRSQIAMRVEFYGCHTNRCDMPIGLESGTIADPQFRASSFQNFYCSAFNARLHGTRAGRRGGAWCARALNRKQWIQVDFGTSARVTRVVTQGRQNSNQ--WVKSYYVTYSSNGINFKIYKENGKR-------------KIFEGNYDRYIPVTNTFKTPLNGRYFRVHPVSWHSRIAMRL 509          

HSP 2 Score: 134.035 bits (336), Expect = 2.796e-33
Identity = 90/327 (27.52%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  117 EKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ-------PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNK------GWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            E  C+T  PLG+    I+    + +S     +       Q R +   R  W  +  +  +WLQ++LG  + ++ +  QGR D  QW  +F +SYS DG+ F + K     +++FQGN D + V        + A++++ H  +++GH +LR EI GC+        C   +G+   G   +  +   + +R      G + + +      GW  +  N+ QW+Q+D G+PS I  I ++G  D  +  +VT + VS S +  ++  Y E S                 F GN D NS   N       AR+ R+HP  W+ +I MR+
Sbjct:   46 EDPCDT--PLGVQDHRIRKSMFSTTSMANHYYGPWSSKLQDRNHGHYRGGWVPRINNNKQWLQINLGARSRVNRIAIQGRYDANQWTETFKLSYSKDGSKFAFYKVG-KYERIFQGNNDRYRVNVLRLIPPVVAQYVRIHPQTWYGHVALRTEIYGCRIGKRSRKMCNLPMGMEKRGISNARITASSQYNRYFAANRGRLQAARQGRYLGGWRPRVNNRYQWLQVDFGKPSKIVRIASQGHRDYDY--WVTRFSVSSSVDLVHFVQYMEFSAI-------------KYFTGNRDRNSVVPNVFNPSIRARYIRVHPYGWRSQIAMRV 354          

HSP 3 Score: 105.145 bits (261), Expect = 8.522e-24
Identity = 56/153 (36.60%), Postives = 88/153 (57.52%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARLY--LENRK--SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+G+  G I D Q  ASS +       C A  ARL+     R+  +WCA+  +  +W+QVD GT A ++ V+TQGR +  QWV S+ ++YS++G NF   K++ G +K+F+GN D +    N F   +  R+ + H  S+H   ++R+E  GC
Sbjct:  367 PIGLESGTIADPQFRASSFQ----NFYCSAFNARLHGTRAGRRGGAWCARALNRKQWIQVDFGTSARVTRVVTQGRQNSNQWVKSYYVTYSSNGINFKIYKEN-GKRKIFEGNYDRYIPVTNTFKTPLNGRYFRVHPVSWHSRIAMRLEFFGC 514          

HSP 4 Score: 85.8853 bits (211), Expect = 1.458e-17
Identity = 58/208 (27.88%), Postives = 93/208 (44.71%), Query Frame = 3
Query:  456 FQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHR------TCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            F+GNRD  SV  +    +IR R I+ + Y++  H S+RVE  GC   PC   LGV  +    S  S     +       +  ++  H     GW  +  N  QW+QI++G  S +  I  +GR D+    +   +++S+S +   + +YK                   +F+GN D     +  L  P VA++ RIHP  W   + +R
Sbjct:    1 FKGNRDQNSVVMHRLFPRIRCRVIRLYPYTWRSHMSMRVEFYGCAEDPCDTPLGVQDHRIRKSMFSTTSMANHYYGPWSSKLQDRNHGHYRGGWVPRINNNKQWLQINLGARSRVNRIAIQGRYDANQ--WTETFKLSYSKDGSKFAFYKVGKYE-------------RIFQGNNDRYRVNVLRLIPPVVAQYVRIHPQTWYGHVALR 193          
BLAST of Lactadherin vs. Ensembl Nematostella
Match: EDO48077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK09])

HSP 1 Score: 144.05 bits (362), Expect = 3.164e-38
Identity = 103/320 (32.19%), Postives = 151/320 (47.19%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS---TELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP--CKEILG------VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDI----GQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            PLGM    I+  Q++A++     L  W            L +R SW AK    ++WLQ+    +  ++GV TQGR D  QWV  + + +STDGT F   +    S K+FQ NRD  SV +N  N  I ARF++ + Y +  + S+R E  GC    C   LG         +    S  S+         +E  H      W AK +N+NQWIQ+D+    G+PS +  + T+G  D  +  +VT+Y +++S +   +  YK NS             N   F GN D ++   + L  P  AR+ RIHP  W   IG+R
Sbjct:   20 PLGMEDKRIRPGQLSANNFYNHHLSPWNSR---------LNSRYSWSAKASDHNQWLQIQF-DQTKVTGVATQGRQDAHQWVTRYNLLHSTDGTTFTTYRYP-SSDKLFQANRDRSSVVYNALNPPIYARFLRINPYGWRSYISMRAEFYGCATDQCNLPLGFQDGRITRSHMTASSLYSQYYGPWNARIQETNHGQVRGAWIAKIRNQNQWIQVDLEFDFGRPSKVVRVSTQGMQDRNY--WVTQYYMTYSLDGLRFLEYKHNS-------------NRKYFTGNRDRSTAVSHVLYPPIRARYVRIHPWGWHAYIGLR 313          

HSP 2 Score: 85.5001 bits (210), Expect = 4.092e-18
Identity = 52/160 (32.50%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  123 ECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDL----GTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ 590
            +CN   PLG   G I    +TASS   + +       Q   + + R +W AK ++ ++W+QVDL    G  + +  V TQG  D   WV  + ++YS DG  F   K +  ++K F GNRD  +   +     IRAR+++ H + +H +  LR E  GC 
Sbjct:  164 QCNL--PLGFQDGRITRSHMTASSLYSQYYGPWNARIQETNHGQVRGAWIAKIRNQNQWIQVDLEFDFGRPSKVVRVSTQGMQDRNYWVTQYYMTYSLDGLRFLEYKHN-SNRKYFTGNRDRSTAVSHVLYPPIRARYVRIHPWGWHAYIGLRAEFFGCH 320          
BLAST of Lactadherin vs. Ensembl Nematostella
Match: EDO41038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M9])

HSP 1 Score: 147.902 bits (372), Expect = 5.490e-38
Identity = 97/321 (30.22%), Postives = 169/321 (52.65%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASSTELKSWRDNCKASQARL--YLEN--RKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP----CKEILGVFPYXXXXX---XXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            PLGM    I D +ITASST L S   N    +ARL   L++  + +W AK     +WLQ+D+G    ++ ++TQGR D  QWV S+ I +S     FH    DY   + F+GN+D+ +   +  N  I AR+++    ++HGH S+R+E+ GC      C + +G        S   + S+    +R       H+ +N+G    W   + +KN W++ID+G+ + +T I T+G+ D+ +  +VT Y + +S +  ++  +  +             +N  +F+GN+D ++ + + L  P +AR+ R+ P+ W+ +I MR+
Sbjct:  160 PLGMKSKAITDSRITASST-LNS---NHSPQRARLDTVLQDSLKGAWSAKTNDMGQWLQIDMGRATKVTRIVTQGRSDANQWVKSYKIQFSQQDL-FH----DYREGRTFEGNKDTNTKYGHVLNPPIIARYVRVLPVTWHGHISMRMELFGCTEGEFKCLKAIGAQSGTLKDSQFFASSELSSSYRASNARL-HLHTNRGRVGAWSPSRSDKNPWLEIDVGRIAKVTGISTQGQQDANY--WVTSYALQYSLDGSSFTTFSVS-------------RNPKIFEGNKDRSTVRSHALAMPILARYVRVRPMTWRGRIAMRV 455          

HSP 2 Score: 146.747 bits (369), Expect = 1.418e-37
Identity = 97/321 (30.22%), Postives = 156/321 (48.60%), Query Frame = 3
Query:  150 MIQGDIKDQQITASSTELKSWRDNCKASQARLYL----ENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--------PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHI-----LSNKG-WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            M  G IKD Q+ ASS    SW  N  A ++RL++      R +W A++    ++LQVD      ++ +  QGR D  QWV  + +SYS DG  +  +    G+ K F GNRD  +V  +   + I  RF++ H   ++ H SLR+E  GC+         C   LG+       S  +     +   + +   +      S KG W AK  +  QW+QID+G+ + +T I+T+GR D+    +V  Y++ FS     ++ Y+E                G  F+GN+D+N++  + L  P +AR+ R+ P+ W   I MR+
Sbjct:    1 MASGAIKDAQLNASS----SWDRNHGAGRSRLHIVRASGKRGAWSARYNDRGQYLQVDFSKPIKLTKIDIQGREDANQWVTEYWVSYSLDGGIYRPLYTPKGNVKYFIGNRDRNTVVSSVLEEPIYPRFVRIHPSKWYQHISLRLEFHGCRNDFEIPKVLCASPLGMKSKAITDSRITASSTLNSNHSPQRARLDTVLQDSLKGAWSAKTNDMGQWLQIDMGRATKVTRIVTQGRSDANQ--WVKSYKIQFSQQDL-FHDYRE----------------GRTFEGNKDTNTKYGHVLNPPIIARYVRVLPVTWHGHISMRM 298          

HSP 3 Score: 107.457 bits (267), Expect = 1.469e-24
Identity = 74/265 (27.92%), Postives = 119/265 (44.91%), Query Frame = 3
Query:   48 NMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQP---------CKEILGVFPYXXXXXXXXXXXXXHRTCTEE------YGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAI 785
            +MR  L  C              E E   +  +G   G +KD Q  ASS    S+R    AS ARL+L   +    +W       + WL++D+G  A ++G+ TQG+ D   WV S+ + YS DG++F        + K+F+GN+D  +V+ +     I AR+++    ++ G  ++RVEI GC           C   LG+  +    +          T          Y H     GW ++K +  QW+Q+D+G+ S +T I
Sbjct:  295 SMRMELFGCT-------------EGEFKCLKAIGAQSGTLKDSQFFASSELSSSYR----ASNARLHLHTNRGRVGAWSPSRSDKNPWLEIDVGRIAKVTGISTQGQQDANYWVTSYALQYSLDGSSFTTFSVSR-NPKIFEGNKDRSTVRSHALAMPILARYVRVRPMTWRGRIAMRVEIFGCTSGFPLPPVPECMAPLGLQRHIIKDNQMEASSVWSNTHGAANARLYFYPHDGRTGGWSSRKNDGAQWLQVDLGKQSKVTMI 541          
BLAST of Lactadherin vs. Ensembl Medaka
Match: edil3a (EGF like repeats and discoidin domains 3 [Source:NCBI gene;Acc:101165646])

HSP 1 Score: 133.65 bits (335), Expect = 3.207e-33
Identity = 102/332 (30.72%), Postives = 162/332 (48.80%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYI----KDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++GV+TQG  R    ++V S+ ++YS DG  +       KDD     +F+GN D+ +   N F   I A++++ +      H +LR+E+LGC+   C E LG     +  Y    SS  +         E     L  +G    W A   +++QW+Q+D+  P+ +T IIT+G  D  H  +V  Y++++SN+ + W  Y++  +               VF+GN D+++ + N +  P  AR  RI P +W  +I +R
Sbjct:  116 GPLGMEGGIISNQQITASSTHRALFGLQKW----YPYFARL---NKKGLVNAWTAAENDRWPWIQINLQRRMRVTGVITQGAKRIGSPEYVKSYKVAYSDDGKTWRTYRVKGKDD---DMIFRGNVDNNAPSANSFTPPIEAQYVRIYPQVCRRHCTLRMELLGCELTGCSEPLGMKSGHIQDYQVTASSIFRTLNMDMFTWEPGKARLDKQGKVNAWTAGHSDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKIAYSNDGERWNVYQDEKQG-----------KDKVFQGNFDNDTHRKNVIDPPIYARLVRILPWSWYGRITLR 426          

HSP 2 Score: 97.0561 bits (240), Expect = 4.675e-21
Identity = 60/159 (37.74%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM  G I+D Q+TASS       ++ +W    +  +ARL  + +  +W A     S+WLQVDL     ++G++TQG  D    Q+V S+ I+YS DG  ++  +D+  G  KVFQGN D+ + + N  +  I AR ++   +S++G  +LR EILGC
Sbjct:  278 PLGMKSGHIQDYQVTASSIFRTLNMDMFTW----EPGKARLDKQGKVNAWTAGHSDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKIAYSNDGERWNVYQDEKQGKDKVFQGNFDNDTHRKNVIDPPIYARLVRILPWSWYGRITLRAEILGC 432          
BLAST of Lactadherin vs. Ensembl Medaka
Match: edil3a (EGF like repeats and discoidin domains 3 [Source:NCBI gene;Acc:101165646])

HSP 1 Score: 133.265 bits (334), Expect = 3.414e-33
Identity = 102/332 (30.72%), Postives = 162/332 (48.80%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYI----KDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++GV+TQG  R    ++V S+ ++YS DG  +       KDD     +F+GN D+ +   N F   I A++++ +      H +LR+E+LGC+   C E LG     +  Y    SS  +         E     L  +G    W A   +++QW+Q+D+  P+ +T IIT+G  D  H  +V  Y++++SN+ + W  Y++  +               VF+GN D+++ + N +  P  AR  RI P +W  +I +R
Sbjct:  106 GPLGMEGGIISNQQITASSTHRALFGLQKW----YPYFARL---NKKGLVNAWTAAENDRWPWIQINLQRRMRVTGVITQGAKRIGSPEYVKSYKVAYSDDGKTWRTYRVKGKDD---DMIFRGNVDNNAPSANSFTPPIEAQYVRIYPQVCRRHCTLRMELLGCELTGCSEPLGMKSGHIQDYQVTASSIFRTLNMDMFTWEPGKARLDKQGKVNAWTAGHSDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKIAYSNDGERWNVYQDEKQG-----------KDKVFQGNFDNDTHRKNVIDPPIYARLVRILPWSWYGRITLR 416          

HSP 2 Score: 97.0561 bits (240), Expect = 4.944e-21
Identity = 60/159 (37.74%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM  G I+D Q+TASS       ++ +W    +  +ARL  + +  +W A     S+WLQVDL     ++G++TQG  D    Q+V S+ I+YS DG  ++  +D+  G  KVFQGN D+ + + N  +  I AR ++   +S++G  +LR EILGC
Sbjct:  268 PLGMKSGHIQDYQVTASSIFRTLNMDMFTW----EPGKARLDKQGKVNAWTAGHSDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKIAYSNDGERWNVYQDEKQGKDKVFQGNFDNDTHRKNVIDPPIYARLVRILPWSWYGRITLRAEILGC 422          
BLAST of Lactadherin vs. Ensembl Medaka
Match: edil3a (EGF like repeats and discoidin domains 3 [Source:NCBI gene;Acc:101165646])

HSP 1 Score: 133.265 bits (334), Expect = 3.625e-33
Identity = 102/332 (30.72%), Postives = 162/332 (48.80%), Query Frame = 3
Query:  138 GPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENRK----SWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYI----KDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILG-----VFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMR 1055
            GPLGM  G I +QQITASST      L+ W        ARL   N+K    +W A       W+Q++L     ++GV+TQG  R    ++V S+ ++YS DG  +       KDD     +F+GN D+ +   N F   I A++++ +      H +LR+E+LGC+   C E LG     +  Y    SS  +         E     L  +G    W A   +++QW+Q+D+  P+ +T IIT+G  D  H  +V  Y++++SN+ + W  Y++  +               VF+GN D+++ + N +  P  AR  RI P +W  +I +R
Sbjct:  102 GPLGMEGGIISNQQITASSTHRALFGLQKW----YPYFARL---NKKGLVNAWTAAENDRWPWIQINLQRRMRVTGVITQGAKRIGSPEYVKSYKVAYSDDGKTWRTYRVKGKDD---DMIFRGNVDNNAPSANSFTPPIEAQYVRIYPQVCRRHCTLRMELLGCELTGCSEPLGMKSGHIQDYQVTASSIFRTLNMDMFTWEPGKARLDKQGKVNAWTAGHSDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKIAYSNDGERWNVYQDEKQG-----------KDKVFQGNFDNDTHRKNVIDPPIYARLVRILPWSWYGRITLR 412          

HSP 2 Score: 96.6709 bits (239), Expect = 6.375e-21
Identity = 60/159 (37.74%), Postives = 92/159 (57.86%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASS------TELKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDD-YGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            PLGM  G I+D Q+TASS       ++ +W    +  +ARL  + +  +W A     S+WLQVDL     ++G++TQG  D    Q+V S+ I+YS DG  ++  +D+  G  KVFQGN D+ + + N  +  I AR ++   +S++G  +LR EILGC
Sbjct:  264 PLGMKSGHIQDYQVTASSIFRTLNMDMFTW----EPGKARLDKQGKVNAWTAGHSDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKIAYSNDGERWNVYQDEKQGKDKVFQGNFDNDTHRKNVIDPPIYARLVRILPWSWYGRITLRAEILGC 418          
BLAST of Lactadherin vs. Ensembl Medaka
Match: mfge8b (lactadherin [Source:NCBI gene;Acc:101165726])

HSP 1 Score: 122.865 bits (307), Expect = 2.136e-29
Identity = 93/351 (26.50%), Postives = 165/351 (47.01%), Query Frame = 3
Query:  102 IDADYEKECNT-----------VGPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQK--VFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---GHI--LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            +D D++  C +           +  LGM  G I + QI+ASS       L+ W        ARL+ +    +W A     + W+Q+++  +  ++G++TQG  R   A+++ +F ++ S DG  +   + + G +K  VF GN D+ S K N F+  I A++I+          +LR+E++GC+   C E +G+     +    +          E +    H   L  +G    W A   N+++W+Q+D+  P  IT IIT+G  D     ++  ++V+ S++ K+W   K+ +            +   +F GN D+N  K N     F +R+ RI P  W E+I +R+
Sbjct:  127 LDGDFKCHCPSPFVGKHCQLRCISLLGMEGGGIAESQISASSVRYSLLGLQRW----GPELARLHKKGLVNAWSAAAHDKNPWIQINMQRKMRLTGIVTQGASRMGSAEFIKAFKVASSLDGKTYTMYRTE-GQRKDHVFVGNVDNDSTKTNLFDPPIIAQYIRIVPVVCRKACTLRMELVGCELNGCSEPMGMKSRLVLDRQITASSSFRTWGLEAFTWHPHFARLDKQGKTNAWTASTNNRSEWLQVDLLSPKKITGIITQGAKDFGSVQFIVSFKVAHSDDGKSWTVVKDETS-----------KTDKIFPGNSDNNVHKKNIFEPAFYSRYVRILPWEWHERITLRM 461          

HSP 2 Score: 88.9669 bits (219), Expect = 3.126e-18
Identity = 56/159 (35.22%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM    + D+QITASS+      E  +W  +     ARL  + +  +W A   + SEWLQVDL +   I+G++TQG  D    Q++VSF +++S DG ++  +KD+   + K+F GN D+   K N F     +R+++   + +H   +LR+E+LGC
Sbjct:  312 PMGMKSRLVLDRQITASSSFRTWGLEAFTWHPH----FARLDKQGKTNAWTASTNNRSEWLQVDLLSPKKITGIITQGAKDFGSVQFIVSFKVAHSDDGKSWTVVKDETSKTDKIFPGNSDNNVHKKNIFEPAFYSRYVRILPWEWHERITLRMELLGC 466          
BLAST of Lactadherin vs. Ensembl Medaka
Match: mfge8b (lactadherin [Source:NCBI gene;Acc:101165726])

HSP 1 Score: 122.865 bits (307), Expect = 2.585e-29
Identity = 93/351 (26.50%), Postives = 165/351 (47.01%), Query Frame = 3
Query:  102 IDADYEKECNT-----------VGPLGMIQGDIKDQQITASSTE-----LKSWRDNCKASQARLYLENR-KSWCAKFKSFSEWLQVDLGTEAVISGVMTQG--RGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQK--VFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQ--PCKEILGVFPYXXXXXXXXXXXXXHRTCTEEY---GHI--LSNKG----WCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRI 1058
            +D D++  C +           +  LGM  G I + QI+ASS       L+ W        ARL+ +    +W A     + W+Q+++  +  ++G++TQG  R   A+++ +F ++ S DG  +   + + G +K  VF GN D+ S K N F+  I A++I+          +LR+E++GC+   C E +G+     +    +          E +    H   L  +G    W A   N+++W+Q+D+  P  IT IIT+G  D     ++  ++V+ S++ K+W   K+ +            +   +F GN D+N  K N     F +R+ RI P  W E+I +R+
Sbjct:  138 LDGDFKCHCPSPFVGKHCQLRCISLLGMEGGGIAESQISASSVRYSLLGLQRW----GPELARLHKKGLVNAWSAAAHDKNPWIQINMQRKMRLTGIVTQGASRMGSAEFIKAFKVASSLDGKTYTMYRTE-GQRKDHVFVGNVDNDSTKTNLFDPPIIAQYIRIVPVVCRKACTLRMELVGCELNGCSEPMGMKSRLVLDRQITASSSFRTWGLEAFTWHPHFARLDKQGKTNAWTASTNNRSEWLQVDLLSPKKITGIITQGAKDFGSVQFIVSFKVAHSDDGKSWTVVKDETS-----------KTDKIFPGNSDNNVHKKNIFEPAFYSRYVRILPWEWHERITLRM 472          

HSP 2 Score: 88.5817 bits (218), Expect = 3.504e-18
Identity = 56/159 (35.22%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  141 PLGMIQGDIKDQQITASST------ELKSWRDNCKASQARLYLENRK-SWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGD--GAQWVVSFMISYSTDGTNFHYIKDDYG-SQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGC 587
            P+GM    + D+QITASS+      E  +W  +     ARL  + +  +W A   + SEWLQVDL +   I+G++TQG  D    Q++VSF +++S DG ++  +KD+   + K+F GN D+   K N F     +R+++   + +H   +LR+E+LGC
Sbjct:  323 PMGMKSRLVLDRQITASSSFRTWGLEAFTWHPH----FARLDKQGKTNAWTASTNNRSEWLQVDLLSPKKITGIITQGAKDFGSVQFIVSFKVAHSDDGKSWTVVKDETSKTDKIFPGNSDNNVHKKNIFEPAFYSRYVRILPWEWHERITLRMELLGC 477          
BLAST of Lactadherin vs. Planmine SMEST
Match: SMESG000001686.1 (SMESG000001686.1)

HSP 1 Score: 1135.55 bits (2936), Expect = 0.000e+0
Identity = 575/578 (99.48%), Postives = 578/578 (100.00%), Query Frame = 3
Query:   27 LLDFFFSNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXXXXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRRINRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
            ++DFFFSNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYGKIISSGSKGKKKHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIGVLGCKHKGKCGKGFLKVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRR+NRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY
Sbjct:    3 IVDFFFSNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYGKIISSGSKGKKKHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIGVLGCKHKGKCGKGFLKVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRRMNRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 580          
BLAST of Lactadherin vs. Planmine SMEST
Match: SMESG000001686.1 (SMESG000001686.1)

HSP 1 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 564/578 (97.58%), Postives = 567/578 (98.10%), Query Frame = 3
Query:   27 LLDFFFSNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYXXXXXXXXXXXXXHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIXXXXXXXXXXXXXXXXXVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRRINRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 1760
            ++DFFFSNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYGKIISSGSKGKKKHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPN           VFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIGVLGCKHKGKCGKGFLKVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRR+NRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY
Sbjct:    3 IVDFFFSNMRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTELKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQGRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYGKIISSGSKGKKKHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGRGDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPN-----------VFKGNEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIGVLGCKHKGKCGKGFLKVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNANKAVDGHTQWEMDADDQQDSTNVRIDRRMNRKQHMRTCTVLQYKTSSNYNPIWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQYNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQATGVKHRRRTDFKAILCEVMVY 569          
BLAST of Lactadherin vs. Planmine SMEST
Match: SMESG000014159.1 (SMESG000014159.1)

HSP 1 Score: 54.6842 bits (130), Expect = 2.067e-7
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  264 SWCAK---FKSFSEWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYS------TDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYS-FHGHPSLRVEILGCQPCKEIL 608
            +WC      KS SE+LQ+DLG   +I  V+T+GR   G G ++   + I YS      +D  N+   K+  G QK+  G  D+F       +  I  R I+   YS       L++++ GC    +IL
Sbjct:   31 AWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEK-GFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDIL 157          
BLAST of Lactadherin vs. Planmine SMEST
Match: SMESG000014159.1 (SMESG000014159.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.492e-7
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  264 SWCAK---FKSFSEWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYS------TDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYS-FHGHPSLRVEILGCQPCKEIL 608
            +WC      KS SE+LQ+DLG   +I  V+T+GR   G G ++   + I YS      +D  N+   K+  G QK+  G  D+F       +  I  R I+   YS       L++++ GC    +IL
Sbjct:   17 AWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEK-GFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDIL 143          
BLAST of Lactadherin vs. Planmine SMEST
Match: SMESG000014159.1 (SMESG000014159.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.598e-7
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  264 SWCAK---FKSFSEWLQVDLGTEAVISGVMTQGR---GDGAQWVVSFMISYS------TDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYFNDKIRARFIKFHTYS-FHGHPSLRVEILGCQPCKEIL 608
            +WC      KS SE+LQ+DLG   +I  V+T+GR   G G ++   + I YS      +D  N+   K+  G QK+  G  D+F       +  I  R I+   YS       L++++ GC    +IL
Sbjct:   17 AWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEK-GFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDIL 143          
The following BLAST results are available for this feature:
BLAST of Lactadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFGE83.844e-3429.64milk fat globule-EGF factor 8 protein [Source:HGNC... [more]
MFGE81.386e-3329.34milk fat globule-EGF factor 8 protein [Source:HGNC... [more]
MFGE81.386e-3329.34milk fat globule-EGF factor 8 protein [Source:HGNC... [more]
F81.344e-3229.67coagulation factor VIII [Source:HGNC Symbol;Acc:HG... [more]
EDIL38.438e-3230.09EGF like repeats and discoidin domains 3 [Source:H... [more]
back to top
BLAST of Lactadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ddr-11.327e-834.39Discoidin domain-containing receptor A [Source:Un... [more]
ddr-26.016e-730.30Discoidin domain-containing receptor tyrosine kina... [more]
ddr-29.951e-630.00Discoidin domain-containing receptor tyrosine kina... [more]
ddr-29.951e-630.00Discoidin domain-containing receptor tyrosine kina... [more]
back to top
BLAST of Lactadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hml1.857e-1722.01gene:FBgn0029167 transcript:FBtr0333020[more]
Hml1.890e-1722.01gene:FBgn0029167 transcript:FBtr0075753[more]
Nrx-IV8.771e-1231.93gene:FBgn0013997 transcript:FBtr0075998[more]
Nrx-IV1.311e-1130.07gene:FBgn0013997 transcript:FBtr0075999[more]
Ddr1.726e-1132.05gene:FBgn0053531 transcript:FBtr0340169[more]
back to top
BLAST of Lactadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edil3a7.254e-3431.00EGF-like repeats and discoidin I-like domains 3a [... [more]
edil3a7.483e-3431.00EGF-like repeats and discoidin I-like domains 3a [... [more]
edil3a8.175e-3431.00EGF-like repeats and discoidin I-like domains 3a [... [more]
f81.367e-3229.51coagulation factor VIII, procoagulant component [S... [more]
edil3b1.838e-3230.00EGF-like repeats and discoidin I-like domains 3b [... [more]
back to top
BLAST of Lactadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mef2d2.337e-3631.42myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-... [more]
mef2d2.869e-3631.42myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-... [more]
mef2d5.251e-3631.74myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-... [more]
mef2d8.545e-3631.74myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-... [more]
mef2d2.066e-3531.18myocyte enhancer factor 2D [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Lactadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfge81.180e-4734.87milk fat globule-EGF factor 8 protein [Source:MGI ... [more]
Mfge81.036e-4635.38milk fat globule-EGF factor 8 protein [Source:MGI ... [more]
Edil39.789e-3330.09EGF-like repeats and discoidin I-like domains 3 [S... [more]
Edil31.117e-3230.09EGF-like repeats and discoidin I-like domains 3 [S... [more]
F85.226e-3229.55coagulation factor VIII [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Lactadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21956|MFGM_MOUSE7.247e-4635.38Lactadherin OS=Mus musculus OX=10090 GN=Mfge8 PE=1... [more]
sp|P70490|MFGM_RAT8.857e-4534.48Lactadherin OS=Rattus norvegicus OX=10116 GN=Mfge8... [more]
sp|P79385|MFGM_PIG1.121e-3831.63Lactadherin OS=Sus scrofa OX=9823 GN=MFGE8 PE=1 SV... [more]
sp|Q95114|MFGM_BOVIN8.525e-3830.84Lactadherin OS=Bos taurus OX=9913 GN=MFGE8 PE=1 SV... [more]
sp|O18806|FA8_CANLF6.565e-3632.05Coagulation factor VIII OS=Canis lupus familiaris ... [more]
back to top
BLAST of Lactadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LLD74.345e-16239.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LJG83.541e-16138.87Uncharacterized protein OS=Opisthorchis felineus O... [more]
G4VIR12.104e-15042.11Putative dock OS=Schistosoma mansoni OX=6183 GN=Sm... [more]
R7T4112.399e-14442.96Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1QRH03.594e-14443.34Lactadherin OS=Crassostrea gigas OX=29159 GN=CGI_1... [more]
back to top
BLAST of Lactadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edil3b2.124e-3830.92EGF-like repeat and discoidin I-like domain-contai... [more]
edil3b4.539e-3730.59EGF-like repeat and discoidin I-like domain-contai... [more]
f51.217e-3231.37venom prothrombin activator omicarin-C non-catalyt... [more]
f81.365e-3230.61coagulation factor VIII, procoagulant component [S... [more]
mfge8b1.094e-2926.00lactadherin-like [Source:NCBI gene;Acc:103047215][more]
back to top
BLAST of Lactadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007561.16.682e-2727.33pep scaffold:Pmarinus_7.0:GL479407:10781:33713:1 g... [more]
EDIL39.281e-2527.27EGF like repeats and discoidin domains 3 [Source:H... [more]
ENSPMAT00000004027.18.323e-2238.22pep scaffold:Pmarinus_7.0:GL481210:3001:5030:1 gen... [more]
ENSPMAT00000001939.19.503e-2225.39pep scaffold:Pmarinus_7.0:GL476444:333387:405756:1... [more]
ENSPMAT00000003059.11.589e-2124.93pep scaffold:Pmarinus_7.0:GL476485:229541:264028:1... [more]
back to top
BLAST of Lactadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lactadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO296091.123e-4233.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467882.188e-4134.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480805.394e-4031.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480773.164e-3832.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410385.490e-3830.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lactadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edil3a3.207e-3330.72EGF like repeats and discoidin domains 3 [Source:N... [more]
edil3a3.414e-3330.72EGF like repeats and discoidin domains 3 [Source:N... [more]
edil3a3.625e-3330.72EGF like repeats and discoidin domains 3 [Source:N... [more]
mfge8b2.136e-2926.50lactadherin [Source:NCBI gene;Acc:101165726][more]
mfge8b2.585e-2926.50lactadherin [Source:NCBI gene;Acc:101165726][more]
back to top
BLAST of Lactadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001686.10.000e+099.48SMESG000001686.1[more]
SMESG000001686.10.000e+097.58SMESG000001686.1[more]
SMESG000014159.12.067e-731.25SMESG000014159.1[more]
SMESG000014159.12.492e-731.25SMESG000014159.1[more]
SMESG000014159.12.598e-731.25SMESG000014159.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024840 ID=SMED30024840|Name=Lactadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=1992bp
TTTCATAATTTTGCAAATAAAATACTTTATTAGATTTCTTTTTCTCAAAC
ATGCGCTTCCTGTTATTGTCTTGCGTGATTTGCGTGGCTTCGGTTATTTT
AATCGACGCAGACTATGAGAAAGAATGCAATACTGTTGGCCCTCTGGGGA
TGATTCAAGGGGACATAAAAGATCAACAGATTACCGCTTCTTCAACTGAA
TTAAAGTCATGGCGAGACAACTGTAAAGCATCTCAAGCTCGACTGTATTT
AGAAAATCGCAAAAGTTGGTGCGCAAAATTCAAATCATTCTCTGAATGGC
TCCAAGTTGATCTGGGAACAGAAGCTGTTATTTCAGGAGTAATGACACAA
GGCCGTGGAGATGGGGCTCAGTGGGTAGTCAGTTTCATGATTTCCTACAG
CACCGACGGAACAAATTTTCATTATATAAAAGATGACTATGGAAGTCAAA
AAGTTTTTCAAGGAAATCGAGATTCATTTTCAGTGAAGCATAATTATTTC
AATGATAAAATTCGAGCCCGATTCATAAAATTTCACACATATTCATTTCA
CGGGCATCCGAGTTTAAGAGTTGAGATATTGGGATGTCAACCCTGCAAAG
AGATTCTCGGTGTATTTCCTTATGGAAAAATAATTTCGTCCGGTTCGAAA
GGCAAAAAGAAACATCGTACTTGCACTGAAGAATACGGTCACATTTTGAG
CAACAAAGGATGGTGCGCAAAGAAACAAAATAAAAATCAGTGGATTCAAA
TTGATATTGGACAACCTTCACTTATCACAGCGATAATCACCAAAGGCAGA
GGCGACTCCAAACATCCAACTTATGTCACCGAGTATCAAGTCTCTTTCAG
TAACAATAGCAAAAATTGGTATTATTACAAAGAAAACTCAGAATCCGGAC
CAAACAATGTGTACATGTGGTGGATACAGAATGGAACGGTATTTAAAGGT
AACGAAGATTCGAATAGTGAGAAAATCAACTATTTACGAGAACCATTTGT
TGCGAGATTCACAAGAATCCATCCAATAAATTGGAAAGAAAAGATCGGAA
TGAGAATCGGTGTATTGGGTTGCAAACATAAAGGAAAGTGTGGAAAAGGA
TTCTTAAAAGTTAATGACGTCAGTCCTTGTATCGCAAACATTGCTTACAA
AAAGCAAGCTTGGATTACGATGGAGACAAATAAAATGCACAAACGAAACA
TTGGTTATTCTCCATCAGAAAGGCGAAGTCAATTCATGAAAAATGCCAAC
AAAGCCGTCGATGGCCATACACAATGGGAAATGGACGCTGATGATCAACA
GGACAGTACAAATGTGCGAATTGATCGTCGAATAAATAGAAAACAGCACA
TGAGAACCTGCACAGTTCTTCAATATAAAACCTCATCAAATTACAATCCA
ATTTGGTATGTTAATCTTGGGGAGCAAACTACAGTTAATGGAGTCATCAT
TTACAACGGCAACGACATTCTTTTCAGTGAAAAATCAGAAAACAGAGCTG
AAAGAGATCTTGTAGAGAATGTCGACAAAATTTCGGTGTTTGTTGACCAA
TACAATTCAAAAGGTACGAACCAATTCCGGAAAACCTCTGATTTGTTATG
TGGCTCTGTTACGAAATTCAATAACGCTTTATCAAAACCGAAAGTCCACA
TTAGCTGTCAACAACCGATGGTGGGACAATTCGTGTACATCCAAGCGACA
GGTGTCAAACATCGCCGAAGGACTGACTTTAAAGCCATTTTATGTGAAGT
AATGGTCTACTGACCTGTCCTGATTACACAGTGTAAAGTCTTGTTTCAAC
ATAAATTACCTCTACTACCATCATGACAACGCAGAATATAAAGATTTTCA
CCCACAATTGTTTTCTTTTCTTGATTTAATGCCATATTTTCATGAATATT
CATTCGAAATTAGAATTGTCATAATATCTGCATGTGTACATGATCTTTTT
TTCTTTGTATTATTTGTAAATTTAATAAATTGTTTAAATGAC
back to top

protein sequence of SMED30024840-orf-1

>SMED30024840-orf-1 ID=SMED30024840-orf-1|Name=SMED30024840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=571bp
MRFLLLSCVICVASVILIDADYEKECNTVGPLGMIQGDIKDQQITASSTE
LKSWRDNCKASQARLYLENRKSWCAKFKSFSEWLQVDLGTEAVISGVMTQ
GRGDGAQWVVSFMISYSTDGTNFHYIKDDYGSQKVFQGNRDSFSVKHNYF
NDKIRARFIKFHTYSFHGHPSLRVEILGCQPCKEILGVFPYGKIISSGSK
GKKKHRTCTEEYGHILSNKGWCAKKQNKNQWIQIDIGQPSLITAIITKGR
GDSKHPTYVTEYQVSFSNNSKNWYYYKENSESGPNNVYMWWIQNGTVFKG
NEDSNSEKINYLREPFVARFTRIHPINWKEKIGMRIGVLGCKHKGKCGKG
FLKVNDVSPCIANIAYKKQAWITMETNKMHKRNIGYSPSERRSQFMKNAN
KAVDGHTQWEMDADDQQDSTNVRIDRRINRKQHMRTCTVLQYKTSSNYNP
IWYVNLGEQTTVNGVIIYNGNDILFSEKSENRAERDLVENVDKISVFVDQ
YNSKGTNQFRKTSDLLCGSVTKFNNALSKPKVHISCQQPMVGQFVYIQAT
GVKHRRRTDFKAILCEVMVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
GO:0031012extracellular matrix
GO:0070062extracellular exosome
GO:1903561extracellular vesicle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000421FA58C
IPR008979Galactose-bd-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005178integrin binding
GO:0005509calcium ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007275multicellular organism development
GO:0010811positive regulation of cell-substrate adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000421Coagulation factor 5/8 C-terminal domainSMARTSM00231disc_4coord: 181..341
e-value: 6.9E-16
score: 68.8
coord: 25..179
e-value: 4.8E-15
score: 66.0
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 43..176
e-value: 4.9E-25
score: 88.1
coord: 218..336
e-value: 9.2E-22
score: 77.5
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01286FA58C_2coord: 325..341
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 72..101
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 220..249
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 182..341
score: 28.6
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 26..179
score: 36.192
IPR000421Coagulation factor 5/8 C-terminal domainCDDcd00057FA58Ccoord: 30..178
e-value: 2.75251E-41
score: 144.032
IPR000421Coagulation factor 5/8 C-terminal domainCDDcd00057FA58Ccoord: 217..340
e-value: 1.1473E-30
score: 114.757
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 16..180
e-value: 1.1E-51
score: 177.0
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 181..347
e-value: 1.1E-41
score: 144.6
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 361..570
e-value: 5.0E-15
score: 57.5
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 429..570
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 26..180
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 219..342
NoneNo IPR availablePANTHERPTHR24543FAMILY NOT NAMEDcoord: 26..180
coord: 217..345
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.773