Mitochondrial ATP synthase subunit b

Overview
NameMitochondrial ATP synthase subunit b
Smed IDSMED30024839
Length (bp)1044
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial ATP synthase subunit b (SMED30024839) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial ATP synthase subunit b (SMED30024839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial ATP synthase subunit b (SMED30024839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial ATP synthase subunit b (SMED30024839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30024839h1SMcG0016737 Contig38884newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024839h1SMcG0016737 Contig38884uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024839h1SMcG0016737 Contig19663uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024839h1SMcG0016737 Contig19663newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024839h1SMcG0016737 Contig308GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024839h1SMcG0016737 dd_Smed_v4_905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30024839h1SMcG0016737 dd_Smed_v6_905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30024839h1SMcG0016737 dd_Smed_v6_905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Human
Match: ATP5PB (ATP synthase peripheral stalk-membrane subunit b [Source:HGNC Symbol;Acc:HGNC:840])

HSP 1 Score: 107.071 bits (266), Expect = 1.741e-26
Identity = 66/201 (32.84%), Postives = 106/201 (52.74%), Query Frame = 3
Query:  396 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNG-SFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
            Y  KVR G+ P+E+F  LY KTGVTGPY+   G I   + KEI V +  +F  +    + V  + KY   P  A F   L+++         + +      +I+  K ++ +      LF   + N+ + LE  YR+R Y VY  +KN+LDYH   +   +R ++ +++NW+   V +  + + +K T+A+CI DLK LAK
Sbjct:   50 YGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKY--GPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAK 248          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Human
Match: ATP5PB (ATP synthase peripheral stalk-membrane subunit b [Source:HGNC Symbol;Acc:HGNC:840])

HSP 1 Score: 76.2554 bits (186), Expect = 7.801e-16
Identity = 51/180 (28.33%), Postives = 88/180 (48.89%), Query Frame = 3
Query:  459 TGVTGPYLFMWGGIALLMQKEIIVFNG-SFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
                GPY+   G I   + KEI V +  +F  +    + V  + KY   P  A F   L+++         + +      +I+  K ++ +      LF   + N+ + LE  YR+R Y VY  +KN+LDYH   +   +R ++ +++NW+   V +  + + +K T+A+CI DLK LAK
Sbjct:   10 AATAGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKY--GPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAK 187          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Celegans
Match: asb-2 (ATP Synthase B homolog [Source:UniProtKB/TrEMBL;Acc:Q19126])

HSP 1 Score: 86.6557 bits (213), Expect = 4.235e-19
Identity = 60/200 (30.00%), Postives = 97/200 (48.50%), Query Frame = 3
Query:  363 FKKFPDND--------ST*YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPV-RAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYT 935
            FK+ PD D           Y PK R+ + PD WF      TGV+GPYLF  G  A L+ KE+ VF     + +   +  +++T+     + +  +    ++  +F G    ++   V  K    AK+ + +  +      A KE++ LQLE+ YRK    V   +K ++DY KE E +K R +R  LL  I + V K+++
Sbjct:   84 FKEHPDRDLVNYPYPARPMYPPKSRLLMMPDSWFTPFQKVTGVSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVTRTAGYKIDQGLYNGYQERVNFFKGLIQEDLKEAVEFKKTS-AKQTESLNSIKESYPTALKESMALQLEATYRKNVQSVATELKRRIDYLKETEESKARVEREQLLKLINSEVDKEFS 282          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Celegans
Match: asb-2 (ATP Synthase B homolog [Source:UniProtKB/TrEMBL;Acc:Q19126])

HSP 1 Score: 86.6557 bits (213), Expect = 4.235e-19
Identity = 60/200 (30.00%), Postives = 97/200 (48.50%), Query Frame = 3
Query:  363 FKKFPDND--------ST*YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPV-RAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYT 935
            FK+ PD D           Y PK R+ + PD WF      TGV+GPYLF  G  A L+ KE+ VF     + +   +  +++T+     + +  +    ++  +F G    ++   V  K    AK+ + +  +      A KE++ LQLE+ YRK    V   +K ++DY KE E +K R +R  LL  I + V K+++
Sbjct:   84 FKEHPDRDLVNYPYPARPMYPPKSRLLMMPDSWFTPFQKVTGVSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVTRTAGYKIDQGLYNGYQERVNFFKGLIQEDLKEAVEFKKTS-AKQTESLNSIKESYPTALKESMALQLEATYRKNVQSVATELKRRIDYLKETEESKARVEREQLLKLINSEVDKEFS 282          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Celegans
Match: asb-2 (ATP Synthase B homolog [Source:UniProtKB/TrEMBL;Acc:Q19126])

HSP 1 Score: 86.6557 bits (213), Expect = 4.235e-19
Identity = 60/200 (30.00%), Postives = 97/200 (48.50%), Query Frame = 3
Query:  363 FKKFPDND--------ST*YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPV-RAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYT 935
            FK+ PD D           Y PK R+ + PD WF      TGV+GPYLF  G  A L+ KE+ VF     + +   +  +++T+     + +  +    ++  +F G    ++   V  K    AK+ + +  +      A KE++ LQLE+ YRK    V   +K ++DY KE E +K R +R  LL  I + V K+++
Sbjct:   84 FKEHPDRDLVNYPYPARPMYPPKSRLLMMPDSWFTPFQKVTGVSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVTRTAGYKIDQGLYNGYQERVNFFKGLIQEDLKEAVEFKKTS-AKQTESLNSIKESYPTALKESMALQLEATYRKNVQSVATELKRRIDYLKETEESKARVEREQLLKLINSEVDKEFS 282          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Celegans
Match: asb-1 (ATP Synthase B homolog [Source:UniProtKB/TrEMBL;Acc:Q20053])

HSP 1 Score: 85.1149 bits (209), Expect = 1.431e-18
Identity = 65/220 (29.55%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  363 FKKFPDNDST*YH--------PKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKV-WFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTP-ELDKATLAQCINDLKKLA 992
            FK+ PD D T Y         PK R+ + PD WF A    TG +GPYLF  G  A L+ KE+ VF     + +   +  +++++     + A       ++V +F G    ++   V  +    A+     A +   +  + K+++ LQLE+ YRK    +   IK +++Y KE E  K RF+R  LL  I +SV K  +  +  +  L   I  LK +A
Sbjct:   82 FKEHPDRDLTNYPYPSRPMYPPKTRLLMMPDSWFTAFQKVTGTSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVSRTAGYKIDAGLYKDYQERVGFFKGLIQEDLKEAVDFRKTSAAQ-TASFAALKEGMPTSLKDSMQLQLEAAYRKNVQTISNEIKRRIEYLKETEETKARFERDQLLKLINDSVEKQVSQKDFQEKFLQNAIQQLKGIA 300          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Celegans
Match: asb-1 (ATP Synthase B homolog [Source:UniProtKB/TrEMBL;Acc:Q20053])

HSP 1 Score: 85.1149 bits (209), Expect = 1.431e-18
Identity = 65/220 (29.55%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  363 FKKFPDNDST*YH--------PKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKV-WFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTP-ELDKATLAQCINDLKKLA 992
            FK+ PD D T Y         PK R+ + PD WF A    TG +GPYLF  G  A L+ KE+ VF     + +   +  +++++     + A       ++V +F G    ++   V  +    A+     A +   +  + K+++ LQLE+ YRK    +   IK +++Y KE E  K RF+R  LL  I +SV K  +  +  +  L   I  LK +A
Sbjct:   82 FKEHPDRDLTNYPYPSRPMYPPKTRLLMMPDSWFTAFQKVTGTSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVSRTAGYKIDAGLYKDYQERVGFFKGLIQEDLKEAVDFRKTSAAQ-TASFAALKEGMPTSLKDSMQLQLEAAYRKNVQTISNEIKRRIEYLKETEETKARFERDQLLKLINDSVEKQVSQKDFQEKFLQNAIQQLKGIA 300          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Fly
Match: ATPsynB (gene:FBgn0019644 transcript:FBtr0076405)

HSP 1 Score: 133.265 bits (334), Expect = 8.359e-37
Identity = 78/201 (38.81%), Postives = 111/201 (55.22%), Query Frame = 3
Query:  399 HP-KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDK--KVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLA 992
            HP KVR+G  P+EWF   Y+KTGVTGPY F  G I  L  KEI V    +   L   I  +I  K L   +  +    +DK    W  G R  E+  L  + +IE  K+E+  AD  + L +A KEN+ LQLE+ +R+R  +VY  +K +LDY  E    ++R  + +++NWI  +V    +P+ +K TL +CI DL  LA
Sbjct:   40 HPGKVRLGFLPEEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAIIAVKKLGPVIAKWADGEIDKIESEWKEG-REAELKVL--SDAIEAEKKEQWRADGALLLMEAKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHVERRLSQKHMVNWITTNVLASISPQQEKETLNKCIADLSALA 237          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Zebrafish
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:ZFIN;Acc:ZDB-GENE-041010-33])

HSP 1 Score: 107.457 bits (267), Expect = 8.450e-27
Identity = 73/201 (36.32%), Postives = 107/201 (53.23%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAK---PVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKT 998
            KVR GIFP+E F  LY KTGVTGPY+   G +  L+ KEI V N     +    I  VI+  Y  K   P  A F   L+           + +     + IE  K+E+   +    LF A + NV + LE  YR+R + V   +K +LDY  E +   +R ++ +++NW+  SV K  TP+ +K ++A+CI+DLK LAK+
Sbjct:   49 KVRHGIFPEEIFTMLYPKTGVTGPYMLGTGLLLYLLSKEIYVINHE--TIAGASIGAVII--YAVKKFGPSVAAFADKLNADKIAKAQEVKDQSMASYAQGIENEKKEQWRVEGRSMLFDAKRNNVAMLLEINYRERLHMVTNEVKKRLDYQVELQNLHRRMEQEHMVNWVEQSVVKSITPQQEKESIAKCISDLKVLAKS 245          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Zebrafish
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:ZFIN;Acc:ZDB-GENE-041010-33])

HSP 1 Score: 107.457 bits (267), Expect = 8.450e-27
Identity = 73/201 (36.32%), Postives = 107/201 (53.23%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAK---PVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKT 998
            KVR GIFP+E F  LY KTGVTGPY+   G +  L+ KEI V N     +    I  VI+  Y  K   P  A F   L+           + +     + IE  K+E+   +    LF A + NV + LE  YR+R + V   +K +LDY  E +   +R ++ +++NW+  SV K  TP+ +K ++A+CI+DLK LAK+
Sbjct:   49 KVRHGIFPEEIFTMLYPKTGVTGPYMLGTGLLLYLLSKEIYVINHE--TIAGASIGAVII--YAVKKFGPSVAAFADKLNADKIAKAQEVKDQSMASYAQGIENEKKEQWRVEGRSMLFDAKRNNVAMLLEINYRERLHMVTNEVKKRLDYQVELQNLHRRMEQEHMVNWVEQSVVKSITPQQEKESIAKCISDLKVLAKS 245          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Xenopus
Match: uqcrfs1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [Source:Xenbase;Acc:XB-GENE-5746219])

HSP 1 Score: 110.153 bits (274), Expect = 1.223e-27
Identity = 67/198 (33.84%), Postives = 106/198 (53.54%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKT 998
            KVR G+ P+E+F  LY KTGVTGPY+   G +  L+ KEI V N          I +V   K     V A+   + ++KV        + A     ++IE   +E+   +    LF A + NV + LE  YR+R  +VY  +K +LDY    +  ++R ++ +++NW+  +V +  TP+  K ++A+CI DLK L+KT
Sbjct:   49 KVRFGLIPEEFFQFLYPKTGVTGPYMLGTGLLVYLLSKEIYVINHETFAAASIGIVIVYGIKKFGPSVAAFADKLNEEKVA-KAQAVKDSALKNLERAIEEENKEQWRVEGRHHLFDAKRNNVTMLLEINYRERILNVYNEVKKRLDYQVALQHLQRRKEQDHMINWVEKNVIQSITPQQQKESIAKCITDLKVLSKT 245          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Mouse
Match: Atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:MGI Symbol;Acc:MGI:1100495])

HSP 1 Score: 106.301 bits (264), Expect = 2.476e-26
Identity = 68/207 (32.85%), Postives = 109/207 (52.66%), Query Frame = 3
Query:  396 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFN-GSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANK------SIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
            Y  KVR+G+ P+E+F  LY KTGVTGPY+   G     + KEI V    +F     + ISVV +  Y+ K   A F   +DK    N  +  ++  +  +       +I++ K ++ +      LF   + N+ L LE  YR+R +  Y  +KN+LDYH   +   +R +  ++++W+   V K  + + +K T+A+CI DLK LAK
Sbjct:   50 YGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETF-----STISVVGLIVYVIKKYGASFGEFIDK---LNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEVTYRERLHKAYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCIEDLKLLAK 248          
BLAST of Mitochondrial ATP synthase subunit b vs. UniProt/SwissProt
Match: sp|Q94516|AT5F1_DROME (ATP synthase subunit b, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynB PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 8.379e-36
Identity = 78/201 (38.81%), Postives = 111/201 (55.22%), Query Frame = 3
Query:  399 HP-KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDK--KVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLA 992
            HP KVR+G  P+EWF   Y+KTGVTGPY F  G I  L  KEI V    +   L   I  +I  K L   +  +    +DK    W  G R  E+  L  + +IE  K+E+  AD  + L +A KEN+ LQLE+ +R+R  +VY  +K +LDY  E    ++R  + +++NWI  +V    +P+ +K TL +CI DL  LA
Sbjct:   40 HPGKVRLGFLPEEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAIIAVKKLGPVIAKWADGEIDKIESEWKEG-REAELKVL--SDAIEAEKKEQWRADGALLLMEAKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHVERRLSQKHMVNWITTNVLASISPQQEKETLNKCIADLSALA 237          
BLAST of Mitochondrial ATP synthase subunit b vs. UniProt/SwissProt
Match: sp|P24539|AT5F1_HUMAN (ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 8.363e-26
Identity = 66/201 (32.84%), Postives = 106/201 (52.74%), Query Frame = 3
Query:  396 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNG-SFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
            Y  KVR G+ P+E+F  LY KTGVTGPY+   G I   + KEI V +  +F  +    + V  + KY   P  A F   L+++         + +      +I+  K ++ +      LF   + N+ + LE  YR+R Y VY  +KN+LDYH   +   +R ++ +++NW+   V +  + + +K T+A+CI DLK LAK
Sbjct:   50 YGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKY--GPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAK 248          
BLAST of Mitochondrial ATP synthase subunit b vs. UniProt/SwissProt
Match: sp|Q9CQQ7|AT5F1_MOUSE (ATP synthase F(0) complex subunit B1, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pb PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.732e-25
Identity = 68/207 (32.85%), Postives = 109/207 (52.66%), Query Frame = 3
Query:  396 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFN-GSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANK------SIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
            Y  KVR+G+ P+E+F  LY KTGVTGPY+   G     + KEI V    +F     + ISVV +  Y+ K   A F   +DK    N  +  ++  +  +       +I++ K ++ +      LF   + N+ L LE  YR+R +  Y  +KN+LDYH   +   +R +  ++++W+   V K  + + +K T+A+CI DLK LAK
Sbjct:   50 YGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETF-----STISVVGLIVYVIKKYGASFGEFIDK---LNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEVTYRERLHKAYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCIEDLKLLAK 248          
BLAST of Mitochondrial ATP synthase subunit b vs. UniProt/SwissProt
Match: sp|Q5RFH9|AT5F1_PONAB (ATP synthase F(0) complex subunit B1, mitochondrial OS=Pongo abelii OX=9601 GN=ATP5PB PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.137e-25
Identity = 64/200 (32.00%), Postives = 105/200 (52.50%), Query Frame = 3
Query:  396 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
            Y  KVR G+ P+E+F  LY KTGVTGPY+   G I   + KEI V +      L + I V++       P  A F   L+++         + +      +I++ K ++ +      LF   + N+ + LE  YR+R Y VY  +KN+LDYH   +   ++ ++ +++NW+   V +  + + +K T+A+CI DLK LAK
Sbjct:   50 YGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTAL-SLIGVMVYGIKKYGPAVADFADKLNEQKLAQLEEAKQTSIQQIQNAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHIYVQNMMRQKEQEHMVNWVEKHVVQSISTQQEKETIAKCIADLKLLAK 248          
BLAST of Mitochondrial ATP synthase subunit b vs. UniProt/SwissProt
Match: sp|P13619|AT5F1_BOVIN (ATP synthase F(0) complex subunit B1, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PB PE=1 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 2.081e-24
Identity = 61/203 (30.05%), Postives = 106/203 (52.22%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVA------NKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAK 995
            KVR G+ P+E+F  LY KTGVTGPY+   G I  L+ KEI V       + P   S +    +L   V+ Y  ++ +     N  +  ++  +          +I++ K ++ +      LF   + N+ + LE  YR+R + VY  +KN+LDYH   +   ++ ++ +++NW+   V +  + + +K T+A+CI DLK L+K
Sbjct:   53 KVRFGLIPEEFFQFLYPKTGVTGPYVLGTGLILYLLSKEIYV-------ITPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQSISAQQEKETIAKCIADLKLLSK 248          
BLAST of Mitochondrial ATP synthase subunit b vs. TrEMBL
Match: A0A183TDA2 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS14450 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.312e-44
Identity = 88/209 (42.11%), Postives = 121/209 (57.89%), Query Frame = 3
Query:  399 HPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKV--WFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQ-KTVSM 1016
            HPKVR+G  PD WF ALY +TGVTGPYLF+ G +A L+ KEI V +  F  V+P  + +  M K        Y      K++  ++       +A L  + +I+ A  E   A     LFQA KEN+ LQLE+ YR+R   V+  +  +LDYH E+E  ++RFQ+ ++ NWI NSV    TP  +K T+ QCI DLK LAK Q +T S+
Sbjct:   88 HPKVRLGFLPDSWFQALYSRTGVTGPYLFLTGSVAFLLSKEIWVVDAHFMEVIPFVLIMTWMIKTFGSRASDYLDQFTQKRIDHFYTNPMKKALANL--DNTIKSADEEIARAASVPTLFQAKKENLDLQLEAAYRERLQRVHKMVTRRLDYHVERENVRRRFQQQHMANWITNSVISGITPTQEKETIRQCIEDLKNLAKAQSRTASL 294          
BLAST of Mitochondrial ATP synthase subunit b vs. TrEMBL
Match: A0A0X3PWM3 (ATP synthase subunit b (Fragment) OS=Schistocephalus solidus OX=70667 GN=AT5F1 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.545e-44
Identity = 88/209 (42.11%), Postives = 121/209 (57.89%), Query Frame = 3
Query:  399 HPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKV--WFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQ-KTVSM 1016
            HPKVR+G  PD WF ALY +TGVTGPYLF+ G +A L+ KEI V +  F  V+P  + +  M K        Y      K++  ++       +A L  + +I+ A  E   A     LFQA KEN+ LQLE+ YR+R   V+  +  +LDYH E+E  ++RFQ+ ++ NWI NSV    TP  +K T+ QCI DLK LAK Q +T S+
Sbjct:  109 HPKVRLGFLPDSWFQALYSRTGVTGPYLFLTGSVAFLLSKEIWVVDAHFMEVIPFVLIMTWMIKTFGSRASDYLDQFTQKRIDHFYTNPMKKALANL--DNTIKSADEEIARAASVPTLFQAKKENLDLQLEAAYRERLQRVHKMVTRRLDYHVERENVRRRFQQQHMANWITNSVISGITPTQEKETIRQCIEDLKNLAKAQSRTASL 315          
BLAST of Mitochondrial ATP synthase subunit b vs. TrEMBL
Match: A0A4V3SGL9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001861 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 3.522e-43
Identity = 90/222 (40.54%), Postives = 134/222 (60.36%), Query Frame = 3
Query:  363 FKKFPDNDST*YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAK--PVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNI--ELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM 1016
            FK FP    +  HPKVR+G  PD WF ALY  TGVTGPYLF++G  A L+ KEI+V +  F   +   + +V+MT  + K  P+ A F     +KV    +  P + +L  N    +A  ++E+   +    L +A +ENV LQLE+ YR+R   VY A+  +LDYH E+E  ++RFQ+++L+NW+V+ V K  TP  +K TL  CI +LK+LA+  K+ ++
Sbjct:   82 FKNFPTVKYSVTHPKVRLGFLPDAWFQALYPITGVTGPYLFLFGSTAFLISKEILVVDPHF---VEMGVFIVLMTGLMKKFGPLFAEFLDKHTEKVEQVRYYEP-LNSLHRNLDETIATADEEITRASAVESLVKAKEENVALQLEAAYRERLQQVYRAVHRRLDYHVERENTRRRFQQTHLVNWVVDQVVKGITPAQEKETLTYCIGELKRLAQVHKSTAV 299          
BLAST of Mitochondrial ATP synthase subunit b vs. TrEMBL
Match: A0A183MXR0 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS20835 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 7.105e-43
Identity = 84/219 (38.36%), Postives = 133/219 (60.73%), Query Frame = 3
Query:  363 FKKFPDNDST*YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSF-GLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHR-TPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVS 1013
            F+ +P       HPKVRMG+FPD WF   Y+KTGVTGPY+F++G    L+ KEI VFNG F   V+   +SV+I+ ++ A+  R   + + ++      H+   E+ + + N +I+  + E E A    E  +A +EN+ LQLE+ YR+R   VY  +  +L+YH E+E  ++R+ + +++NW+V+ V K  TP  +K TL  CIN+LK+LA+  K  +
Sbjct:   79 FENYPTFKLARCHPKVRMGVFPDSWFQPFYNKTGVTGPYMFLFGSFMFLINKEIWVFNGHFLEFVVFLSMSVMIVKRFGAR-TRKIVEKLAEEDEHLMYHQPINEVKSYIDN-TIKTCEMEVERAAAVPEHVRAKEENIALQLEASYRERLQSVYRTVHRRLEYHVERENTRKRYIQQHMVNWVVDHVVKGITPAQEKDTLTHCINELKRLAQASKVTT 295          
BLAST of Mitochondrial ATP synthase subunit b vs. TrEMBL
Match: A0A075AIV4 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12840 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.559e-43
Identity = 93/222 (41.89%), Postives = 130/222 (58.56%), Query Frame = 3
Query:  363 FKKFPDNDST*YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAK--PVRAYFQTILDKKVWFNGHRTPEIATLVAN--KSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM 1016
            FK FP       HPKVR+G  PD WF  LY  TGVTGPYLF++G  A L+ KEI+V +  F   +   + +V+MT  + K  P+ A F     +KV    +  P +  L  N  K+I  A  E   A     L +A +ENV LQLE+ YR+R   VY A+  +LDYH E+E  ++RFQ+++L+NW+V+ V K  TP  +K TL  CI +LK+LA+  KT ++
Sbjct:  100 FKNFPTVKYPLKHPKVRLGFIPDAWFQTLYPITGVTGPYLFLFGSTAFLISKEILVVDPHF---IEMGVFIVLMTGLIKKFGPLVAEFLDKHTEKVEQIRYYEP-LNALHRNLDKTIATANEEIARASAVESLVKAKEENVALQLEAAYRERLQQVYRAVHRRLDYHVERENTRRRFQQTHLINWVVDQVVKGITPAQEKETLTYCIGELKRLAQVHKTAAV 317          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Cavefish
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:NCBI gene;Acc:111194600])

HSP 1 Score: 116.701 bits (291), Expect = 2.419e-30
Identity = 68/201 (33.83%), Postives = 110/201 (54.73%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKT 1007
            K+R GIFP+E F+ LY KTGVTGPY+   G +  ++ KEI V N      L     ++   K     V AY   + ++KV        ++A     ++IE  K+E+   +    LF   + NV + LE+ YR+R + V   +K +LDY  E +   +R ++ +++NW+  +V K  TP+ +K ++A+CI+DLK LAK  + 
Sbjct:   49 KIRHGIFPEELFSLLYPKTGVTGPYMLGTGLLLYMLSKEIYVINHETFAALSISSVIIYGIKKFGPGVAAYADKLNEEKVA-KAQEVKDVAVARLAQAIEDEKKEQWRVEGRHMLFDTKRNNVTMLLETNYRERLHMVTSEVKRRLDYQVELQNLHRRMEQEHMVNWVEQNVVKSITPQQEKESIAKCISDLKVLAKATQA 248          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Cavefish
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:NCBI gene;Acc:111194600])

HSP 1 Score: 116.701 bits (291), Expect = 2.545e-30
Identity = 68/198 (34.34%), Postives = 109/198 (55.05%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKT 998
            K+R GIFP+E F+ LY KTGVTGPY+   G +  ++ KEI V N      L     ++   K     V AY   + ++KV        ++A     ++IE  K+E+   +    LF   + NV + LE+ YR+R + V   +K +LDY  E +   +R ++ +++NW+  +V K  TP+ +K ++A+CI+DLK LAK 
Sbjct:   53 KIRHGIFPEELFSLLYPKTGVTGPYMLGTGLLLYMLSKEIYVINHETFAALSISSVIIYGIKKFGPGVAAYADKLNEEKVA-KAQEVKDVAVARLAQAIEDEKKEQWRVEGRHMLFDTKRNNVTMLLETNYRERLHMVTSEVKRRLDYQVELQNLHRRMEQEHMVNWVEQNVVKSITPQQEKESIAKCISDLKVLAKA 249          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Sea Lamprey
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:ZFIN;Acc:ZDB-GENE-041010-33])

HSP 1 Score: 66.6254 bits (161), Expect = 4.254e-13
Identity = 64/207 (30.92%), Postives = 95/207 (45.89%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEI-IVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKV-WFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVN----SVRKDYTPELDKATLAQCINDLKKLAKTQKT 1007
            KVR+G  P+E F  LY K GV  P+    G +  L+ KE+ I+ N +F  +    I + I+ KY  K V AY   + D+ +   N  R   I  L   K+IE  K+E+   +    LF A K    +  +     R    +L +K +LD           F    L + +++    SV     P  DK T+A+CI DLK L+KT + 
Sbjct:   20 KVRLGFVPEELFQFLYPKIGVILPFALGRGLLTYLLSKELYIINNETFAGLSMAAILIYIIKKY-GKDVAAYADKLNDELIESVNSVRDVTINNLT--KAIENEKKEQWCVEGRNMLFDAKKVVSAMLFKLQSLNRLNLAFLKVKRRLDTSSP---GLNSFHGLVLASLVISKRRRSVLHSELPRKDKDTIAKCIADLKVLSKTAQA 220          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Sea Lamprey
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:ZFIN;Acc:ZDB-GENE-041010-33])

HSP 1 Score: 58.9214 bits (141), Expect = 2.233e-10
Identity = 60/205 (29.27%), Postives = 93/205 (45.37%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEI-IVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKV-WFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAK--ENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKT 1007
            KVR+G  P+E F  LY K GV  P+    G +  L+ KE+ I+ N +F  +    I + I+ KY  K V AY   + D+ +   N  R   I  L   K+IE  K+E+   +    LF A K    +  +L+S+ R     + +   +         L  +R       +W    + +      DK T+A+CI DLK L+KT + 
Sbjct:   31 KVRLGFVPEELFQFLYPKIGVILPFALGRGLLTYLLSKELYIINNETFAGLSMAAILIYIIKKY-GKDVAAYADKLNDELIESVNSVRDVTINNL--TKAIENEKKEQWCVEGRNMLFDAKKVVSAMLFKLQSLNRLNLAFLKVKCNSPQQVAGISLLKDRRLDVPEAFHWHRTVLLRIARSAQDKDTIAKCIADLKVLSKTAQA 232          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Nematostella
Match: EDO43737 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXX3])

HSP 1 Score: 75.0998 bits (183), Expect = 8.913e-16
Identity = 55/191 (28.80%), Postives = 94/191 (49.21%), Query Frame = 3
Query:  456 KTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVI------MTKYLAKPVRAYF----QTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKEN--VGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLA 992
            KTG TG  +F  G  A L+  EI++ +        TYI+ V+      + K    P+        Q ILD    FN  R   I  L    +I+  K  + +     ++ +  +EN  +G++LE  YR   + V   +K +LDY  E E   ++ +++++++W+   V K  TP+ +K +++QCI DLK +A
Sbjct:   62 KTGETGQLMFFGGLAAYLLSNEILIIHEE------TYIAAVMGGTFYWLMKKAGGPIAEMLDNTSQEILDA---FNVGRNASIKHL--QDAIDNEKHLEHMLSCRTDIIEMMRENNVMGMELE--YRNNVHHVVKEVKKRLDYQVEMETFHRKVEQAHIIDWVEKEVIKSITPQQEKESISQCIRDLKAMA 239          
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Medaka
Match: atp5pb (ATP synthase peripheral stalk-membrane subunit b [Source:NCBI gene;Acc:110015346])

HSP 1 Score: 106.301 bits (264), Expect = 5.076e-26
Identity = 64/195 (32.82%), Postives = 101/195 (51.79%), Query Frame = 3
Query:  405 KVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKL 989
            KVR GIFP+E F  LY KTGVTGPY+   G I  ++ KEI V N           +++   K     V      I ++KV        ++A     ++I+  K+E+   +    LF A + NV + LE+ YR+R + V   +K +LDY    +    R ++ +++NW+  +V    TP+ +K ++A+CI DLK L
Sbjct:  109 KVRHGIFPEELFQLLYPKTGVTGPYMLGTGLILYMLSKEIYVINHETFAAASIGTAIIYGVKKFGPTVANLADKINEEKVA-KAQEVKDVAISSLTQAIDDEKKEQWRVEGRSMLFDAKRNNVAMLLETNYRERLHMVTNEVKRRLDYQIALQNLHHRLEQEHMINWVEKNVISSITPQQEKESIAKCITDLKVL 302          
BLAST of Mitochondrial ATP synthase subunit b vs. Planmine SMEST
Match: SMESG000077800.1 (SMESG000077800.1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.918e-152
Identity = 206/207 (99.52%), Postives = 207/207 (100.00%), Query Frame = 3
Query:  396 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM 1016
            YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSY+LNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM
Sbjct:    6 YHPKVRMGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYVLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM 212          
BLAST of Mitochondrial ATP synthase subunit b vs. Planmine SMEST
Match: SMESG000077800.1 (SMESG000077800.1)

HSP 1 Score: 414.075 bits (1063), Expect = 2.106e-147
Identity = 200/201 (99.50%), Postives = 201/201 (100.00%), Query Frame = 3
Query:  414 MGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM 1016
            MGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSY+LNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM
Sbjct:    1 MGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPTYISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAKREKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKELAKQRFQRSYVLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVSM 201          
The following BLAST results are available for this feature:
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ATP5PB1.741e-2632.84ATP synthase peripheral stalk-membrane subunit b [... [more]
ATP5PB7.801e-1628.33ATP synthase peripheral stalk-membrane subunit b [... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asb-24.235e-1930.00ATP Synthase B homolog [Source:UniProtKB/TrEMBL;A... [more]
asb-24.235e-1930.00ATP Synthase B homolog [Source:UniProtKB/TrEMBL;A... [more]
asb-24.235e-1930.00ATP Synthase B homolog [Source:UniProtKB/TrEMBL;A... [more]
asb-11.431e-1829.55ATP Synthase B homolog [Source:UniProtKB/TrEMBL;A... [more]
asb-11.431e-1829.55ATP Synthase B homolog [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ATPsynB8.359e-3738.81gene:FBgn0019644 transcript:FBtr0076405[more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp5pb8.450e-2736.32ATP synthase peripheral stalk-membrane subunit b [... [more]
atp5pb8.450e-2736.32ATP synthase peripheral stalk-membrane subunit b [... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
uqcrfs11.223e-2733.84ubiquinol-cytochrome c reductase, Rieske iron-sulf... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atp5pb2.476e-2632.85ATP synthase peripheral stalk-membrane subunit b [... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94516|AT5F1_DROME8.379e-3638.81ATP synthase subunit b, mitochondrial OS=Drosophil... [more]
sp|P24539|AT5F1_HUMAN8.363e-2632.84ATP synthase F(0) complex subunit B1, mitochondria... [more]
sp|Q9CQQ7|AT5F1_MOUSE1.732e-2532.85ATP synthase F(0) complex subunit B1, mitochondria... [more]
sp|Q5RFH9|AT5F1_PONAB4.137e-2532.00ATP synthase F(0) complex subunit B1, mitochondria... [more]
sp|P13619|AT5F1_BOVIN2.081e-2430.05ATP synthase F(0) complex subunit B1, mitochondria... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183TDA22.312e-4442.11Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3PWM33.545e-4442.11ATP synthase subunit b (Fragment) OS=Schistocephal... [more]
A0A4V3SGL93.522e-4340.54Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183MXR07.105e-4338.36Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A075AIV49.559e-4341.89Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp5pb2.419e-3033.83ATP synthase peripheral stalk-membrane subunit b [... [more]
atp5pb2.545e-3034.34ATP synthase peripheral stalk-membrane subunit b [... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp5pb4.254e-1330.92ATP synthase peripheral stalk-membrane subunit b [... [more]
atp5pb2.233e-1029.27ATP synthase peripheral stalk-membrane subunit b [... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO437378.913e-1628.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp5pb5.076e-2632.82ATP synthase peripheral stalk-membrane subunit b [... [more]
back to top
BLAST of Mitochondrial ATP synthase subunit b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077800.11.918e-15299.52SMESG000077800.1[more]
SMESG000077800.12.106e-14799.50SMESG000077800.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024839 ID=SMED30024839|Name=Mitochondrial ATP synthase subunit b|organism=Schmidtea mediterranea sexual|type=transcript|length=1044bp
TGAATTAATTTATTTAGATATTCGAAACTATCGCATAAACATTTGAAAAT
GATTAAGTTAACTACCATTTTTCCAATTATATCTAAACAATTAATTACGC
GAACTCTTGCTTATGAAGTGCCAGTTTTCGATGTGTCTAAAATAGATGAA
TATGCCAAAGCTTCAAATGCAACTAATAAAGACTCTTCTCTTATTTTGGC
ACCTTATGCCTTAGATTTTAAAACAGTTCTACCAAAATCAACTGCAGAAA
AATCTGTTTATGAAAAGAAAGTAGAAATATGTAACGCTTTTATACATAGA
TATAATGTAATAGCAAATAAATGGGAAGAAGTGTATGAAAAATATTATGG
TAAAGAGCGAGATTTAAAAAATTTCCCGACAATGACAGTACCTGATATCA
TCCAAAAGTTAGAATGGGCATATTTCCGGATGAGTGGTTTAATGCTTTGT
ACGATAAAACTGGAGTTACTGGTCCATATTTGTTTATGTGGGGCGGAATA
GCGCTCCTGATGCAGAAAGAAATAATTGTATTTAACGGCTCTTTTGGTTT
GGTTCTGCCAACGTATATTTCGGTCGTAATAATGACCAAATATTTAGCTA
AGCCAGTTCGAGCGTACTTTCAAACAATTTTAGATAAAAAAGTCTGGTTC
AATGGTCATCGCACGCCAGAAATTGCCACCCTTGTAGCAAATAAATCCAT
TGAAGTAGCGAAACGAGAGAAAGAAGTTGCCGATGTTAATATTGAACTTT
TCCAAGCTGCTAAAGAAAATGTTGGTTTGCAATTGGAAAGTATTTATCGG
AAAAGAAATTACGATGTCTATTTAGCGATTAAAAACAAACTAGACTATCA
CAAGGAGAAAGAATTGGCCAAACAACGTTTTCAGCGCAGCTATTTGTTGA
ATTGGATTGTAAACTCTGTAAGGAAGGATTATACTCCGGAACTTGACAAG
GCGACTCTGGCGCAATGCATTAATGATTTGAAAAAGTTGGCCAAGACCCA
GAAAACGGTTTCAATGTAAATGAAAGAGATAGGGAAGTAATTGC
back to top

protein sequence of SMED30024839-orf-1

>SMED30024839-orf-1 ID=SMED30024839-orf-1|Name=SMED30024839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MIKLTTIFPIISKQLITRTLAYEVPVFDVSKIDEYAKASNATNKDSSLIL
APYALDFKTVLPKSTAEKSVYEKKVEICNAFIHRYNVIANKWEEVYEKYY
GKERDLKNFPTMTVPDIIQKLEWAYFRMSGLMLCTIKLELLVHICLCGAE
*
back to top

protein sequence of SMED30024839-orf-2

>SMED30024839-orf-2 ID=SMED30024839-orf-2|Name=SMED30024839-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MGIFPDEWFNALYDKTGVTGPYLFMWGGIALLMQKEIIVFNGSFGLVLPT
YISVVIMTKYLAKPVRAYFQTILDKKVWFNGHRTPEIATLVANKSIEVAK
REKEVADVNIELFQAAKENVGLQLESIYRKRNYDVYLAIKNKLDYHKEKE
LAKQRFQRSYLLNWIVNSVRKDYTPELDKATLAQCINDLKKLAKTQKTVS
M*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013837ATP_synth_F0_suB
IPR008688ATPase_B_chain/sub_B/MI25
Vocabulary: biological process
TermDefinition
GO:0015986ATP synthesis coupled proton transport
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0000276mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013837ATP synthase, F0 complex, subunit BPANTHERPTHR12733MITOCHONDRIAL ATP SYNTHASE B CHAINcoord: 74..149