Polyubiquitin

Overview
NamePolyubiquitin
Smed IDSMED30024835
Length (bp)856
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polyubiquitin (SMED30024835) t-SNE clustered cells

Violin plots show distribution of expression levels for Polyubiquitin (SMED30024835) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024835

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024835h1SMcG0017816 dd_Smed_v4_11294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024835h1SMcG0017816 dd_Smed_v4_11294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024835h1SMcG0017816 dd_Smed_v4_11294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024835h1SMcG0017816 Contig12674newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024835h1SMcG0017816 Contig12674uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30024835h1SMcG0017816 dd_Smed_v4_11294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polyubiquitin vs. Ensembl Human
Match: UBC (ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468])

HSP 1 Score: 56.225 bits (134), Expect = 4.394e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Human
Match: UBC (ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468])

HSP 1 Score: 58.5362 bits (140), Expect = 4.706e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 56.225 bits (134), Expect = 2.818e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Human
Match: UBC (ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468])

HSP 1 Score: 58.5362 bits (140), Expect = 4.769e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 56.225 bits (134), Expect = 2.727e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Human
Match: UBA52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:HGNC Symbol;Acc:HGNC:12458])

HSP 1 Score: 55.8398 bits (133), Expect = 4.899e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Human
Match: UBC (ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468])

HSP 1 Score: 58.5362 bits (140), Expect = 5.216e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 56.225 bits (134), Expect = 3.206e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Celegans
Match: ubq-2 (Ubiquitin-60S ribosomal protein L40 Ubiquitin 60S ribosomal protein L40 [Source:UniProtKB/Swiss-Prot;Acc:P49632])

HSP 1 Score: 55.8398 bits (133), Expect = 9.277e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Celegans
Match: ubq-1 (Polyubiquitin-A Ubiquitin Ubiquitin-related [Source:UniProtKB/Swiss-Prot;Acc:P0CG71])

HSP 1 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 57.7658 bits (138), Expect = 3.066e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 56.6102 bits (135), Expect = 6.891e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          

HSP 7 Score: 49.6766 bits (117), Expect = 1.144e-6
Identity = 25/68 (36.76%), Postives = 44/68 (64.71%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQG 201
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG 503          
BLAST of Polyubiquitin vs. Ensembl Celegans
Match: ubq-1 (Polyubiquitin-A Ubiquitin Ubiquitin-related [Source:UniProtKB/Swiss-Prot;Acc:P0CG71])

HSP 1 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.9214 bits (141), Expect = 1.290e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 57.7658 bits (138), Expect = 3.066e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 56.6102 bits (135), Expect = 6.891e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          

HSP 7 Score: 49.6766 bits (117), Expect = 1.144e-6
Identity = 25/68 (36.76%), Postives = 44/68 (64.71%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQG 201
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAG 503          
BLAST of Polyubiquitin vs. Ensembl Celegans
Match: ubq-1 (Polyubiquitin-A Ubiquitin Ubiquitin-related [Source:UniProtKB/Swiss-Prot;Acc:P0CG71])

HSP 1 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   73 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  149 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  225 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  301 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  453 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 6 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  529 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 593          

HSP 7 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  605 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 669          

HSP 8 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  681 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 745          

HSP 9 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  757 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 821          

HSP 10 Score: 57.3806 bits (137), Expect = 4.097e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  377 LRGGMQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 11 Score: 56.6102 bits (135), Expect = 7.389e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Celegans
Match: ubq-1 (Polyubiquitin-A Ubiquitin Ubiquitin-related [Source:UniProtKB/Swiss-Prot;Acc:P0CG71])

HSP 1 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   73 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  149 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  225 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  301 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  453 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 6 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  529 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 593          

HSP 7 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  605 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 669          

HSP 8 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  681 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 745          

HSP 9 Score: 58.5362 bits (140), Expect = 1.712e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  757 LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 821          

HSP 10 Score: 57.3806 bits (137), Expect = 4.097e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  377 LRGGMQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 11 Score: 56.6102 bits (135), Expect = 7.389e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Fly
Match: RpL40 (gene:FBgn0003941 transcript:FBtr0334787)

HSP 1 Score: 55.4546 bits (132), Expect = 1.492e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Fly
Match: RpL40 (gene:FBgn0003941 transcript:FBtr0077470)

HSP 1 Score: 55.4546 bits (132), Expect = 1.492e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Fly
Match: Ubi-p5E (gene:FBgn0086558 transcript:FBtr0345892)

HSP 1 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 7 Score: 56.225 bits (134), Expect = 1.104e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Fly
Match: Ubi-p5E (gene:FBgn0086558 transcript:FBtr0070933)

HSP 1 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 7 Score: 56.225 bits (134), Expect = 1.104e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Fly
Match: Ubi-p63E (gene:FBgn0003943 transcript:FBtr0333142)

HSP 1 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 7 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  512 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 593          

HSP 8 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  588 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 669          

HSP 9 Score: 58.5362 bits (140), Expect = 2.587e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  664 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 745          

HSP 10 Score: 56.225 bits (134), Expect = 1.279e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Zebrafish
Match: ubb (ubiquitin B [Source:ZFIN;Acc:ZDB-GENE-050411-10])

HSP 1 Score: 56.6102 bits (135), Expect = 4.150e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Zebrafish
Match: ubb (ubiquitin B [Source:ZFIN;Acc:ZDB-GENE-050411-10])

HSP 1 Score: 58.5362 bits (140), Expect = 1.001e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 1.001e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 56.225 bits (134), Expect = 5.356e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Zebrafish
Match: CR848813.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_42:42047434:42048357:1 gene:ENSDARG00000116968.1 transcript:ENSDART00000187237.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR848813.2)

HSP 1 Score: 58.151 bits (139), Expect = 2.046e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.151 bits (139), Expect = 2.046e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.151 bits (139), Expect = 2.046e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 56.225 bits (134), Expect = 1.027e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Zebrafish
Match: uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:ZFIN;Acc:ZDB-GENE-051023-7])

HSP 1 Score: 55.4546 bits (132), Expect = 2.124e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Zebrafish
Match: UBB (si:ch211-202a12.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8486])

HSP 1 Score: 58.5362 bits (140), Expect = 2.850e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 2.850e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 2.850e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 2.850e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 2.850e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 56.225 bits (134), Expect = 1.381e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Xenopus
Match: uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:NCBI gene;Acc:448705])

HSP 1 Score: 56.225 bits (134), Expect = 6.787e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Xenopus
Match: ENSXETT00000033679.1 (ubiquitin C [Source:NCBI gene;Acc:448120])

HSP 1 Score: 58.5362 bits (140), Expect = 1.477e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 1.477e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 56.225 bits (134), Expect = 7.989e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Xenopus
Match: uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:NCBI gene;Acc:448705])

HSP 1 Score: 55.4546 bits (132), Expect = 2.852e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Xenopus
Match: pdcd11 (programmed cell death 11 [Source:Xenbase;Acc:XB-GENE-967218])

HSP 1 Score: 58.5362 bits (140), Expect = 4.677e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   67 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 148          

HSP 2 Score: 58.5362 bits (140), Expect = 4.677e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  143 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 224          

HSP 3 Score: 58.5362 bits (140), Expect = 4.677e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  219 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 300          

HSP 4 Score: 58.5362 bits (140), Expect = 4.677e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  295 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 376          

HSP 5 Score: 56.225 bits (134), Expect = 2.399e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   12 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 72          

HSP 6 Score: 55.8398 bits (133), Expect = 3.009e-8
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  584 LRGGMQIFVKTLTGKTITLEVEPSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLCDYNI 648          

HSP 7 Score: 55.8398 bits (133), Expect = 3.009e-8
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  660 LRGGMQIFVKTLTGKTITLEVEPSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLCDYNI 724          

HSP 8 Score: 55.8398 bits (133), Expect = 3.913e-8
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 1
Query:    1 VEDC-GIAD-----KSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            +EDC  +AD     +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  485 LEDCRSLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKGKIQDKEGIPPDQQRLIFAGKQLEDGRTLCDYNI 572          

HSP 9 Score: 55.4546 bits (132), Expect = 5.135e-8
Identity = 29/84 (34.52%), Postives = 52/84 (61.90%), Query Frame = 1
Query:   10 CGIADKS-----VINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            C ++D S     ++NV    + +M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D ++  +Y I
Sbjct:  413 CTLSDISWTFELILNVSFTSQSIMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDCRSLADYNI 496          
BLAST of Polyubiquitin vs. Ensembl Xenopus
Match: pdcd11 (programmed cell death 11 [Source:Xenbase;Acc:XB-GENE-967218])

HSP 1 Score: 58.5362 bits (140), Expect = 4.681e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 4.681e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 4.681e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 4.681e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 56.225 bits (134), Expect = 2.380e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          

HSP 6 Score: 56.225 bits (134), Expect = 2.853e-8
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  573 LRGGMQIFVKTLTGKTITLEVEPSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLCDYNI 637          

HSP 7 Score: 55.8398 bits (133), Expect = 3.745e-8
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 1
Query:    1 VEDC-GIAD-----KSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            +EDC  +AD     +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  474 LEDCRSLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKGKIQDKEGIPPDQQRLIFAGKQLEDGRTLCDYNI 561          

HSP 8 Score: 55.4546 bits (132), Expect = 4.783e-8
Identity = 29/84 (34.52%), Postives = 52/84 (61.90%), Query Frame = 1
Query:   10 CGIADKS-----VINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            C ++D S     ++NV    + +M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D ++  +Y I
Sbjct:  402 CTLSDISWTFELILNVSFTSQSIMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDCRSLADYNI 485          
BLAST of Polyubiquitin vs. Ensembl Mouse
Match: Gm8797 (predicted pseudogene 8797 [Source:MGI Symbol;Acc:MGI:3643769])

HSP 1 Score: 55.8398 bits (133), Expect = 4.895e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Mouse
Match: Uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:MGI Symbol;Acc:MGI:98887])

HSP 1 Score: 56.225 bits (134), Expect = 7.262e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Mouse
Match: Ubc (ubiquitin C [Source:MGI Symbol;Acc:MGI:98889])

HSP 1 Score: 58.5362 bits (140), Expect = 7.846e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 56.225 bits (134), Expect = 4.249e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          

HSP 3 Score: 49.2914 bits (116), Expect = 1.023e-6
Identity = 25/68 (36.76%), Postives = 44/68 (64.71%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQG 201
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAG 199          
BLAST of Polyubiquitin vs. Ensembl Mouse
Match: Ubb (ubiquitin B [Source:MGI Symbol;Acc:MGI:98888])

HSP 1 Score: 58.5362 bits (140), Expect = 1.074e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 1.074e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 56.225 bits (134), Expect = 6.067e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Mouse
Match: Kxd1 (KxDL motif containing 1 [Source:MGI Symbol;Acc:MGI:1922870])

HSP 1 Score: 57.3806 bits (137), Expect = 1.901e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  105 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 165          
BLAST of Polyubiquitin vs. UniProt/SwissProt
Match: sp|P19848|UBIQ_COPCO (Ubiquitin OS=Coprinellus congregatus OX=5347 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.214e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. UniProt/SwissProt
Match: sp|P69310|UBIQ_AVESA (Ubiquitin OS=Avena sativa OX=4498 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 8.386e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI 61          
BLAST of Polyubiquitin vs. UniProt/SwissProt
Match: sp|P69317|UBIQ_LUPPO (Ubiquitin OS=Lupinus polyphyllus OX=3874 PE=3 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 9.130e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI 61          
BLAST of Polyubiquitin vs. UniProt/SwissProt
Match: sp|P69313|UBIQ_HELAN (Ubiquitin OS=Helianthus annuus OX=4232 PE=3 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 9.130e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI 61          
BLAST of Polyubiquitin vs. UniProt/SwissProt
Match: sp|P69326|UBIQ_WHEAT (Ubiquitin OS=Triticum aestivum OX=4565 PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 9.409e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI 61          
BLAST of Polyubiquitin vs. TrEMBL
Match: E1F4T0 (Ubiquitin OS=Giardia intestinalis (strain P15) OX=658858 GN=GLP15_4884 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.811e-9
Identity = 28/61 (45.90%), Postives = 43/61 (70.49%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK+VT+ V  TD I N+K KI++K G+ P+ Q L++ G  L+D++T Q+Y I
Sbjct:    1 MQIFVKTLTGKTVTLEVEPTDTINNIKAKIQDKEGIPPDQQRLIFSGKQLEDNRTLQDYSI 61          
BLAST of Polyubiquitin vs. TrEMBL
Match: C6LQV8 (Ubiquitin OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) OX=598745 GN=GL50581_1138 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.811e-9
Identity = 28/61 (45.90%), Postives = 43/61 (70.49%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK+VT+ V  TD I N+K KI++K G+ P+ Q L++ G  L+D++T Q+Y I
Sbjct:    1 MQIFVKTLTGKTVTLEVEPTDTINNIKAKIQDKEGIPPDQQRLIFSGKQLEDNRTLQDYSI 61          
BLAST of Polyubiquitin vs. TrEMBL
Match: A0A132NTC6 (Ubiquitin OS=Giardia intestinalis assemblage B OX=1394984 GN=QR46_2668 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.811e-9
Identity = 28/61 (45.90%), Postives = 43/61 (70.49%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK+VT+ V  TD I N+K KI++K G+ P+ Q L++ G  L+D++T Q+Y I
Sbjct:    1 MQIFVKTLTGKTVTLEVEPTDTINNIKAKIQDKEGIPPDQQRLIFSGKQLEDNRTLQDYSI 61          
BLAST of Polyubiquitin vs. TrEMBL
Match: V6TLM0 (Ubiquitin OS=Giardia intestinalis OX=5741 GN=DHA2_7110 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.811e-9
Identity = 28/61 (45.90%), Postives = 43/61 (70.49%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK+VT+ V  TD I N+K KI++K G+ P+ Q L++ G  L+D++T Q+Y I
Sbjct:    1 MQIFVKTLTGKTVTLEVEPTDTINNIKAKIQDKEGIPPDQQRLIFSGKQLEDNRTLQDYSI 61          
BLAST of Polyubiquitin vs. TrEMBL
Match: Q24989 (Ubiquitin (Fragment) OS=Giardia intestinalis OX=5741 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.830e-9
Identity = 28/61 (45.90%), Postives = 43/61 (70.49%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK+VT+ V  TD I N+K KI++K G+ P+ Q L++ G  L+D++T Q+Y I
Sbjct:    1 MQIFVKTLTGKTVTLEVEPTDTINNIKAKIQDKEGIPPDQQRLIFSGKQLEDNRTLQDYSI 61          
BLAST of Polyubiquitin vs. Ensembl Cavefish
Match: uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:NCBI gene;Acc:103027541])

HSP 1 Score: 55.4546 bits (132), Expect = 1.800e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Cavefish
Match: uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:NCBI gene;Acc:103027541])

HSP 1 Score: 55.4546 bits (132), Expect = 1.800e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Cavefish
Match: si:ch211-202a12.4 (ubiquitin B [Source:HGNC Symbol;Acc:HGNC:12463])

HSP 1 Score: 58.5362 bits (140), Expect = 2.152e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   80 LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 144          

HSP 2 Score: 58.5362 bits (140), Expect = 2.152e-9
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  156 LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 220          

HSP 3 Score: 48.521 bits (114), Expect = 3.410e-6
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   76 KKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            K   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  317 KDLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 372          
BLAST of Polyubiquitin vs. Ensembl Cavefish
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:103044043])

HSP 1 Score: 55.0694 bits (131), Expect = 4.863e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Cavefish
Match: nedd8l (NEDD8-like [Source:NCBI gene;Acc:103044361])

HSP 1 Score: 51.2174 bits (121), Expect = 2.029e-8
Identity = 24/61 (39.34%), Postives = 38/61 (62.30%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M I VK   GK + I +  TD++  +K ++EEK G+ P+ Q L+Y G  + D+KT  +Y+I
Sbjct:    1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTASDYKI 61          
BLAST of Polyubiquitin vs. Ensembl Sea Lamprey
Match: UBB (ubiquitin B [Source:HGNC Symbol;Acc:HGNC:12463])

HSP 1 Score: 58.5362 bits (140), Expect = 4.395e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   69 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 150          

HSP 2 Score: 58.5362 bits (140), Expect = 4.395e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  145 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 226          

HSP 3 Score: 58.5362 bits (140), Expect = 4.395e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  221 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 302          

HSP 4 Score: 58.5362 bits (140), Expect = 4.395e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  297 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 378          

HSP 5 Score: 56.6102 bits (135), Expect = 1.699e-9
Identity = 25/62 (40.32%), Postives = 42/62 (67.74%), Query Frame = 1
Query:   58 LMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            +M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   13 IMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 74          
BLAST of Polyubiquitin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006261.1 (pep scaffold:Pmarinus_7.0:GL477433:28222:29567:1 gene:ENSPMAG00000005664.1 transcript:ENSPMAT00000006261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 9.441e-7
Identity = 23/78 (29.49%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   10 CGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            CG+   S +N+  +   ++++VK    K++TI V  ++ + +LK K+ +K G+A   Q L +    L+DD+  + Y I
Sbjct:   59 CGLKQNSTVNLLHVDNAVDVFVKTLANKTLTIEVKLSNSVLSLKQKVHQKAGIAVNQQILTFGSHTLEDDQKLESYGI 136          
BLAST of Polyubiquitin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006254.1 (pep scaffold:Pmarinus_7.0:GL477433:3744:20801:-1 gene:ENSPMAG00000005642.1 transcript:ENSPMAT00000006254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 4.858e-6
Identity = 23/78 (29.49%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   10 CGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            CG+   S +N+  +   ++++VK    K++TI V  ++ + +LK K+ +K G+A   Q L +    L+DD+  + Y I
Sbjct:  135 CGLKQNSTVNLLHVDNAVDVFVKTLANKTLTIEVKLSNSVLSLKQKVHQKAGIAVNQQILTFGSHTLEDDQKLESYGI 212          

HSP 2 Score: 45.8246 bits (107), Expect = 4.858e-6
Identity = 23/78 (29.49%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   10 CGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            CG+   S +N+  +   ++++VK    K++TI V  ++ + +LK K+ +K G+A   Q L +    L+DD+  + Y I
Sbjct:  286 CGLKQNSTVNLLHVDNAVDVFVKTLANKTLTIEVKLSNSVLSLKQKVHQKAGIAVNQQILTFGSHTLEDDQKLESYGI 363          
BLAST of Polyubiquitin vs. Ensembl Yeast
Match: RPL40B (Ubiquitin-ribosomal 60S subunit protein L40B fusion protein; cleaved to yield ubiquitin and ribosomal protein L40B; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; homologous to mammalian ribosomal protein L40, no bacterial homolog; RPL40B has a paralog, RPL40A, that arose from the whole genome duplication [Source:SGD;Acc:S000001802])

HSP 1 Score: 56.225 bits (134), Expect = 1.263e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Yeast
Match: RPL40A (Ubiquitin-ribosomal 60S subunit protein L40A fusion protein; cleaved to yield ubiquitin and ribosomal protein L40A; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; homologous to mammalian ribosomal protein L40, no bacterial homolog; RPL40A has a paralog, RPL40B, that arose from the whole genome duplication; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000001410])

HSP 1 Score: 56.225 bits (134), Expect = 1.263e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Yeast
Match: UBI4 (Ubiquitin; becomes conjugated to proteins, marking them for selective degradation via the ubiquitin-26S proteasome system; essential for the cellular stress response; encoded as a polyubiquitin precursor comprised of 5 head-to-tail repeats; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003962])

HSP 1 Score: 59.3066 bits (142), Expect = 1.478e-10
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   73 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 59.3066 bits (142), Expect = 1.478e-10
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  149 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 59.3066 bits (142), Expect = 1.478e-10
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  225 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 59.3066 bits (142), Expect = 1.478e-10
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 1
Query:   49 LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            LR  M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 57.3806 bits (137), Expect = 6.710e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Yeast
Match: RPS31 (Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B; homologous to mammalian ribosomal protein S27A, no bacterial homolog [Source:SGD;Acc:S000004157])

HSP 1 Score: 56.225 bits (134), Expect = 2.452e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V ++D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Nematostella
Match: EDO31255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYF9])

HSP 1 Score: 56.6102 bits (135), Expect = 9.694e-11
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Nematostella
Match: EDO32403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV54])

HSP 1 Score: 58.5362 bits (140), Expect = 2.859e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 56.9954 bits (136), Expect = 8.995e-10
Identity = 29/82 (35.37%), Postives = 51/82 (62.20%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q  ++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 56.225 bits (134), Expect = 1.670e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Nematostella
Match: EDO45561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSG9])

HSP 1 Score: 56.225 bits (134), Expect = 4.969e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Nematostella
Match: EDO32547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUP6])

HSP 1 Score: 58.5362 bits (140), Expect = 8.721e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 8.721e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 8.721e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 8.721e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 8.721e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 58.5362 bits (140), Expect = 8.721e-10
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 7 Score: 56.225 bits (134), Expect = 4.410e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Nematostella
Match: EDO48503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ25])

HSP 1 Score: 55.0694 bits (131), Expect = 1.807e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Medaka
Match: ENSORLT00000001484.2 (pep primary_assembly:ASM223467v1:12:2266741:2269204:1 gene:ENSORLG00000001204.2 transcript:ENSORLT00000001484.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 6.149e-10
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Medaka
Match: uba52 (ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:NCBI gene;Acc:101169681])

HSP 1 Score: 55.8398 bits (133), Expect = 1.253e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Medaka
Match: ENSORLT00000015052.2 (pep primary_assembly:ASM223467v1:12:2267197:2268484:1 gene:ENSORLG00000012019.2 transcript:ENSORLT00000015052.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 1.826e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Ensembl Medaka
Match: ubb (ubiquitin C [Source:NCBI gene;Acc:101172100])

HSP 1 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:   56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 137          

HSP 2 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  132 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 213          

HSP 3 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  208 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 289          

HSP 4 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  284 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 365          

HSP 5 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  360 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 441          

HSP 6 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  436 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 517          

HSP 7 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  609 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 690          

HSP 8 Score: 58.5362 bits (140), Expect = 3.077e-9
Identity = 30/82 (36.59%), Postives = 52/82 (63.41%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            + D  I  +S +++ + LR  M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  685 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 766          

HSP 9 Score: 56.225 bits (134), Expect = 1.563e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          

HSP 10 Score: 56.225 bits (134), Expect = 1.563e-8
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:  554 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 614          
BLAST of Polyubiquitin vs. Ensembl Medaka
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:101164670])

HSP 1 Score: 55.0694 bits (131), Expect = 4.383e-9
Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   61 MEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            M+I+VK   GK++T+ V  +D I N+K KI++K G+ P+ Q L++ G  L+D +T  +Y I
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI 61          
BLAST of Polyubiquitin vs. Planmine SMEST
Match: SMESG000063621.1 (SMESG000063621.1)

HSP 1 Score: 289.656 bits (740), Expect = 6.343e-89
Identity = 156/157 (99.36%), Postives = 156/157 (99.36%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTIVQCHQPQMNKIVKKLRPSVFKRPGTVMDTNIIECN 471
            VED GIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDTIIVVTTVTGGLQILTIPMEGGNVAADFQIFHIISTIVQCHQPQMNKIVKKLRPSVFKRPGTVMDTNIIECN
Sbjct: 1948 VEDYGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDTIIVVTTVTGGLQILTIPMEGGNVAADFQIFHIISTIVQCHQPQMNKIVKKLRPSVFKRPGTVMDTNIIECN 2104          

HSP 2 Score: 83.9593 bits (206), Expect = 6.921e-18
Identity = 58/123 (47.15%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI     I +V  +  G+QI    M+G  VA + Q    IS I
Sbjct: 1798 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAEKSIIYIVARLRWGMQIFAKTMDGKTVALEVQKSEKISDI 1918          

HSP 3 Score: 83.9593 bits (206), Expect = 7.052e-18
Identity = 58/123 (47.15%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI     I +V  +  G+QI    M+G  VA + Q    IS I
Sbjct: 1052 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAEKSVINIVARLRWGMQIFAKTMDGKTVAFEVQKTEKISDI 1172          

HSP 4 Score: 83.9593 bits (206), Expect = 7.052e-18
Identity = 58/123 (47.15%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI     I +V  +  G+QI    M+G  VA + Q    IS I
Sbjct: 1473 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAEKSVINIVARLRWGMQIFAKTMDGKTVAFEVQKTEKISDI 1593          

HSP 5 Score: 83.5741 bits (205), Expect = 1.136e-17
Identity = 44/84 (52.38%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VE+  IA+KSVIN V  LR  M+I+ K  DGK+V   V  T++I ++K KI+EK GLAP+ Q LVYQG +L+D++T  EYQI  
Sbjct:  705 VEEYQIAEKSVINIVARLRWGMQIFAKTMDGKTVAFEVQKTEKISDIKKKIQEKIGLAPDEQKLVYQGGILEDERTVDEYQIAE 788          

HSP 6 Score: 83.5741 bits (205), Expect = 1.136e-17
Identity = 44/84 (52.38%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VE+  IA+KSVIN V  LR  M+I+ K  DGK+V   V  T++I ++K KI+EK GLAP+ Q LVYQG +L+D++T  EYQI  
Sbjct: 1126 VEEYQIAEKSVINIVARLRWGMQIFAKTMDGKTVAFEVQKTEKISDIKKKIQEKIGLAPDEQKLVYQGGILEDERTVDEYQIAE 1209          

HSP 7 Score: 83.5741 bits (205), Expect = 1.136e-17
Identity = 44/84 (52.38%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VE+  IA+KSVIN V  LR  M+I+ K  DGK+V   V  T++I ++K KI+EK GLAP+ Q LVYQG +L+D++T  EYQI  
Sbjct: 1547 VEEYQIAEKSVINIVARLRWGMQIFAKTMDGKTVAFEVQKTEKISDIKKKIQEKIGLAPDEQKLVYQGGILEDERTVDEYQIAE 1630          

HSP 8 Score: 82.4185 bits (202), Expect = 2.444e-17
Identity = 45/84 (53.57%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI  
Sbjct:  479 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAE 560          

HSP 9 Score: 82.4185 bits (202), Expect = 2.444e-17
Identity = 45/84 (53.57%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI  
Sbjct:  882 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAE 963          

HSP 10 Score: 82.4185 bits (202), Expect = 2.444e-17
Identity = 45/84 (53.57%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI  
Sbjct: 1303 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAE 1384          

HSP 11 Score: 80.1073 bits (196), Expect = 1.412e-16
Identity = 45/84 (53.57%), Postives = 57/84 (67.86%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VED GIAD SVINV DI    M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG +L+D++T  EYQI  
Sbjct:  309 VEDYGIADGSVINVVDI--GSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGGILEDERTVDEYQIAE 390          

HSP 12 Score: 79.7221 bits (195), Expect = 1.850e-16
Identity = 54/123 (43.90%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            VE+  IA+KSVIN V  LR  M+++ K  + K+V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI     I +V  +  G+QI    M+G  VA + Q    IS I
Sbjct:  629 VEEYQIAEKSVINIVARLRWGMQMFAKTVNDKTVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAEKSVINIVARLRWGMQIFAKTMDGKTVAFEVQKTEKISDI 751          

HSP 13 Score: 79.7221 bits (195), Expect = 2.188e-16
Identity = 41/84 (48.81%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            VE+  IA+KSVIN V  LR  M+++ K  + K+V   V  +D I ++K KI+EK GLAP+ Q LVYQG++L+D++T +EYQI  
Sbjct:  553 VEEYQIAEKSVINIVARLRTAMQMFAKTVNDKTVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGEILEDERTVEEYQIAE 636          

HSP 14 Score: 77.411 bits (189), Expect = 1.247e-15
Identity = 40/84 (47.62%), Postives = 58/84 (69.05%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRK-LMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            V++  IA+KSVIN+   R+  M+I+ K  DG +V   V  +D I ++K KI+EK GLAP+ Q LVYQG +L+D++T +EYQI  
Sbjct:  137 VDEYRIAEKSVINILARRRGSMQIFAKTMDGITVAFEVQKSDTIRDVKKKIQEKIGLAPDEQKLVYQGGILEDERTVEEYQIAE 220          

HSP 15 Score: 69.707 bits (169), Expect = 4.711e-13
Identity = 38/82 (46.34%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KS+I  V  LR  M+I+ K  DGK+V + V  +++I ++K KI+EK GLAP+ Q LVYQG  L+D+ + ++Y I
Sbjct: 1872 VEEYQIAEKSIIYIVARLRWGMQIFAKTMDGKTVALEVQKSEKISDIKKKIQEKIGLAPDEQKLVYQGQDLEDEISVEDYGI 1953          

HSP 16 Score: 69.3218 bits (168), Expect = 6.937e-13
Identity = 39/81 (48.15%), Postives = 54/81 (66.67%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VED GIAD SVINV  +  ++ I+ K  DGK+V   V  TD I ++K KI+E+ GLA + Q LVYQG  L+D+ + ++Y I
Sbjct: 1724 VEDYGIADGSVINVVDIGSML-IFAKTMDGKTVAFEVQKTDTIRDVKEKIQEEIGLASDEQKLVYQGQDLEDEISVEDYGI 1803          

HSP 17 Score: 66.2402 bits (160), Expect = 6.077e-12
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 1
Query:   13 GIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYH 249
            GI D SVIN +  LR  ++I+ K  DGK++   V   D I ++K KI  K GLAP+ Q LVYQG +L+D++T  EY+I  
Sbjct:   65 GIIDNSVINFIARLRGGVKIFGKTMDGKTIGFKVQMADTIRDVKKKIHGKIGLAPDEQILVYQGGILQDERTVDEYRIAE 144          

HSP 18 Score: 56.225 bits (134), Expect = 1.293e-8
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVIN V  LR  M+++ K  + K+V   V   D I ++K KI+ KF L P+ Q L Y+G  L+D+ +  E  +
Sbjct:  956 VEEYQIAEKSVINIVARLRTAMQMFAKTVNDKTVAFEVQKADTIRDVKKKIQRKFWLPPDEQKLDYEGQDLEDELSIAERSV 1037          

HSP 19 Score: 56.225 bits (134), Expect = 1.293e-8
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVIN V  LR  M+++ K  + K+V   V   D I ++K KI+ KF L P+ Q L Y+G  L+D+ +  E  +
Sbjct: 1377 VEEYQIAEKSVINIVARLRTAMQMFAKTVNDKTVAFEVQKADTIRDVKKKIQRKFWLPPDEQKLDYEGQDLEDELSIAERSV 1458          

HSP 20 Score: 53.1434 bits (126), Expect = 1.409e-7
Identity = 31/82 (37.80%), Postives = 48/82 (58.54%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVIN+    R  M+++ K  + K+V   V   D I ++K KI+ KF L P+ Q L Y+G  L+D+ +  E  +
Sbjct:  213 VEEYQIAEKSVINIVARPRTAMQMFAKTVNDKTVAFEVQKADTIRDVKKKIQRKFWLPPDEQKLDYEGQDLEDELSIAERSV 294          
BLAST of Polyubiquitin vs. Planmine SMEST
Match: SMESG000048258.1 (SMESG000048258.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.266e-20
Identity = 47/82 (57.32%), Postives = 63/82 (76.83%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VED GIA+KSVINV   LR  M+I+ K  DGK+V I V  T++I ++K+KI+EK GLAP+ Q LVYQG +L+D++T +EYQI
Sbjct:  891 VEDYGIAEKSVINVPARLRGGMQIFAKTMDGKTVAIEVQKTEKIRDIKLKIQEKIGLAPDEQILVYQGGILEDERTVEEYQI 972          

HSP 2 Score: 76.6406 bits (187), Expect = 2.184e-15
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            VED GIA+KSVI V I    M I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  145 VEDYGIAEKSVITVAI--GGMVILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 224          

HSP 3 Score: 76.6406 bits (187), Expect = 2.184e-15
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            VED GIA+KSVI V I    M I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  520 VEDYGIAEKSVITVAI--GGMVILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 599          

HSP 4 Score: 75.0998 bits (183), Expect = 6.474e-15
Identity = 51/115 (44.35%), Postives = 72/115 (62.61%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQ 342
            VE+  IA+KSVINV    R  M+I+ K  DGK+V   V   ++I ++K+KI+EK GLAP  Q LVYQG +L+D++T ++Y I     I V   + GG+QI    M+G  VA + Q
Sbjct:  815 VEEYQIAEKSVINVVARPRGGMQIFAKTMDGKTVAFEVRKAEKIRDVKLKIQEKIGLAPGEQRLVYQGGILEDERTVEDYGIAEKSVINVPARLRGGMQIFAKTMDGKTVAIEVQ 929          

HSP 5 Score: 74.7146 bits (182), Expect = 8.632e-15
Identity = 40/82 (48.78%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+ K  DGK+V   V   ++I ++K+KI+EK GLAP  Q LVYQG +L+D++T ++Y I
Sbjct:  444 VEEYQIAEKSVINVVARPRGGMQIFAKTMDGKTVAFEVRKAEKIRDVKLKIQEKIGLAPGEQRLVYQGGILEDERTVEDYGI 525          

HSP 6 Score: 73.1738 bits (178), Expect = 2.880e-14
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            ED GIAD+S+I+V  +  ++ I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  370 EDYGIADESMIDVVAIGGMV-ILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 449          

HSP 7 Score: 73.1738 bits (178), Expect = 2.880e-14
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            ED GIAD+S+I+V  +  ++ I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  741 EDYGIADESMIDVVAIGGMV-ILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 820          

HSP 8 Score: 72.7886 bits (177), Expect = 4.020e-14
Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            ED GIAD+S+I+V  +R  M+I+ K  DGK V I V  TD I ++K++I+ + GLAP+   LVYQG +L+D++T ++Y I
Sbjct:  296 EDYGIADESMIDVVAIRD-MQIFPKTGDGKIVPIEVQKTDTIRDVKLRIQNQIGLAPDEPKLVYQGGILEDERTAEDYGI 374          

HSP 9 Score: 69.3218 bits (168), Expect = 6.136e-13
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+    D K V I V  TD I ++K+KI+EK G+AP+ Q LVYQG +L+D++T ++Y I
Sbjct:  219 VEEYQIAEKSVINVVARPRGGMQIFAITVDCKIVPIEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILEDERTAEDYGI 300          

HSP 10 Score: 69.3218 bits (168), Expect = 6.136e-13
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+    D K V I V  TD I ++K+KI+EK G+AP+ Q LVYQG +L+D++T ++Y I
Sbjct:  594 VEEYQIAEKSVINVVARPRGGMQIFAITVDCKIVPIEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILEDERTAEDYGI 675          

HSP 11 Score: 67.781 bits (164), Expect = 2.187e-12
Identity = 31/81 (38.27%), Postives = 57/81 (70.37%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            +E  GI DKS+IN+++    M++Y+++  G +  + V   D+I ++K++I+ + GLAP+ Q LVYQG +L+D++T ++Y I
Sbjct:   73 LEQYGIVDKSLINIELG---MQMYLRRVGGTTELVTVGKADKIRDVKLRIQNQIGLAPDEQKLVYQGGILEDERTVEDYGI 150          

HSP 12 Score: 59.6918 bits (143), Expect = 7.945e-10
Identity = 34/80 (42.50%), Postives = 51/80 (63.75%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            ED GIAD+S+I+     K      +  DGK V I V  TD I ++K++I+ + GLAP+   LVYQG +L+D++T ++Y I
Sbjct:  671 EDYGIADESMID-----KGHANISQNGDGKIVPIEVQKTDTIRDVKLRIQNQIGLAPDEPKLVYQGGILEDERTAEDYGI 745          
BLAST of Polyubiquitin vs. Planmine SMEST
Match: SMESG000048258.1 (SMESG000048258.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.368e-20
Identity = 47/82 (57.32%), Postives = 63/82 (76.83%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VED GIA+KSVINV   LR  M+I+ K  DGK+V I V  T++I ++K+KI+EK GLAP+ Q LVYQG +L+D++T +EYQI
Sbjct:  874 VEDYGIAEKSVINVPARLRGGMQIFAKTMDGKTVAIEVQKTEKIRDIKLKIQEKIGLAPDEQILVYQGGILEDERTVEEYQI 955          

HSP 2 Score: 76.6406 bits (187), Expect = 2.357e-15
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            VED GIA+KSVI V I    M I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  128 VEDYGIAEKSVITVAI--GGMVILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 207          

HSP 3 Score: 76.6406 bits (187), Expect = 2.357e-15
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            VED GIA+KSVI V I    M I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  503 VEDYGIAEKSVITVAI--GGMVILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 582          

HSP 4 Score: 75.0998 bits (183), Expect = 7.182e-15
Identity = 51/115 (44.35%), Postives = 72/115 (62.61%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQ 342
            VE+  IA+KSVINV    R  M+I+ K  DGK+V   V   ++I ++K+KI+EK GLAP  Q LVYQG +L+D++T ++Y I     I V   + GG+QI    M+G  VA + Q
Sbjct:  798 VEEYQIAEKSVINVVARPRGGMQIFAKTMDGKTVAFEVRKAEKIRDVKLKIQEKIGLAPGEQRLVYQGGILEDERTVEDYGIAEKSVINVPARLRGGMQIFAKTMDGKTVAIEVQ 912          

HSP 5 Score: 74.7146 bits (182), Expect = 8.566e-15
Identity = 40/82 (48.78%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+ K  DGK+V   V   ++I ++K+KI+EK GLAP  Q LVYQG +L+D++T ++Y I
Sbjct:  427 VEEYQIAEKSVINVVARPRGGMQIFAKTMDGKTVAFEVRKAEKIRDVKLKIQEKIGLAPGEQRLVYQGGILEDERTVEDYGI 508          

HSP 6 Score: 73.1738 bits (178), Expect = 3.078e-14
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            ED GIAD+S+I+V  +  ++ I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  353 EDYGIADESMIDVVAIGGMV-ILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 432          

HSP 7 Score: 73.1738 bits (178), Expect = 3.078e-14
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            ED GIAD+S+I+V  +  ++ I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  724 EDYGIADESMIDVVAIGGMV-ILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 803          

HSP 8 Score: 72.7886 bits (177), Expect = 4.140e-14
Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            ED GIAD+S+I+V  +R  M+I+ K  DGK V I V  TD I ++K++I+ + GLAP+   LVYQG +L+D++T ++Y I
Sbjct:  279 EDYGIADESMIDVVAIRD-MQIFPKTGDGKIVPIEVQKTDTIRDVKLRIQNQIGLAPDEPKLVYQGGILEDERTAEDYGI 357          

HSP 9 Score: 69.3218 bits (168), Expect = 6.088e-13
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+    D K V I V  TD I ++K+KI+EK G+AP+ Q LVYQG +L+D++T ++Y I
Sbjct:  202 VEEYQIAEKSVINVVARPRGGMQIFAITVDCKIVPIEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILEDERTAEDYGI 283          

HSP 10 Score: 69.3218 bits (168), Expect = 6.088e-13
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+    D K V I V  TD I ++K+KI+EK G+AP+ Q LVYQG +L+D++T ++Y I
Sbjct:  577 VEEYQIAEKSVINVVARPRGGMQIFAITVDCKIVPIEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILEDERTAEDYGI 658          

HSP 11 Score: 67.3958 bits (163), Expect = 2.251e-12
Identity = 31/81 (38.27%), Postives = 57/81 (70.37%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            +E  GI DKS+IN+++    M++Y+++  G +  + V   D+I ++K++I+ + GLAP+ Q LVYQG +L+D++T ++Y I
Sbjct:   56 LEQYGIVDKSLINIELG---MQMYLRRVGGTTELVTVGKADKIRDVKLRIQNQIGLAPDEQKLVYQGGILEDERTVEDYGI 133          

HSP 12 Score: 60.077 bits (144), Expect = 7.736e-10
Identity = 34/80 (42.50%), Postives = 51/80 (63.75%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            ED GIAD+S+I+     K      +  DGK V I V  TD I ++K++I+ + GLAP+   LVYQG +L+D++T ++Y I
Sbjct:  654 EDYGIADESMID-----KGHANISQNGDGKIVPIEVQKTDTIRDVKLRIQNQIGLAPDEPKLVYQGGILEDERTAEDYGI 728          
BLAST of Polyubiquitin vs. Planmine SMEST
Match: SMESG000048258.1 (SMESG000048258.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.439e-20
Identity = 47/82 (57.32%), Postives = 63/82 (76.83%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDI-LRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VED GIA+KSVINV   LR  M+I+ K  DGK+V I V  T++I ++K+KI+EK GLAP+ Q LVYQG +L+D++T +EYQI
Sbjct:  891 VEDYGIAEKSVINVPARLRGGMQIFAKTMDGKTVAIEVQKTEKIRDIKLKIQEKIGLAPDEQILVYQGGILEDERTVEEYQI 972          

HSP 2 Score: 76.6406 bits (187), Expect = 2.453e-15
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            VED GIA+KSVI V I    M I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  145 VEDYGIAEKSVITVAI--GGMVILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 224          

HSP 3 Score: 76.6406 bits (187), Expect = 2.453e-15
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            VED GIA+KSVI V I    M I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  520 VEDYGIAEKSVITVAI--GGMVILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 599          

HSP 4 Score: 75.0998 bits (183), Expect = 6.940e-15
Identity = 51/115 (44.35%), Postives = 72/115 (62.61%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQ 342
            VE+  IA+KSVINV    R  M+I+ K  DGK+V   V   ++I ++K+KI+EK GLAP  Q LVYQG +L+D++T ++Y I     I V   + GG+QI    M+G  VA + Q
Sbjct:  815 VEEYQIAEKSVINVVARPRGGMQIFAKTMDGKTVAFEVRKAEKIRDVKLKIQEKIGLAPGEQRLVYQGGILEDERTVEDYGIAEKSVINVPARLRGGMQIFAKTMDGKTVAIEVQ 929          

HSP 5 Score: 74.7146 bits (182), Expect = 8.752e-15
Identity = 40/82 (48.78%), Postives = 57/82 (69.51%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+ K  DGK+V   V   ++I ++K+KI+EK GLAP  Q LVYQG +L+D++T ++Y I
Sbjct:  444 VEEYQIAEKSVINVVARPRGGMQIFAKTMDGKTVAFEVRKAEKIRDVKLKIQEKIGLAPGEQRLVYQGGILEDERTVEDYGI 525          

HSP 6 Score: 73.1738 bits (178), Expect = 3.204e-14
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            ED GIAD+S+I+V  +  ++ I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  370 EDYGIADESMIDVVAIGGMV-ILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 449          

HSP 7 Score: 73.1738 bits (178), Expect = 3.204e-14
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVL-KDDKTYQEYQI 243
            ED GIAD+S+I+V  +  ++ I  K  DGK+V   V  TD I ++K+KI+EK G+AP+ Q LVYQG +L +D++T +EYQI
Sbjct:  741 EDYGIADESMIDVVAIGGMV-ILAKTMDGKTVAFEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILYEDERTVEEYQI 820          

HSP 8 Score: 72.7886 bits (177), Expect = 4.268e-14
Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            ED GIAD+S+I+V  +R  M+I+ K  DGK V I V  TD I ++K++I+ + GLAP+   LVYQG +L+D++T ++Y I
Sbjct:  296 EDYGIADESMIDVVAIRD-MQIFPKTGDGKIVPIEVQKTDTIRDVKLRIQNQIGLAPDEPKLVYQGGILEDERTAEDYGI 374          

HSP 9 Score: 69.3218 bits (168), Expect = 6.162e-13
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+    D K V I V  TD I ++K+KI+EK G+AP+ Q LVYQG +L+D++T ++Y I
Sbjct:  219 VEEYQIAEKSVINVVARPRGGMQIFAITVDCKIVPIEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILEDERTAEDYGI 300          

HSP 10 Score: 69.3218 bits (168), Expect = 6.162e-13
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDIL-RKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            VE+  IA+KSVINV    R  M+I+    D K V I V  TD I ++K+KI+EK G+AP+ Q LVYQG +L+D++T ++Y I
Sbjct:  594 VEEYQIAEKSVINVVARPRGGMQIFAITVDCKIVPIEVQKTDTIRDVKLKIQEKVGVAPDEQILVYQGGILEDERTAEDYGI 675          

HSP 11 Score: 67.781 bits (164), Expect = 2.217e-12
Identity = 31/81 (38.27%), Postives = 57/81 (70.37%), Query Frame = 1
Query:    1 VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            +E  GI DKS+IN+++    M++Y+++  G +  + V   D+I ++K++I+ + GLAP+ Q LVYQG +L+D++T ++Y I
Sbjct:   73 LEQYGIVDKSLINIELG---MQMYLRRVGGTTELVTVGKADKIRDVKLRIQNQIGLAPDEQKLVYQGGILEDERTVEDYGI 150          

HSP 12 Score: 59.6918 bits (143), Expect = 7.827e-10
Identity = 34/80 (42.50%), Postives = 51/80 (63.75%), Query Frame = 1
Query:    4 EDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            ED GIAD+S+I+     K      +  DGK V I V  TD I ++K++I+ + GLAP+   LVYQG +L+D++T ++Y I
Sbjct:  671 EDYGIADESMID-----KGHANISQNGDGKIVPIEVQKTDTIRDVKLRIQNQIGLAPDEPKLVYQGGILEDERTAEDYGI 745          
BLAST of Polyubiquitin vs. Planmine SMEST
Match: SMESG000063727.1 (SMESG000063727.1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.068e-17
Identity = 55/123 (44.72%), Postives = 75/123 (60.98%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            V+D GIAD+SVINV   LR  M  + K  DGK+V   V  +++I ++K+KI+EK GLAP+ Q LV+Q  +L+DDKT ++Y I     I VV  +   +QI    MEG  VA + Q    IS I
Sbjct:  224 VKDYGIADRSVINVVTRLRCGMLTFAKTMDGKTVAFKVQKSEKISDIKLKIQEKIGLAPDEQKLVFQSRILQDDKTVKDYGIADRSVINVVARLRSDMQIFARTMEGKTVAFEVQKAVTISDI 346          

HSP 2 Score: 77.0258 bits (188), Expect = 1.211e-15
Identity = 53/123 (43.09%), Postives = 75/123 (60.98%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            V++  I++KSVIN+   LR  M+I+ K  DGK+V   V N ++I ++K+KI+EK GLA + Q LVYQG +L+DDKT ++Y I     I VVT +  G+      M+G  VA   Q    IS I
Sbjct:  148 VDEYQISEKSVINILARLRGGMKIFAKTMDGKTVAFEVQNAEKIRDIKLKIQEKIGLASDEQKLVYQGGILQDDKTVKDYGIADRSVINVVTRLRCGMLTFAKTMDGKTVAFKVQKSEKISDI 270          

HSP 3 Score: 75.8702 bits (185), Expect = 3.248e-15
Identity = 38/81 (46.91%), Postives = 57/81 (70.37%), Query Frame = 1
Query:   13 GIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHL 252
            GIA+KSVINV   LR  M+I+ K  +GK+V   V   ++I ++K KI+EK GLAP+ Q L+YQG +L D++T ++Y I ++
Sbjct:  528 GIAEKSVINVVARLRWGMQIFAKTMEGKTVAFNVQKAEKISDIKKKIQEKLGLAPDEQKLLYQGRILDDERTLEDYGIANM 608          

HSP 4 Score: 73.9442 bits (180), Expect = 1.309e-14
Identity = 55/132 (41.67%), Postives = 77/132 (58.33%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTIVQCHQPQMN 393
            VED GIADKSVI+V DI    M+I+ +  +GK+V   V  +D I ++K KI+EK G AP+ Q LVY+  +L+D++T   Y I     I VV  +  G+QI    MEG  VA + Q    IS I +  Q ++ 
Sbjct:  450 VEDYGIADKSVIDVVDICG--MQIFARTMEGKTVAFEVQKSDTISDIKKKIQEKIGQAPDDQKLVYRSGILEDERTVWHYGIAEKSVINVVARLRWGMQIFAKTMEGKTVAFNVQKAEKISDIKKKIQEKLG 579          

HSP 5 Score: 72.0182 bits (175), Expect = 7.143e-14
Identity = 51/119 (42.86%), Postives = 71/119 (59.66%), Query Frame = 1
Query:   13 GIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQIFHIISTI 366
            GIAD SVI+V DI    M+I+ K  DGK+V + V  +D   ++K KI+EK GLAP+ Q LVY+G +L D++T ++Y I   D  ++      G+QI    MEG  VA + Q    IS I
Sbjct:  380 GIADGSVIDVVDIGN--MQIFAKTIDGKTVALEVQKSDTTSDIKKKIQEKIGLAPDEQKLVYRGGILADERTVEDYGIA--DKSVIDVVDICGMQIFARTMEGKTVAFEVQKSDTISDI 494          

HSP 6 Score: 71.633 bits (174), Expect = 7.209e-14
Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 1
Query:    1 VEDCGIADKSVINV-DILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQI 243
            V+D GIAD+SVINV   LR  M+I+ +  +GK+V   V     I ++K KI+EK GLAP+   LVY+G++L+D++T   Y I
Sbjct:  300 VKDYGIADRSVINVVARLRSDMQIFARTMEGKTVAFEVQKAVTISDIKKKIQEKIGLAPDELKLVYRGEILEDERTVGHYGI 381          

HSP 7 Score: 67.0106 bits (162), Expect = 3.331e-12
Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 1
Query:    1 VEDCGIADKSVIN-VDILRK-LMEIYVKKCDGKSVTIPVHNTDQIGNLKVKIEEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDXXXXXXXXXXXXXXXXXPMEGGNVAADFQ 342
            V + GI D S+I  +  LR  +++I+V+  DGK+V   VH TD+I  +K +I+E   LA + Q LVYQG +L+D++T  EYQI     I ++  + GG++I    M+G  VA + Q
Sbjct:   71 VSNYGIIDYSIIKFIARLRSGILQIFVRTLDGKTVPFVVHKTDKISCIKKQIQENLRLAQDGQKLVYQGGILEDERTVDEYQISEKSVINILARLRGGMKIFAKTMDGKTVAFEVQ 186          
The following BLAST results are available for this feature:
BLAST of Polyubiquitin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBC4.394e-1040.98ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468][more]
UBC4.706e-1036.59ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468][more]
UBC4.769e-1036.59ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468][more]
UBA524.899e-1040.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
UBC5.216e-1036.59ubiquitin C [Source:HGNC Symbol;Acc:HGNC:12468][more]
back to top
BLAST of Polyubiquitin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubq-29.277e-1040.98Ubiquitin-60S ribosomal protein L40 Ubiquitin 60S ... [more]
ubq-11.290e-936.59Polyubiquitin-A Ubiquitin Ubiquitin-related [Sourc... [more]
ubq-11.290e-936.59Polyubiquitin-A Ubiquitin Ubiquitin-related [Sourc... [more]
ubq-11.712e-941.54Polyubiquitin-A Ubiquitin Ubiquitin-related [Sourc... [more]
ubq-11.712e-941.54Polyubiquitin-A Ubiquitin Ubiquitin-related [Sourc... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL401.492e-940.98gene:FBgn0003941 transcript:FBtr0334787[more]
RpL401.492e-940.98gene:FBgn0003941 transcript:FBtr0077470[more]
Ubi-p5E2.285e-936.59gene:FBgn0086558 transcript:FBtr0345892[more]
Ubi-p5E2.285e-936.59gene:FBgn0086558 transcript:FBtr0070933[more]
Ubi-p63E2.587e-936.59gene:FBgn0003943 transcript:FBtr0333142[more]
back to top
BLAST of Polyubiquitin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubb4.150e-1040.98ubiquitin B [Source:ZFIN;Acc:ZDB-GENE-050411-10][more]
ubb1.001e-936.59ubiquitin B [Source:ZFIN;Acc:ZDB-GENE-050411-10][more]
CR848813.22.046e-936.59pep chromosome:GRCz11:CHR_ALT_CTG5_1_42:42047434:4... [more]
uba522.124e-940.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
UBB2.850e-936.59si:ch211-202a12.4 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba526.787e-1040.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
ENSXETT00000033679.11.477e-936.59ubiquitin C [Source:NCBI gene;Acc:448120][more]
uba522.852e-940.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
pdcd114.677e-936.59programmed cell death 11 [Source:Xenbase;Acc:XB-GE... [more]
pdcd114.681e-936.59programmed cell death 11 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm87974.895e-1040.98predicted pseudogene 8797 [Source:MGI Symbol;Acc:M... [more]
Uba527.262e-1040.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
Ubc7.846e-1036.59ubiquitin C [Source:MGI Symbol;Acc:MGI:98889][more]
Ubb1.074e-936.59ubiquitin B [Source:MGI Symbol;Acc:MGI:98888][more]
Kxd11.901e-940.98KxDL motif containing 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Polyubiquitin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19848|UBIQ_COPCO7.214e-1040.98Ubiquitin OS=Coprinellus congregatus OX=5347 PE=1 ... [more]
sp|P69310|UBIQ_AVESA8.386e-1040.98Ubiquitin OS=Avena sativa OX=4498 PE=1 SV=1[more]
sp|P69317|UBIQ_LUPPO9.130e-1040.98Ubiquitin OS=Lupinus polyphyllus OX=3874 PE=3 SV=2[more]
sp|P69313|UBIQ_HELAN9.130e-1040.98Ubiquitin OS=Helianthus annuus OX=4232 PE=3 SV=2[more]
sp|P69326|UBIQ_WHEAT9.409e-1040.98Ubiquitin OS=Triticum aestivum OX=4565 PE=1 SV=2[more]
back to top
BLAST of Polyubiquitin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E1F4T03.811e-945.90Ubiquitin OS=Giardia intestinalis (strain P15) OX=... [more]
C6LQV83.811e-945.90Ubiquitin OS=Giardia intestinalis (strain ATCC 505... [more]
A0A132NTC63.811e-945.90Ubiquitin OS=Giardia intestinalis assemblage B OX=... [more]
V6TLM03.811e-945.90Ubiquitin OS=Giardia intestinalis OX=5741 GN=DHA2_... [more]
Q249893.830e-945.90Ubiquitin (Fragment) OS=Giardia intestinalis OX=57... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba521.800e-940.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
uba521.800e-940.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
si:ch211-202a12.42.152e-941.54ubiquitin B [Source:HGNC Symbol;Acc:HGNC:12463][more]
rps27a4.863e-940.98ribosomal protein S27a [Source:NCBI gene;Acc:10304... [more]
nedd8l2.029e-839.34NEDD8-like [Source:NCBI gene;Acc:103044361][more]
back to top
BLAST of Polyubiquitin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
UBB4.395e-1036.59ubiquitin B [Source:HGNC Symbol;Acc:HGNC:12463][more]
ENSPMAT00000006261.19.441e-729.49pep scaffold:Pmarinus_7.0:GL477433:28222:29567:1 g... [more]
ENSPMAT00000006254.14.858e-629.49pep scaffold:Pmarinus_7.0:GL477433:3744:20801:-1 g... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RPL40B1.263e-1040.98Ubiquitin-ribosomal 60S subunit protein L40B fusio... [more]
RPL40A1.263e-1040.98Ubiquitin-ribosomal 60S subunit protein L40A fusio... [more]
UBI41.478e-1041.54Ubiquitin; becomes conjugated to proteins, marking... [more]
RPS312.452e-1040.98Fusion protein cleaved to yield ribosomal protein ... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO312559.694e-1140.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324032.859e-1036.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455614.969e-1040.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325478.721e-1036.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485031.807e-940.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polyubiquitin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001484.26.149e-1040.98pep primary_assembly:ASM223467v1:12:2266741:226920... [more]
uba521.253e-940.98ubiquitin A-52 residue ribosomal protein fusion pr... [more]
ENSORLT00000015052.21.826e-940.98pep primary_assembly:ASM223467v1:12:2267197:226848... [more]
ubb3.077e-936.59ubiquitin C [Source:NCBI gene;Acc:101172100][more]
rps27a4.383e-940.98ribosomal protein S27a [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Polyubiquitin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063621.16.343e-8999.36SMESG000063621.1[more]
SMESG000048258.11.266e-2057.32SMESG000048258.1[more]
SMESG000048258.11.368e-2057.32SMESG000048258.1[more]
SMESG000048258.11.439e-2057.32SMESG000048258.1[more]
SMESG000063727.13.068e-1744.72SMESG000063727.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024835 ID=SMED30024835|Name=Polyubiquitin|organism=Schmidtea mediterranea sexual|type=transcript|length=856bp
GTTGAGGATTGTGGAATTGCTGATAAATCTGTGATCAATGTCGATATTTT
GAGAAAGCTAATGGAAATATATGTGAAAAAATGTGATGGCAAATCGGTAA
CAATTCCAGTTCACAATACAGATCAAATCGGCAATTTGAAGGTTAAAATT
GAGGAAAAGTTTGGACTGGCCCCGGAAAGTCAGACATTAGTTTATCAAGG
CGATGTATTGAAGGATGATAAAACCTATCAGGAATATCAAATCTATCATC
TGGATACAATAATTGTTGTTACAACTGTCACTGGCGGCCTGCAAATATTA
ACCATACCAATGGAAGGCGGAAATGTGGCAGCCGACTTCCAAATATTTCA
TATAATCAGCACAATTGTCCAATGTCACCAACCCCAGATGAACAAGATTG
TGAAGAAGCTGAGACCGAGTGTTTTTAAACGTCCCGGTACTGTGATGGAC
ACTAACATTATTGAATGCAATTAATATGCAGGATATCCGGTACTTTTGTC
GCATTGCCCTACACCAAAAATATTAAATATATTTAATAATTTATTAATCA
AATATTTAAATATCTTTTAATATAATGAAATCGTTTACGTAATTAATAAA
AGTATCACTAAACAAAGGTTTATAATACCTTTTTCAATCCATTTCTCCAG
TAGTGAATATTTTACGTGGCACTCGTTCGTTTCTTAAATTTTACTTTTCT
ATCTTGATCTCAGAAAAATACTATGAGATTAAAGCTTTTTAGTGTTGACG
TGAATTATAATAAAAACTTTAATGCATTTGAAATTTATAAAAACTATGCT
TATGTTTATAATATTGCTTTTTATTTATGTTCATTATTTATTTTCATCGC
ATTATT
back to top

protein sequence of SMED30024835-orf-1

>SMED30024835-orf-1 ID=SMED30024835-orf-1|Name=SMED30024835-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=158bp
VEDCGIADKSVINVDILRKLMEIYVKKCDGKSVTIPVHNTDQIGNLKVKI
EEKFGLAPESQTLVYQGDVLKDDKTYQEYQIYHLDTIIVVTTVTGGLQIL
TIPMEGGNVAADFQIFHIISTIVQCHQPQMNKIVKKLRPSVFKRPGTVMD
TNIIECN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR019956Ubiquitin_dom
IPR000626Ubiquitin-like_dom
IPR019954Ubiquitin_CS
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019956Ubiquitin domainPRINTSPR00348UBIQUITINcoord: 31..51
score: 40.5
coord: 52..72
score: 37.25
coord: 73..94
score: 22.46
IPR000626Ubiquitin-like domainSMARTSM00213ubq_7coord: 21..92
e-value: 8.2E-14
score: 61.9
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 23..92
e-value: 2.3E-18
score: 65.7
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 21..96
score: 19.39
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 18..100
e-value: 1.3E-20
score: 74.7
NoneNo IPR availablePANTHERPTHR10666:SF283coord: 21..121
coord: 2..99
NoneNo IPR availablePANTHERPTHR10666UBIQUITINcoord: 21..121
coord: 2..99
NoneNo IPR availableCDDcd01803Ubl_ubiquitincoord: 21..96
e-value: 2.02786E-14
score: 62.4617
IPR019954Ubiquitin conserved sitePROSITEPS00299UBIQUITIN_1coord: 47..72
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 3..96