beta-catenin-1

Overview
Namebeta-catenin-1 (ABY85206.1)
Smed IDSMED30024824
Length (bp)3183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta-catenin-1 (SMED30024824) t-SNE clustered cells

Violin plots show distribution of expression levels for beta-catenin-1 (SMED30024824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta-catenin-1 (SMED30024824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta-catenin-1 (SMED30024824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024824SMESG000039528.1 dd_Smed_v4_2688_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024824SMESG000039528.1 dd_Smed_v4_2688_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30024824SMESG000039528.1 dd_Smed_v4_2688_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024824SMESG000039528.1 Contig47951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024824SMESG000039528.1 Contig47951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30024824SMESG000039528.1 EU082826smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30024824SMESG000039528.1 EU082826smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30024824SMESG000039528.1 EU082826smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30024824SMESG000039528.1 EU082826smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30024824SMESG000039528.1 EU082826smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30024824SMESG000039528.1 Smed-beta-catenin-1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30024824SMESG000039528.1 EU130786.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30024824SMESG000039528.1 EU130786.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30024824SMESG000039528.1 EU130786.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30024824SMESG000039528.1 EU130786.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024824SMESG000039528.1 dd_Smed_v4_2688_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-catenin-1 vs. Ensembl Human
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 441.039 bits (1133), Expect = 2.378e-140
Identity = 290/735 (39.46%), Postives = 398/735 (54.15%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICM-LTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + +    S  G  + +  D S+ L EW+         G S         D  G  +  R   + M   ++    + +D            D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWE--------QGFSQSFTQEQVADIDGQYAMTR--AQRMLKHAVVNLINYQD------------DAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 633          
BLAST of beta-catenin-1 vs. Ensembl Human
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 441.039 bits (1133), Expect = 2.643e-140
Identity = 290/735 (39.46%), Postives = 399/735 (54.29%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICM-LTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + +    S  G  + +  D S+ L EW+         G S         D  G  +  R   + M   ++    + +D            D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L +            D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   10 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEEDVDTSQVLYEWE--------QGFSQSFTQEQVADIDGQYAMTR--AQRMLKHAVVNLINYQD------------DAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 626          
BLAST of beta-catenin-1 vs. Ensembl Human
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 437.958 bits (1125), Expect = 1.622e-139
Identity = 266/617 (43.11%), Postives = 361/617 (58.51%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Human
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 439.499 bits (1129), Expect = 2.592e-139
Identity = 264/616 (42.86%), Postives = 359/616 (58.28%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L +            D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Human
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 439.499 bits (1129), Expect = 2.828e-139
Identity = 264/616 (42.86%), Postives = 358/616 (58.12%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Celegans
Match: hmp-2 (Beta-catenin-like protein hmp-2 [Source:UniProtKB/Swiss-Prot;Acc:O44326])

HSP 1 Score: 178.718 bits (452), Expect = 1.989e-46
Identity = 164/622 (26.37%), Postives = 277/622 (44.53%), Query Frame = 3
Query:  600 AIPDLIKLINDEDDAVVINEATMMVFQLSKTDA--IDAI-INSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSY-DYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAAT-RLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFP--DDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPI--RERGFGWPMIVL---INRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIIS-------------MKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAIL 2390
            ++PDL+KL+ D D++VV   A    + LS+ D    +A   + +  +  ++ A +K+ +    R   GA+ +MS+++ G  +IF +  +  ++++L  S+ESV+ YA+TTL NLL++    +   R+   +  +   L K N K L    D L  L  +  PSK+  L   GP  L+ I++ Y D+ KL++T  R ++ LSVC +NKP +I  G + AL                Y ++  A++  S            L  +RNLSD+AT   N   L+  L++I+  A           +  +  CA G LSNLTCNN  NK T    GG++A++  I                     P  +++ EP +C LRH ++RH  AE AQ+ +   Q   +++  +E    P                         +IKA +G+IRN A+   N + +   +   G   + L   I R  I  + +N   +I+     +  +IE +  ALH LA  P + +                 + +  RL+ +P+   +               E ++R   GLL ++S    G   + S  V +  L E   S  +++ TYA+ +L
Sbjct:   79 SLPDLVKLMCDHDESVVA-RAVHRAYMLSREDPNFFNAPGFDHRSFVEALMAA-SKSSNVNVRRNAIGALSHMSEQRGGPLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQARALNAVEALTPHLHKTNPKLLAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPAL----------------YVELCTAKDERSQTAI--------LVAMRNLSDSATNEENLTQLIIKLLEIIRVA-----------NDGMTACACGTLSNLTCNNTRNKQTVCSHGGIDALVTAIR------------------RLPEVEEVTEPALCALRHCTARHSLAEEAQSELRFCQAFPVILDQLETLRTP-------------------------VIKAALGVIRNSALLQTNLIELTQEQTANGHTAVSLTMDILRRAITAIEEN--PDIAVDGVPMWGVIEGAVSALHQLANHPAVAAACCDDIGQVGNPECPPFLDLLHRLLAHPRLGSMDD-------------EVLEREILGLLYQLSKRPDGARAVESTGV-SALLMESRGSQYKSVVTYANGVL 604          
BLAST of beta-catenin-1 vs. Ensembl Celegans
Match: hmp-2 (Beta-catenin-like protein hmp-2 [Source:UniProtKB/Swiss-Prot;Acc:O44326])

HSP 1 Score: 178.718 bits (452), Expect = 1.989e-46
Identity = 164/622 (26.37%), Postives = 277/622 (44.53%), Query Frame = 3
Query:  600 AIPDLIKLINDEDDAVVINEATMMVFQLSKTDA--IDAI-INSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSY-DYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAAT-RLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFP--DDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPI--RERGFGWPMIVL---INRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIIS-------------MKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAIL 2390
            ++PDL+KL+ D D++VV   A    + LS+ D    +A   + +  +  ++ A +K+ +    R   GA+ +MS+++ G  +IF +  +  ++++L  S+ESV+ YA+TTL NLL++    +   R+   +  +   L K N K L    D L  L  +  PSK+  L   GP  L+ I++ Y D+ KL++T  R ++ LSVC +NKP +I  G + AL                Y ++  A++  S            L  +RNLSD+AT   N   L+  L++I+  A           +  +  CA G LSNLTCNN  NK T    GG++A++  I                     P  +++ EP +C LRH ++RH  AE AQ+ +   Q   +++  +E    P                         +IKA +G+IRN A+   N + +   +   G   + L   I R  I  + +N   +I+     +  +IE +  ALH LA  P + +                 + +  RL+ +P+   +               E ++R   GLL ++S    G   + S  V +  L E   S  +++ TYA+ +L
Sbjct:   79 SLPDLVKLMCDHDESVVA-RAVHRAYMLSREDPNFFNAPGFDHRSFVEALMAA-SKSSNVNVRRNAIGALSHMSEQRGGPLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQARALNAVEALTPHLHKTNPKLLAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPAL----------------YVELCTAKDERSQTAI--------LVAMRNLSDSATNEENLTQLIIKLLEIIRVA-----------NDGMTACACGTLSNLTCNNTRNKQTVCSHGGIDALVTAIR------------------RLPEVEEVTEPALCALRHCTARHSLAEEAQSELRFCQAFPVILDQLETLRTP-------------------------VIKAALGVIRNSALLQTNLIELTQEQTANGHTAVSLTMDILRRAITAIEEN--PDIAVDGVPMWGVIEGAVSALHQLANHPAVAAACCDDIGQVGNPECPPFLDLLHRLLAHPRLGSMDD-------------EVLEREILGLLYQLSKRPDGARAVESTGV-SALLMESRGSQYKSVVTYANGVL 604          
BLAST of beta-catenin-1 vs. Ensembl Celegans
Match: hmp-2 (Beta-catenin-like protein hmp-2 [Source:UniProtKB/Swiss-Prot;Acc:O44326])

HSP 1 Score: 178.718 bits (452), Expect = 2.167e-46
Identity = 164/622 (26.37%), Postives = 277/622 (44.53%), Query Frame = 3
Query:  600 AIPDLIKLINDEDDAVVINEATMMVFQLSKTDA--IDAI-INSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSY-DYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAAT-RLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFP--DDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPI--RERGFGWPMIVL---INRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIIS-------------MKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAIL 2390
            ++PDL+KL+ D D++VV   A    + LS+ D    +A   + +  +  ++ A +K+ +    R   GA+ +MS+++ G  +IF +  +  ++++L  S+ESV+ YA+TTL NLL++    +   R+   +  +   L K N K L    D L  L  +  PSK+  L   GP  L+ I++ Y D+ KL++T  R ++ LSVC +NKP +I  G + AL                Y ++  A++  S            L  +RNLSD+AT   N   L+  L++I+  A           +  +  CA G LSNLTCNN  NK T    GG++A++  I                     P  +++ EP +C LRH ++RH  AE AQ+ +   Q   +++  +E    P                         +IKA +G+IRN A+   N + +   +   G   + L   I R  I  + +N   +I+     +  +IE +  ALH LA  P + +                 + +  RL+ +P+   +               E ++R   GLL ++S    G   + S  V +  L E   S  +++ TYA+ +L
Sbjct:  105 SLPDLVKLMCDHDESVVA-RAVHRAYMLSREDPNFFNAPGFDHRSFVEALMAA-SKSSNVNVRRNAIGALSHMSEQRGGPLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQARALNAVEALTPHLHKTNPKLLAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPAL----------------YVELCTAKDERSQTAI--------LVAMRNLSDSATNEENLTQLIIKLLEIIRVA-----------NDGMTACACGTLSNLTCNNTRNKQTVCSHGGIDALVTAIR------------------RLPEVEEVTEPALCALRHCTARHSLAEEAQSELRFCQAFPVILDQLETLRTP-------------------------VIKAALGVIRNSALLQTNLIELTQEQTANGHTAVSLTMDILRRAITAIEEN--PDIAVDGVPMWGVIEGAVSALHQLANHPAVAAACCDDIGQVGNPECPPFLDLLHRLLAHPRLGSMDD-------------EVLEREILGLLYQLSKRPDGARAVESTGV-SALLMESRGSQYKSVVTYANGVL 630          
BLAST of beta-catenin-1 vs. Ensembl Celegans
Match: bar-1 (Beta-catenin/armadillo-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q18825])

HSP 1 Score: 111.694 bits (278), Expect = 8.913e-25
Identity = 105/417 (25.18%), Postives = 194/417 (46.52%), Query Frame = 3
Query:  600 AIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-------AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEA-----NVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAV---RSSGCIPKMVALLQ-KNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQ 1802
            AIP+L  L+ D+D+ VV ++A +++  ++K +           I++ + + +      +K E    +R   G  +++  ++ G+ ++  A     ++IP L++ +G    S+  YAI T+H++L  +  G ++V   R    I  +   L+ + + K L +  D +++L   +   K++ +K GGP  L+ +++   YE LLW  T++LK  S   A  P ++  GG   L N+L H                          S RL+ + L TLRN+SD  +++  D LL   +  L+N+ N          T +   +A I+SNL  NN++NK       GV  ++R     L +      +  ++     +D  E  ICTLRH+   H  ++  QA +     L  L +++ M+
Sbjct:  119 AIPELTMLMKDQDNEVV-HKAVILMQNIAKMECDPMRRQNEARIVDPRVIFTLRDLLRDKVEFPNIIRCTLGTFFHICNRQEGIDLVTRAIAEQPDIIPNLIRHIGTYPSSIYKYAILTMHSILSDKQRGGQSVIIARQQDAITHVTPWLEAEKSEKLLPVIVDLIRVLCEKNTEQKIKFVKMGGPQKLLMLLQHRVYENLLWRTTQLLKTFSNFDA--PNLVAFGGRQILANLLSHG-------------------------SPRLVQSTLETLRNISDVPSKIKED-LLLKSLLELVNSRN----------TTIRLYSAQIMSNLVANNRHNKEFMCGNNGVVILVRA----LTIATKEMGDLRDKEAQQMEDYIESLICTLRHLCVGHPMSDKVQAFVFRDPAL-FLHKLLTMR 491          
BLAST of beta-catenin-1 vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 56.6102 bits (135), Expect = 1.016e-7
Identity = 55/209 (26.32%), Postives = 93/209 (44.50%), Query Frame = 3
Query:  933 LLYQDGG-KEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQ--PSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-----NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLT 1535
            L Y D   KE  R  G IPK++ALL+ +  +       CL+ L+F  +   +KL +++  G   +  ++++     +   A   L  LS     KPVI     +++ T IL   +     + P   VL    S+   HF   L  N    LRN+S A+ +      +  +L++ LV  L +A      Q + +D+  +  A  +L NL+
Sbjct:  718 LTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDASVKEEAAAALWNLSSADMLKPVI-----LESATEILSQQV-----IAP---VLAVGTSDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAI-----QKSQVDSPTVENAVCLLRNLS 908          
BLAST of beta-catenin-1 vs. Ensembl Fly
Match: arm (gene:FBgn0000117 transcript:FBtr0089990)

HSP 1 Score: 465.692 bits (1197), Expect = 2.820e-150
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. Ensembl Fly
Match: arm (gene:FBgn0000117 transcript:FBtr0089991)

HSP 1 Score: 464.922 bits (1195), Expect = 1.678e-148
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. Ensembl Fly
Match: arm (gene:FBgn0000117 transcript:FBtr0089992)

HSP 1 Score: 464.922 bits (1195), Expect = 1.678e-148
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. Ensembl Fly
Match: arm (gene:FBgn0000117 transcript:FBtr0332583)

HSP 1 Score: 464.922 bits (1195), Expect = 1.678e-148
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. Ensembl Fly
Match: arm (gene:FBgn0000117 transcript:FBtr0089988)

HSP 1 Score: 464.922 bits (1195), Expect = 1.678e-148
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. Ensembl Zebrafish
Match: ctnnb1 (catenin (cadherin-associated protein), beta 1 [Source:NCBI gene;Acc:30265])

HSP 1 Score: 437.958 bits (1125), Expect = 8.400e-139
Identity = 293/750 (39.07%), Postives = 402/750 (53.60%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + + S+S K   +D D ++Q   L EW+   N + N     DI     M       +        EGM        + +    +    P                D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  +G ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       I  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDDDVDNQV--LYEWEQGFNQSFNQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------IHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 669          
BLAST of beta-catenin-1 vs. Ensembl Zebrafish
Match: ctnnb2 (catenin, beta 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2575])

HSP 1 Score: 437.573 bits (1124), Expect = 1.023e-138
Identity = 262/616 (42.53%), Postives = 360/616 (58.44%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y+YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L           A  D NV+TCAAGILSNLTCNN  NK+   ++GG+E+++RT+                      +DI EP +C LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  148 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYNYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------ASDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIESLVRTV----------------LRAGDREDITEPAVCALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 669          
BLAST of beta-catenin-1 vs. Ensembl Zebrafish
Match: ctnnb1 (catenin (cadherin-associated protein), beta 1 [Source:NCBI gene;Acc:30265])

HSP 1 Score: 434.491 bits (1116), Expect = 2.229e-137
Identity = 293/759 (38.60%), Postives = 402/759 (52.96%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL----------NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + + S+S K   +D D ++Q   L EW+   N + N     DI     M       +        EGM        + +    +    P                D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  +G ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+             + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       I  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDDDVDNQV--LYEWEQGFNQSFNQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQTSLAEVDVQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------IHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 678          
BLAST of beta-catenin-1 vs. Ensembl Zebrafish
Match: jupa (junction plakoglobin a [Source:ZFIN;Acc:ZDB-GENE-991207-22])

HSP 1 Score: 420.624 bits (1080), Expect = 6.142e-133
Identity = 242/614 (39.41%), Postives = 361/614 (58.79%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  +V+N+A M+V QL++ +A   A++ S +M++ ++ AM      E  R  A  ++N+S ++ GL  IF++  IP LV++L   M+SVLFYAITTLHNLLL+Q+G K AVR +  + +MV LL+K+N KFL I TDCLQ+L++ +Q SKL IL +GGP  L++I+++Y+YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   L  +                         SQRL+ NCLWTLRNLSDAAT+ +  ++LL+VLV +L           +  D N++TCA G+LSNLTCNN  NK    +  GVEA++ TI                       D+ EP +C LRH++SRH EAE AQ ++    G+  +++++             +QP            +W ++KA++GLIRNLA+ P N  P+R+      ++ L+++A  D     S A  S +D + +EEI+E   GALH++A+DP  R  I SM                  + +   LL++ L++++RV AG+L E++ ++   E+I ++   +  L E++HS+NE I+TYA+A+L R  E+KN  Y
Sbjct:  129 ATRAIPELTKLLNDEDQ-LVVNKAAMIVNQLTRKEASRRALMQSPQMVAAVVRAMQNTTDMETTRATASILHNLSHQREGLLAIFKSGGIPALVRMLSSPMDSVLFYAITTLHNLLLHQEGAKMAVRLADGLQRMVPLLKKSNPKFLAITTDCLQLLSYGNQESKLIILANGGPEGLVNIMRTYNYEKLLWTTSRVLKVLSVCPSNKPAIVDAGGMQALGKHLSGS-------------------------SQRLMQNCLWTLRNLSDAATKQDGMENLLQVLVGLL-----------SADDINMLTCATGVLSNLTCNNTRNKTQVTQSNGVEALIHTI----------------LRASSKQDVIEPAVCALRHLTSRHPEAETAQNAVRMHYGIPAIVKLL-------------NQP-----------YHWPVVKAVVGLIRNLALCPANQAPLRDADAIPKLVTLLSKAHQDAQKPGSSAQRSYQDGVRMEEIVEGCTGALHIMARDPMNRGTIASM----------------DTIPLFVQLLYSPLDNVKRVAAGVLCELALDKQSAEIIDAEGA-SAPLMELLHSSNEGIATYAAAVLYRTAEDKNPDY 648          
BLAST of beta-catenin-1 vs. Ensembl Zebrafish
Match: jupa (junction plakoglobin a [Source:ZFIN;Acc:ZDB-GENE-991207-22])

HSP 1 Score: 420.624 bits (1080), Expect = 6.142e-133
Identity = 242/614 (39.41%), Postives = 361/614 (58.79%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  +V+N+A M+V QL++ +A   A++ S +M++ ++ AM      E  R  A  ++N+S ++ GL  IF++  IP LV++L   M+SVLFYAITTLHNLLL+Q+G K AVR +  + +MV LL+K+N KFL I TDCLQ+L++ +Q SKL IL +GGP  L++I+++Y+YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   L  +                         SQRL+ NCLWTLRNLSDAAT+ +  ++LL+VLV +L           +  D N++TCA G+LSNLTCNN  NK    +  GVEA++ TI                       D+ EP +C LRH++SRH EAE AQ ++    G+  +++++             +QP            +W ++KA++GLIRNLA+ P N  P+R+      ++ L+++A  D     S A  S +D + +EEI+E   GALH++A+DP  R  I SM                  + +   LL++ L++++RV AG+L E++ ++   E+I ++   +  L E++HS+NE I+TYA+A+L R  E+KN  Y
Sbjct:  129 ATRAIPELTKLLNDEDQ-LVVNKAAMIVNQLTRKEASRRALMQSPQMVAAVVRAMQNTTDMETTRATASILHNLSHQREGLLAIFKSGGIPALVRMLSSPMDSVLFYAITTLHNLLLHQEGAKMAVRLADGLQRMVPLLKKSNPKFLAITTDCLQLLSYGNQESKLIILANGGPEGLVNIMRTYNYEKLLWTTSRVLKVLSVCPSNKPAIVDAGGMQALGKHLSGS-------------------------SQRLMQNCLWTLRNLSDAATKQDGMENLLQVLVGLL-----------SADDINMLTCATGVLSNLTCNNTRNKTQVTQSNGVEALIHTI----------------LRASSKQDVIEPAVCALRHLTSRHPEAETAQNAVRMHYGIPAIVKLL-------------NQP-----------YHWPVVKAVVGLIRNLALCPANQAPLRDADAIPKLVTLLSKAHQDAQKPGSSAQRSYQDGVRMEEIVEGCTGALHIMARDPMNRGTIASM----------------DTIPLFVQLLYSPLDNVKRVAAGVLCELALDKQSAEIIDAEGA-SAPLMELLHSSNEGIATYAAAVLYRTAEDKNPDY 648          
BLAST of beta-catenin-1 vs. Ensembl Xenopus
Match: dctn5 (dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963961])

HSP 1 Score: 441.039 bits (1133), Expect = 2.836e-140
Identity = 291/735 (39.59%), Postives = 400/735 (54.42%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICM-LTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + + S+S K   +D D  D ++ L EW+         G S         D  G  +  R   + M   ++    + +D            D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L  +                         SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDEDV-DTNQVLYEWE--------QGFSQSFTQDQVADIDGQYAMTR--AQRMLKHAVVNLINYQD------------DAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDS-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 633          
BLAST of beta-catenin-1 vs. Ensembl Xenopus
Match: dctn5 (dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963961])

HSP 1 Score: 439.113 bits (1128), Expect = 1.214e-139
Identity = 263/616 (42.69%), Postives = 357/616 (57.95%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L  +                         SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  131 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDS-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 652          
BLAST of beta-catenin-1 vs. Ensembl Xenopus
Match: dctn5 (dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963961])

HSP 1 Score: 438.343 bits (1126), Expect = 2.664e-139
Identity = 263/616 (42.69%), Postives = 357/616 (57.95%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L  +                         SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  142 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDS-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 663          
BLAST of beta-catenin-1 vs. Ensembl Xenopus
Match: dctn5 (dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963961])

HSP 1 Score: 439.113 bits (1128), Expect = 4.693e-139
Identity = 264/623 (42.38%), Postives = 359/623 (57.62%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNS----------CANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L  +                         SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S          C +   +   +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDS-------------------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVVCNSFKLEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 677          
BLAST of beta-catenin-1 vs. Ensembl Xenopus
Match: jup (junction plakoglobin [Source:NCBI gene;Acc:395011])

HSP 1 Score: 401.364 bits (1030), Expect = 6.890e-126
Identity = 244/615 (39.67%), Postives = 345/615 (56.10%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISP-KDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  +V+N+A+M+V QLSK +A   A++ S ++++ ++  M      +  R     ++N+S  + GL  IF++  IP LV++L   +ESVLFYAITTLHNLLLYQ+G K AVR +  + KMV LL KNN KFL I TDCLQ+LA+ +Q SKL IL +GGP  L+ I+++Y+YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   L                            S RL+ NCLWTLRNLSD AT+    D++LK+LV            Q +  D NV+TCA G LSNLTCNN  NK    +  GVE+++ TI                      DDI EP +C LRH++SRH++AE AQ S+    G+  ++++    L P                       W L+KA IGLIRNLA+ P N  P+ + G    ++ L+ +A  D     +     P  D + +EEI+E   GALH+LA+DP  R  I  +                + + +   LL++ +E+IQRV AG+L E++ ++   + I ++   +  L E++HS NE I+TYA+A+L R +E+KN  Y
Sbjct:  126 ATRAIPELTKLLNDED-PMVVNKASMIVNQLSKKEASRKALMQSPQIVAAVVRTMQHTSDMDTARCTTSILHNLSHHREGLLSIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYNYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSN-------------------------SPRLVQNCLWTLRNLSDVATKQEGLDNVLKILVN-----------QLSSDDVNVLTCATGTLSNLTCNNGRNKTLVTQSNGVESLIHTI----------------LRASDKDDIAEPAVCALRHLTSRHQDAEVAQNSVRLHYGIPAIVKL----LNP--------------------PYQWPLVKATIGLIRNLALCPANHAPLYDAGVIPRLVQLLVKAHQDAQRHAASGAQQPYTDGVKMEEIVEGCTGALHILARDPVNRMDIYKL----------------NTIPLFVQLLYSPVENIQRVAAGVLCELAQDKEAADTIDAEGA-SAPLMELLHSRNEGIATYAAAVLFRISEDKNADY 646          
BLAST of beta-catenin-1 vs. Ensembl Mouse
Match: Ctnnb1 (catenin (cadherin associated protein), beta 1 [Source:MGI Symbol;Acc:MGI:88276])

HSP 1 Score: 439.499 bits (1129), Expect = 2.180e-139
Identity = 266/617 (43.11%), Postives = 361/617 (58.51%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Mouse
Match: Ctnnb1 (catenin (cadherin associated protein), beta 1 [Source:MGI Symbol;Acc:MGI:88276])

HSP 1 Score: 439.499 bits (1129), Expect = 2.180e-139
Identity = 266/617 (43.11%), Postives = 361/617 (58.51%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Mouse
Match: Jup (junction plakoglobin [Source:MGI Symbol;Acc:MGI:96650])

HSP 1 Score: 397.897 bits (1021), Expect = 5.029e-124
Identity = 245/615 (39.84%), Postives = 340/615 (55.28%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISP-KDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  A+P+L KL+NDED  VV+ +A M+V QLSK +A   A++ S ++++ ++  M      +  R     ++N+S  + GL  IF++  IP LV++L   +ESVLFYAITTLHNLLLYQ+G K AVR +  + KMV LL KNN KFL I TDCLQ+LA+ +Q SKL IL +GGP  L+ I+++Y YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   L                            S RL+ NCLWTLRNLSD AT+    + +LK+LV            Q +  D NV+TCA G LSNLTCNN  NK    +  GVEA++  I                      DDI EP +C LRH++SRH EAE AQ S+    G+  +++++                  PN         W L+KA IGLIRNLA+ P N  P++E      ++ L+ +A  D     +     P  D + +EEI+E   GALH+LA+DP  R +I       RL   P          +   LL++ +E+IQRV AG+L E++ ++   + I ++   +  L E++HS NE  +TYA+A+L R +E+KN  Y
Sbjct:  140 ATRALPELTKLLNDED-PVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSN-------------------------SPRLVQNCLWTLRNLSDVATKQEGLESVLKILVN-----------QLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAI----------------LRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN----------------QPN--------QWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIF------RLNTIP----------LFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGA-SAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY 660          
BLAST of beta-catenin-1 vs. Ensembl Mouse
Match: Jup (junction plakoglobin [Source:MGI Symbol;Acc:MGI:96650])

HSP 1 Score: 397.897 bits (1021), Expect = 5.029e-124
Identity = 245/615 (39.84%), Postives = 340/615 (55.28%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISP-KDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  A+P+L KL+NDED  VV+ +A M+V QLSK +A   A++ S ++++ ++  M      +  R     ++N+S  + GL  IF++  IP LV++L   +ESVLFYAITTLHNLLLYQ+G K AVR +  + KMV LL KNN KFL I TDCLQ+LA+ +Q SKL IL +GGP  L+ I+++Y YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   L                            S RL+ NCLWTLRNLSD AT+    + +LK+LV            Q +  D NV+TCA G LSNLTCNN  NK    +  GVEA++  I                      DDI EP +C LRH++SRH EAE AQ S+    G+  +++++                  PN         W L+KA IGLIRNLA+ P N  P++E      ++ L+ +A  D     +     P  D + +EEI+E   GALH+LA+DP  R +I       RL   P          +   LL++ +E+IQRV AG+L E++ ++   + I ++   +  L E++HS NE  +TYA+A+L R +E+KN  Y
Sbjct:  140 ATRALPELTKLLNDED-PVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSN-------------------------SPRLVQNCLWTLRNLSDVATKQEGLESVLKILVN-----------QLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAI----------------LRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN----------------QPN--------QWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIF------RLNTIP----------LFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGA-SAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY 660          
BLAST of beta-catenin-1 vs. Ensembl Mouse
Match: Ctnnb1 (catenin (cadherin associated protein), beta 1 [Source:MGI Symbol;Acc:MGI:88276])

HSP 1 Score: 385.185 bits (988), Expect = 5.238e-121
Identity = 224/482 (46.47%), Postives = 292/482 (60.58%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNS 2027
            A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L +            D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH+EAE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S
Sbjct:  149 ATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSD-----------DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTS 552          
BLAST of beta-catenin-1 vs. UniProt/SwissProt
Match: sp|P35224|CTNB_URECA (Catenin beta OS=Urechis caupo OX=6431 PE=2 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.566e-148
Identity = 307/772 (39.77%), Postives = 425/772 (55.05%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINS-ALEXXXXXXXXXXGYDDMDSE---DQSKNLNEWKYPSNTNA------------------------------NDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKL----LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D    T  WQQNQY+ DSGI S A      SVSSKHG DDMD+    D S+ + ++    +T A                               +G+      L P  P +   L    + +  A V+L    D+ D   R               AIP+L KL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ AM      E  R  AG ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+Q+G K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SY YEKLLWT +RVLKVLSVC++NKP I+  G                           A  S    H SQRL+ NCLWTLRNLSDAAT+  + + LL++LVQ+L           A  D N++TCAAGILSNLTCNNQ NK+T  ++GG+EA++RTI                      +DI EP +C LRH++SRH EAE AQ ++ LH+ GL +L++++             H P             W LIKA++GLIRNLA+ P N  P+RE G    ++ L+ RA  D   + +  + +    +    +EEI+E + GALH++A++   R+ I       R +N          + + A LL++ +++IQRV AG+L E++A++ G E+ I Q   T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   33 DAKQQTMLWQQNQYMGDSGIQSGATTQAPPSVSSKHGLDDMDTGEGMDTSRMMFDFDQGFSTQAFTQEQVDEMNQQLNQTRSQRVRAAMFPETLEEGVQIPSTQLDPGQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATR---------------AIPELTKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAMTNTNDLETTRCAAGTLHNLSHHRQGLLTIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVLLLQRNNLKFLAITTDCLQILAYGNQESKLIILASGGPGELVRIMRSYTYEKLLWTTSRVLKVLSVCASNKPAIVEAGS--------------------------AGPSMHLGHQSQRLVQNCLWTLRNLSDAATKSSDIEGLLQMLVQLL-----------ASNDINIVTCAAGILSNLTCNNQRNKVTVCQVGGIEALVRTI----------------LQAGDREDITEPAVCALRHLTSRHGEAEMAQNAVRLHY-GLPVLVKLL-------------HPP-----------SRWPLIKAVVGLIRNLALCPANHAPLREHGAIPRIVQLLIRAHQDTQRRATAGSGNTSAYVDGVRMEEIVEGTVGALHIMAREAHNRAVI-------RGLN---------CISLFAQLLYSPIDNIQRVAAGVLCELAADKEGAEM-IEQEGTTAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 693          
BLAST of beta-catenin-1 vs. UniProt/SwissProt
Match: sp|Q02453|ARM_MUSDO (Armadillo segment polarity protein OS=Musca domestica OX=7370 GN=arm PE=2 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 1.889e-148
Identity = 298/763 (39.06%), Postives = 417/763 (54.65%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL+DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L +         P P                RL+ NCLWTLRNLSDAAT+++  + LL+ LVQ+L           A  D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH+++RH ++E AQ ++    GL ++++++             H P             W LIKA IGL+RNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   22 TLMWQQNSYLVDSGIHSGAVTQAPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLAEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAITNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLSN---------PSP----------------RLVQNCLWTLRNLSDAATKVDGLEPLLQSLVQVL-----------ASTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTTRHADSEMAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAAIGLVRNLALCPANAAPLREHGAIHHLVRLLMRAFQDTERQRSSVATTGSQQPAAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 673          
BLAST of beta-catenin-1 vs. UniProt/SwissProt
Match: sp|Q29I35|ARM_DROPS (Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=arm PE=3 SV=2)

HSP 1 Score: 465.307 bits (1196), Expect = 9.432e-148
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. UniProt/SwissProt
Match: sp|P18824|ARM_DROME (Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 1.682e-147
Identity = 299/763 (39.19%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA---------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDK--------LLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S                +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ +   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E+ +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMV LLQ+NN+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L        N+ P                  RL+ NCLWTLRNLSDAAT++   + LL+ LVQ+L              D NV+TCAAGILSNLTCNNQ NK T  ++GGV+A++RTI                 N    ++I EP +C LRH++SRH ++E AQ ++    GL ++++++             H P             W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ RA  D   + S    +   +         +EEI+E + GALH+LA++   R+ I                  QS + +   LLFN +E+IQRV AG+L E++A++ G E II Q   T  L +++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   32 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHL-------GNMSP------------------RLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVL-----------GSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTI----------------INAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLL-------------HPP-----------SRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQ----------------QSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAE-IIEQEGATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDY 683          
BLAST of beta-catenin-1 vs. UniProt/SwissProt
Match: sp|Q7QHW5|ARM_ANOGA (Armadillo segment polarity protein OS=Anopheles gambiae OX=7165 GN=arm PE=3 SV=5)

HSP 1 Score: 447.588 bits (1150), Expect = 7.733e-141
Identity = 297/763 (38.93%), Postives = 416/763 (54.52%), Query Frame = 3
Query:  252 TRTWQQNQYLIDSGINSA--------------LEXXXXXXXXXXGY---------DDMD---SEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCA---NISPKDKL-----LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLF-NHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            T  WQQN YL DSGI+S               +E          G+         DDM+   S+ +S+ +    +P      +G+        P  P +   L    + +  A V+L    D+ D   R               AIP+LIKL+NDED  VV+++A MMV QLSK +A   AI+NS +M++ ++ A++ +   E  +   G ++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+QDG K AVR +G + KMVALLQ+NN+KFL I TDCLQILA+ +Q SKL IL   GP  L+ I++SYDYEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L +                          SQRL+ NCLWTLRNLSDAAT+++  + LL  LV +L ++           D NV+TCAAGILSNLTCNNQ NK+T  ++GGVEA++ TI                 N    ++I EP +C LRH++SRH E+E+AQ  + +  GL +++++    L P            P+         W LIKA+IGLIRNLA+ P N  P+RE G    ++ L+ +A  D   + S        P         +EEI+E + GALH+LAK+   R  I S                Q+ + +   LLF N +E+IQRV AG+L E++ ++   E+I ++   T  L E+++S NE ++TYA+A+L + +E+K+  Y
Sbjct:   30 TLMWQQNSYLGDSGIHSGAVTQVPSLSGKDDDMEDDPLMFDMDQGFSQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE--EGIEIPSTQFDPQQPTAVQRLAEPSQMLKHAVVNLINYQDDADLATR---------------AIPELIKLLNDEDQ-VVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRALSNSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALAMHLGNP-------------------------SQRLVQNCLWTLRNLSDAATKVDGLETLLSGLVTVLGSS-----------DVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTI----------------INAGDREEITEPAVCALRHLTSRHPESESAQNVVRNGYGLPVIVKL----LNP------------PS--------RWPLIKAVIGLIRNLALCPANAAPLREHGAIHLLVRLLFKAFQDTQRQRSSVASNGSQPPGAYADGVRMEEIVEGTVGALHILAKEEYNRQVIRS----------------QNVIPIFVQLLFYNDIENIQRVAAGVLCELAVDKEVAEMIEAEGA-TAPLTELLNSANEGVATYAAAVLFKMSEDKSMDY 681          
BLAST of beta-catenin-1 vs. TrEMBL
Match: B0LMF5 (Beta-catenin-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1859.73 bits (4816), Expect = 0.000e+0
Identity = 954/954 (100.00%), Postives = 954/954 (100.00%), Query Frame = 3
Query:  180 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 3041
            MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK
Sbjct:    1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 954          
BLAST of beta-catenin-1 vs. TrEMBL
Match: B1NTA7 (Beta-catenin-like protein 1 OS=Schmidtea mediterranea OX=79327 GN=bcat1 PE=2 SV=1)

HSP 1 Score: 1859.73 bits (4816), Expect = 0.000e+0
Identity = 953/954 (99.90%), Postives = 953/954 (99.90%), Query Frame = 3
Query:  180 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 3041
            MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASL FNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK
Sbjct:    1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLRFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 954          
BLAST of beta-catenin-1 vs. TrEMBL
Match: A0A2S1BJK9 (Beta-catenin-1 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1719.9 bits (4453), Expect = 0.000e+0
Identity = 871/955 (91.20%), Postives = 915/955 (95.81%), Query Frame = 3
Query:  180 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMR-HFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 3041
            MMNESMNIVNSP ADEFINDKTN+TR+WQQNQYLIDSGINSA+ESHSHSVSSKHGYDDMDSEDQ+KN+ EWKY SNTN NDGLSNDICMLTPDTPGS+SCLRHGGEGMADVSLS CYDNK+E NRN +F IDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKA+HAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNT +E YP VLP EN+ESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFN+FQRQS HIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPN PNK NQNNYFPDDIFEPCICTLRHISSRH+EAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRE+GFGWPMIVLINRAQIDLLNK +CA+ISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQS+V+VI SLLFNHLESIQRVTAGLLVEVS ER+GLELIISQIVITNKL+EMVHSNNEAISTYASAILIRATEEKNKRY   HNYN +PQNP+NLRNNLSISLPANQ NN GYLNSILNSPIMH+QP CV HRHNSVTQCGDQNI+TNET C INDVDV+DYHM FSNTLQPQNRY Y  N++DPNYSL+NQT N +I MR HFKQ+G INISNEC+NQ++QK ++N SFK+P+SH +S++GNLCSSN+NSKK+MMDVCML+ADWIETCS+FSQGHSQKSWSPINK
Sbjct:    1 MMNESMNIVNSPQADEFINDKTNYTRSWQQNQYLIDSGINSAIESHSHSVSSKHGYDDMDSEDQNKNIKEWKYSSNTNINDGLSNDICMLTPDTPGSSSCLRHGGEGMADVSLSTCYDNKEETNRNTEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKADHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESYPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNIPNKINQNNYFPDDIFEPCICTLRHISSRHDEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSSVFVIGSLLFNHLESIQRVTAGLLVEVSGERMGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYATSHNYN-VPQNPNNLRNNLSISLPANQVNNPGYLNSILNSPIMHSQPSCVGHRHNSVTQCGDQNISTNET-CQINDVDVSDYHMTFSNTLQPQNRYSYTSNYLDPNYSLLNQTVNPDITMRQHFKQIGPINISNECINQEIQKTFTNPSFKNPTSHQMSITGNLCSSNDNSKKEMMDVCMLEADWIETCSEFSQGHSQKSWSPINK 953          
BLAST of beta-catenin-1 vs. TrEMBL
Match: G8DNQ1 (Beta-catenin-1 (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1565.44 bits (4052), Expect = 0.000e+0
Identity = 787/865 (90.98%), Postives = 826/865 (95.49%), Query Frame = 3
Query:  408 TNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMR-HFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSKKDMMDVCMLDADWIETCSDF 2999
            TN NDGLSNDICMLTPDTPGS+SCLRHGGEGMADVSLS CYDNKDE +RN +F IDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKA+HAEAVRFLAGAIYNMSQKKNGL+IIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNT +E YP VLP EN+ESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFN+FQRQS HIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILR IEWNLALTNPN PNK NQNNYFPDDIFEPCICTLRHISSRH+EAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAII LIRNLAMSPCNFVPIRE+GFGWPMIVLINRAQIDLLNK +CA+ISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQS+V+VIASLLFNHLESIQRVTAGLLVEVS ERLGLELIISQIVITNKL+EMVHSNNEAISTYASAILIRATEEKNKRY   HNYN +PQNP+NLRNNLSISLPANQ NN GYLNSILNSPIMH+QP CV HRHNSVTQCGDQNI+TNET C INDVDV+DYHM FSNTLQPQNRY Y  N++DPNYSL+NQT N +I MR HFKQ+G INISNEC+NQ++QK ++N SFK+P+ H +S++GNLCSSN+NSKK+MMDVCML+ADWIETCS+F
Sbjct:    1 TNINDGLSNDICMLTPDTPGSSSCLRHGGEGMADVSLSTCYDNKDETSRNTEFAIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKADHAEAVRFLAGAIYNMSQKKNGLEIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTTIESYPPVLPTENNESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNTFQRQSTHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRAIEWNLALTNPNIPNKINQNNYFPDDIFEPCICTLRHISSRHDEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIISLIRNLAMSPCNFVPIREKGFGWPMIVLINRAQIDLLNKTACASISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSSVFVIASLLFNHLESIQRVTAGLLVEVSGERLGLELIISQIVITNKLSEMVHSNNEAISTYASAILIRATEEKNKRYATSHNYN-VPQNPNNLRNNLSISLPANQVNNPGYLNSILNSPIMHSQPSCVGHRHNSVTQCGDQNISTNET-CQINDVDVSDYHMTFSNTLQPQNRYSYTSNYLDPNYSLLNQTVNPDITMRQHFKQLGPINISNECINQEIQKTFTNPSFKNPTPHQMSLTGNLCSSNDNSKKEMMDVCMLEADWIETCSEF 863          
BLAST of beta-catenin-1 vs. TrEMBL
Match: T1E1F5 (Beta-Catenin-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 1359.74 bits (3518), Expect = 0.000e+0
Identity = 689/948 (72.68%), Postives = 793/948 (83.65%), Query Frame = 3
Query:  183 MNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNL-ALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNS-GYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSK---KDMMDVCMLDADWIETCSDFSQGH 3011
            MNE +N +NSP +D+ INDKTNFTR+WQQNQYL+DSGINSA+E+H+HSVSS+HGYD+MDSEDQ+K   +WK  SN N NDG  NDICMLTPD+PGS  C R GGE MADV  S+ +D  +  + + +FG DIDK+EAE AIPDL+KLI DEDDAVVINEATMMVFQLSK+DAIDA+INSKEMISC+IEAMNKA+HAEAVRFLAGAIYNMSQKK GLK+IFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQ+GGKEAVR S CIPK+V LLQKNNIKFLTICTDCLQILAFNHQPSK+EILK+GGPLHLIHIIK+YDYEKLLWTATRVLKVLSVCSANKPVIIREGG++ALTNILY TIQ+N+ V PY +    ENSES+P FSQRLLHNCLWTLRNLSDAATR+NFDHLLKVLVQILM+++NSFQRQ+ HIDTN +TCAAGILSNLTCNNQYNKI  FKLGGVEA++R IEWN  +LTN N  NK N NN F ++I EPCIC LRH++SRHEEAEA Q S++ FQGL +LIR++EMQLGPDLFHMQ+HQP+MPNLFLSYYKINWSLIKAIIGLIRN+AMS CNFV IRERGF WPMIVLINRAQID  NKNSC  +S KDKLL+EI+EV+CGALHMLAKDPGIR+QIIS+K+WQRLI+ PQQIGIQSA+YVIASLL+NHLESIQRV  GLLVE+SAER+ LE+I+ Q++ITNKLNEMVHS +EA+STYASAILIRATEEKNKRY   HNYN    N S+ R NLSISLP NQ+NNS G+LNSIL+SP+M NQP C SHR N  +QCGDQ    NE +  IND+DV+  HM F  +   QNRY YN NF+D N   +N T N++I+MR+FK  G IN  N+C  Q++ K+   +     S      +    + N N+    K+ MD+CM D DW E+CSDFSQ H
Sbjct:    1 MNEQLNSMNSPQSDDLINDKTNFTRSWQQNQYLVDSGINSAIETHTHSVSSRHGYDEMDSEDQNKK--DWKCLSNININDGFPNDICMLTPDSPGSNICGRQGGEAMADVHSSSGFDT-NRTDCDKEFGFDIDKLEAEGAIPDLVKLIKDEDDAVVINEATMMVFQLSKSDAIDALINSKEMISCIIEAMNKADHAEAVRFLAGAIYNMSQKKYGLKVIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQEGGKEAVRLSSCIPKLVTLLQKNNIKFLTICTDCLQILAFNHQPSKIEILKNGGPLHLIHIIKNYDYEKLLWTATRVLKVLSVCSANKPVIIREGGIEALTNILYLTIQRNSTVIPYQEEQSTENSESHPQFSQRLLHNCLWTLRNLSDAATRINFDHLLKVLVQILMSSYNSFQRQNIHIDTNAVTCAAGILSNLTCNNQYNKIALFKLGGVEALIRVIEWNFNSLTNSNPQNKMNTNNTFSEEILEPCICALRHLTSRHEEAEAVQTSLIQFQGLTLLIRLLEMQLGPDLFHMQTHQPVMPNLFLSYYKINWSLIKAIIGLIRNMAMSSCNFVSIRERGFVWPMIVLINRAQIDATNKNSCTPLSSKDKLLDEIMEVACGALHMLAKDPGIRAQIISIKLWQRLIHCPQQIGIQSAIYVIASLLYNHLESIQRVAVGLLVELSAERMALEMIMGQMIITNKLNEMVHSKSEAVSTYASAILIRATEEKNKRYAPCHNYNAALPNSSSSRANLSISLPNNQSNNSPGFLNSILHSPVMQNQPTCGSHR-NIPSQCGDQKYINNELMGQINDMDVSQVHMNFVVSPGSQNRYSYNQNFID-NTCNVNPTVNADISMRYFKPPGCINAVNDCHIQEMPKSSYGNLKTRSSHPISHPANVCTNENNNTTSKMKESMDMCMQDTDWTESCSDFSQTH 943          
BLAST of beta-catenin-1 vs. Ensembl Cavefish
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:103035854])

HSP 1 Score: 439.884 bits (1130), Expect = 9.938e-140
Identity = 294/750 (39.20%), Postives = 401/750 (53.47%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + + S+S K   +D D ++Q   L EW+   + N N     DI     M       +        EGM          +    +    P                D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       I  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSNWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDEDVDNQV--LYEWEQGFSQNFNQDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDGAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------IHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 669          
BLAST of beta-catenin-1 vs. Ensembl Cavefish
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:103035854])

HSP 1 Score: 437.573 bits (1124), Expect = 2.246e-139
Identity = 293/750 (39.07%), Postives = 405/750 (54.00%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGMA--DVSLSACYDNKDENNRNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + + S+S K   +D D ++Q   L EW+   + N N     DI     M       +        EGM          +    +    P                D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L+ T       +P                SQRL+ NCLWTLRNLSDAAT+      + VL + +     +  +     D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       I  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSNWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDEDVDNQV--LYEWEQGFSQNFNQDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDGAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--LHLT-------DP----------------SQRLVQNCLWTLRNLSDAATKQTSLAEVDVLQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------IHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 679          
BLAST of beta-catenin-1 vs. Ensembl Cavefish
Match: ctnnb2 (catenin beta-1-like [Source:NCBI gene;Acc:103034575])

HSP 1 Score: 437.573 bits (1124), Expect = 7.940e-139
Identity = 262/616 (42.53%), Postives = 359/616 (58.28%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  AIP+L KL+NDED  VV+N+A++MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP +C LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:  148 ATRAIPELTKLLNDEDQ-VVVNKASVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAVCALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 669          
BLAST of beta-catenin-1 vs. Ensembl Cavefish
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:103035854])

HSP 1 Score: 437.958 bits (1125), Expect = 8.906e-139
Identity = 290/749 (38.72%), Postives = 400/749 (53.40%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGM--ADVSLSACYDNKDENNRNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + + S+S K   +D D ++Q   L EW+   + N N     DI     M       +        EGM          +    +    P                D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+      + VL + +     +  +     D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       I  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSNWQQQSYL-DSGIHSGATTTAPSLSGKGNPEDEDVDNQV--LYEWEQGFSQNFNQDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDGAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQTSLAEVDVLQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------IHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 679          
BLAST of beta-catenin-1 vs. Ensembl Cavefish
Match: jupa (junction plakoglobin-like [Source:NCBI gene;Acc:103045821])

HSP 1 Score: 397.897 bits (1021), Expect = 1.793e-124
Identity = 239/619 (38.61%), Postives = 354/619 (57.19%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNK-----LNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            A  A+P+L KL+ND DD VV+N+A  +V QL+K +A   A++ S +M++ ++ AM      E  R  A  ++N+S ++ GL  IF++  IP LV++L   MESVLFYAITTLHNLLL+Q+G K AVR +  + +MV LL+K+N KFL I TDCLQ+L++ +Q SKL IL +GGP  L+ I+++Y+YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   +  +                         SQRL  NCLWTLRNLSDAAT+ +  D LL+VL+ +L           +  D N++ C  GILSNLTCNN  NK    +  GVEA++  +                      +D+ EP  C LRH++SRH EAE AQ ++    G+  +++++             ++P        YY   W ++KA++GLIRNLA+ P N  P+R+      ++ L+  A  D     S +  + +D + +EEI+E   GALH++A+DP  R  I  M                + + +   LL++ +++I+RV AG+L E++ ++       S +VI N+     L E++HS+NE I+TYA+A+L R +E+KN  Y
Sbjct:  129 ATRAVPELTKLLND-DDQVVVNKAAQIVNQLTKKEASRRALMQSPQMVAAVVRAMQNTGDMETARATASILHNLSHQREGLLSIFKSGGIPALVRMLSSPMESVLFYAITTLHNLLLHQEGAKMAVRLADGLQRMVPLLKKSNHKFLAITTDCLQLLSYGNQESKLIILANGGPEGLVQIMRNYNYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHVTGS-------------------------SQRLSQNCLWTLRNLSDAATKQDGLDGLLQVLIGLL-----------STDDVNMLACVTGILSNLTCNNARNKTYVTQNNGVEALIHAL----------------LRAGEKEDVAEPATCALRHLTSRHPEAELAQNAVRTHYGIPAIVKLL-------------NKP--------YY---WPVVKAVVGLIRNLALCPANQAPLRDADAIPKLVNLLINAHQDAQKHGSASQQTYQDGVRMEEIVEGCTGALHIMARDPMSRGVIADM----------------NTIPLFVQLLYSPVDNIKRVAAGVLCELALDKQ------SAVVIDNEGACAPLMELLHSSNEGIATYAAAVLFRISEDKNADY 648          
BLAST of beta-catenin-1 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 449.514 bits (1155), Expect = 5.668e-144
Identity = 288/729 (39.51%), Postives = 405/729 (55.56%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK--DKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSI----SLPANQANNSGYLNSILNSPIMHNQPP-----CVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYH--MPFSNTLQPQNRYPYNPN 2729
            A  AIP+L KL+ND DD VV+  A MMV QLSK +A   AI+ S +M+S ++ A       E  R+ AGA++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQ+LA+ +Q SKL IL  GGP  L+HI+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L                       + P  SQRL+ NCLWTLRNLSDAAT+  N + LL+ LVQ+L +            D NV+TC AGILSNLTCNN  NK+   ++GG+EA+++T+                      +DI EP +C LRH++SRH +AE AQ ++    GL I ++++              QP  P+         W LIKA++GLIRNLA+ P N  P+R+ G    ++ L+ RA  D   +   AN  P+  D + +EEI+E   GALH+LA+D   RS I  +                + V +   LL++++E+IQRV AG+L E++ E+   E I ++   T  L E++HS NE ++TYA+A+L R +E+K                P + +  LS+    SL  +  N  G    ++ + ++H   P      +   H+S+   G   +     L P+ D D+   H   P  + + P+  +P  P+
Sbjct:  147 ATRAIPELTKLLND-DDPVVMGHAAMMVHQLSKKEAARHAIMGSTQMVSALVRAAQNTNDMETARYAAGALHNLSHHRQGLLAIFKSGGIPALVKLLSCPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLNKGNVKFLAITTDCLQLLAYGNQESKLIILASGGPTGLVHIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGIHL-----------------------TSP--SQRLMQNCLWTLRNLSDAATKQENMEGLLQSLVQLLGSN-----------DVNVVTCGAGILSNLTCNNYRNKMVVCQVGGIEALVQTV----------------LQAGDREDITEPAVCALRHLTSRHPDAELAQNAVRLHYGLPITVKLL--------------QP--PS--------RWPLIKAVVGLIRNLALLPANHSPLRDHGAIPRLVQLLVRAHQDTQRQGVAANGQPQYVDGIRMEEIVEGCTGALHILARDAHNRSVIRGL----------------NTVPLFVQLLYSNIENIQRVAAGVLCELAQEKEAAETIETEGA-TAPLTELLHSRNEGVATYAAAVLFRMSEDK----------------PQDFKKRLSVELTHSLFRDDPNAWGE-GGVMGTDLLHQGDPQYHQDGMYGSHSSL-HSGRGYMGEPMGLDPMMDHDLAGPHGNGPEFHDMLPELAHPGGPD 763          
BLAST of beta-catenin-1 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 429.869 bits (1104), Expect = 1.376e-136
Identity = 257/639 (40.22%), Postives = 363/639 (56.81%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNK--NSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISL 2495
            A  AIP+L KL+NDED  VV+ +A MMV QL++ DA   +IINS  +++ ++ AM      +  R  AG ++++S  + GL  IF++  IP LVK+L   +ESV+FYAITTLHNLLL+Q+G K AVR +G + KMVALL + N+KFL I TDCLQILA+ +Q SKL IL  GGP  L+ I+++Y+YEKLLWT +RV+KVLSVCS+NKP I+  GGM AL   L H                          SQRL+ N LWTLRNLSDAAT+  N D LL++LVQ L ++           D NV+TCAAGILSNLTCNN  NK+   ++GG+E +++T+                      +DI EP +C LRH++SRH EAE AQ ++    GL ++++++              QP  P+        +W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D       +     P    +EEI+E   GAL +LA+D   R  I S+ +                + V   LL+++ E++QRV  G+L E++ ++   + I  +   T  L E++HS NE ++TYA+A+L R +E+K                P + R  LS+ L
Sbjct:  148 ATRAIPELTKLLNDEDQ-VVVGQAAMMVHQLTQKDAARLSIINSPPLVAALVRAMQNTGDVDTARHTAGTLHSLSHHQQGLLTIFKSGGIPALVKMLSSPVESVVFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLNRTNVKFLAITTDCLQILAYGNQESKLIILASGGPAALVQIMRTYNYEKLLWTTSRVIKVLSVCSSNKPAIVEAGGMQALALHLSHP-------------------------SQRLVQNSLWTLRNLSDAATKQDNMDGLLQMLVQALDSS-----------DLNVVTCAAGILSNLTCNNYKNKLMACQMGGIEVLVKTL----------------MQAGDREDITEPAVCALRHLTSRHPEAEMAQNAVRLHYGLPVVVKLL--------------QP--PS--------HWPLIKADVGLIRNLALCPANHAPLREQGVLERLVQLLVRAHQDTQRHTMGTMQQSQPDGIRMEEIVEGCTGALQILARDAANREVIYSLNV----------------IPVFVQLLYSNNENVQRVATGVLCEMAQDKEAADAIEREGA-TPVLTELLHSRNEGVATYAAAVLFRLSEDK----------------PQDFRKRLSVEL 676          
BLAST of beta-catenin-1 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 390.963 bits (1003), Expect = 5.277e-123
Identity = 247/669 (36.92%), Postives = 365/669 (54.56%), Query Frame = 3
Query:  513 SLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLS-KTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQA 2510
            ++ +  DN      +PD G          AIP+L KL+NDED  VV  +A ++  QLS K     A++NS  +++ ++  M+     +     AG ++N++    G   IF++  IP LVK+L   +ESV+FY+ITTLH+LLL Q+G K AVR +G + KMVALL + N KFL I TDCLQILAF +Q SKL IL  GGP  L+ I++++ YEKLLW+ +RVLKVLSVC  NKP I+  GGM AL       +  N    P P                RL+ NC WTLRNLSDAAT+  +   LL +LV+ L +            D +++TCAAG LSNLTCNN  NK+  +++GG+EA+L T+E                +    +DI EP +C LRH++SRH++A+ AQ+++    GL ++++++              QP  P+        NW LIKA +GLIRNLA+S  N  P+R+ G    +  L+ RA  D L   S       D + ++EI+E   GAL +LA+DP  R+ I S+ +                + +   LLF+  E++QRV  G+L E++ ++   + I ++      L E++HS NE ++TYA+A+L R +E+              PQ+  N  ++ S+  P NQ+
Sbjct:  126 AMRSAVDNLLSYQDDPDLGT--------RAIPELTKLLNDEDQEVV-RQAALIAHQLSQKAGGQRAMVNSSALVAALVRTMHNTSDIDTATHTAGTLHNLAHDTPGRLAIFKSGGIPALVKMLSSPVESVVFYSITTLHHLLLNQEGSKMAVRLAGGLQKMVALLNRTNEKFLAITTDCLQILAFGNQESKLVILSSGGPAALVQILRTHTYEKLLWSTSRVLKVLSVCPQNKPAIVEAGGMQAL------ALHMNN---PSP----------------RLVQNCFWTLRNLSDAATKQEDMQELLHMLVEALSSR-----------DLSLVTCAAGTLSNLTCNNSNNKLAVYQMGGIEALLNTVE----------------HMGGHEDILEPAVCALRHLTSRHQDADMAQSAVRDSMGLPLVVKLL--------------QP--PS--------NWPLIKADVGLIRNLALSSANHAPMRDEGVVHRLAQLLIRAHQDTLRTASGTLPQTVDGIRMDEIVEGCTGALQILARDPTSRTLITSLNV----------------IPIFVQLLFSPNENVQRVATGVLCEMAQDKDAADAIDAE-GPNPILTELLHSRNEGVATYAAAVLFRLSEDN-------------PQDFQNRFSSSSLFRPDNQS 679          
BLAST of beta-catenin-1 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 228.794 bits (582), Expect = 8.951e-67
Identity = 158/410 (38.54%), Postives = 214/410 (52.20%), Query Frame = 3
Query:  261 WQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDI----------------------------DKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATR 1403
            WQQ  YL DSGI S + + + S+S   G  + +  ++++ + EW+   N N    LS+D    TPD     +  R        +  +   +  +E  + P    D                             D   A  AIP+L KL+ND DD VV+  A MMV QLSK +A   AI++S +M++ ++ A       E  R  AGA++N+S  + GL  IF++  IP LVKLL   +ESVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL KNN+KFL I TDCLQ+LA+ +Q SKL IL  GGP  L+HI+++Y     + TA  +  +L+         +  GGM AL   L         V P                SQRL+ NCLWTLRNLSDAAT+
Sbjct:   25 WQQQSYL-DSGIQSGVNTTAPSLS---GKGNPEDGEETRVVYEWERTFNAN----LSHD---HTPDAESHFASTR-----AQRIRAAMFPETLEEGAQAPSTQFDAEQPTNVQRLAEPSQMLKQAVVNLINYQDDAEVATRAIPELTKLLND-DDPVVMGNAAMMVHQLSKKEAARHAIMDSPQMVAALVRAAQNTNDMETARCAAGALHNLSHHRQGLLAIFKSGGIPALVKLLSCPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLNKNNVKFLAITTDCLQLLAYGNQESKLIILASGGPAGLVHIMRTYTSACCITTAQSLPYILNATCGGFSGNLSSGGMQALGLHL---------VSP----------------SQRLMQNCLWTLRNLSDAATK 392          
BLAST of beta-catenin-1 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 198.364 bits (503), Expect = 1.070e-55
Identity = 130/365 (35.62%), Postives = 200/365 (54.79%), Query Frame = 3
Query: 1341 SQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK--DKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            SQRL+ NCLWTLRNLSDAAT+  N + LL+ LV++L +            D NV+TC AGILSNLTCNN  NK+   ++GG+EA+++T+                      +DI EP +C LRH++SRH +AE AQ ++    GL I ++++              QP             W LIKA++GLIRNLA+ P N  P+RE G    ++ L+ RA  D   +++ +   P+  D + +EEI+E   GALH+LA+D   R+ I  +                + + +   LL++++E++QRV AG+L E++ E+      +     T  L E++HS NE ++TYA+A+L R +E+K + +
Sbjct:   15 SQRLMQNCLWTLRNLSDAATKQENMEGLLQSLVELLGSN-----------DVNVVTCGAGILSNLTCNNYRNKMVVCQVGGIEALVQTV----------------LQAGDREDITEPAVCALRHLTSRHPDAELAQKAVRLHYGLPITVKLL--------------QP----------PSRWPLIKAVVGLIRNLALLPDNHAPLREHGAIPHLVQLLVRAHQDTQRQSAGSGGQPQYVDGIRMEEIVEGCTGALHILARDAHNRTVIRGL----------------NTIPLFVQLLYSNIENVQRVAAGVLCELAQEKE-AAEAVEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDF 311          
BLAST of beta-catenin-1 vs. Ensembl Yeast
Match: VAC8 (Phosphorylated and palmitoylated vacuolar membrane protein; interacts with Atg13p, required for the cytoplasm-to-vacuole targeting (Cvt) pathway; interacts with Nvj1p to form nucleus-vacuole junctions [Source:SGD;Acc:S000000739])

HSP 1 Score: 58.151 bits (139), Expect = 5.079e-9
Identity = 44/170 (25.88%), Postives = 85/170 (50.00%), Query Frame = 3
Query:  750 MNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSS-GCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNIL 1256
            + K++H    R   GA+ NM+  +   K +  A  +P LV LL  +   V +Y  T L N+ + +   K+  ++    + K+V+L+   + +     T  L+ LA +    +LEI++ GG  HL+ +I+S D   L+  +   ++ +S+   N+ +I+  G +  L  +L
Sbjct:  175 LAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLA-SDTSYQLEIVRAGGLPHLVKLIQS-DSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLL 342          
BLAST of beta-catenin-1 vs. Ensembl Nematostella
Match: EDO35729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKL9])

HSP 1 Score: 261.536 bits (667), Expect = 1.317e-77
Identity = 171/451 (37.92%), Postives = 244/451 (54.10%), Query Frame = 3
Query: 1077 SKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIV-LINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            SKL IL  GGP  L+ I+K+Y YEKLL+T +RVLKVLSV + NK  I+  GGM AL   L H                          S RL+ NCLWTLRNLSDAAT+ +  D+LL++LVQ+L +            D  V+TCAAGILSNLTCNN  NK    + GG+EA++RT                       ++I EP +C LRH++SRH +AEAAQ ++    GL +L++++             H P             W LIKA+IGL+RNLA+ P N  PIRE G G P +V L+ RA  D + +    N+      +++I+E + GALH+LA++   R+ I S+                  + +   LL++  E+IQRV AG+L E++ ++ G E I ++   T  L +++HS NE I+ YA+A+L R +E+K++ Y
Sbjct:    2 SKLIILASGGPAELVRIMKTYTYEKLLFTTSRVLKVLSVDTDNKMAIVEAGGMQALAMHLGHQ-------------------------SNRLVQNCLWTLRNLSDAATKEDGLDNLLQMLVQLLSSN-----------DIQVVTCAAGILSNLTCNNPRNKQLVCRFGGIEALVRTC----------------LQAGDREEITEPAVCALRHLTSRHADAEAAQNAVRIHYGLPVLVKLL-------------HPP-----------ARWPLIKAVIGLMRNLALCPANHAPIREHG-GLPRLVQLLMRANQD-MQRRPGHNVVIDGVRMDDIVEGTVGALHILAREAHNRAVIRSLH----------------CISLFVQLLYSPNENIQRVAAGVLCELAQDKEGAEAIEAENA-TQPLTDLLHSRNEGIAAYAAAVLFRMSEDKSQDY 357          
BLAST of beta-catenin-1 vs. Ensembl Nematostella
Match: EDO35728 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKL8])

HSP 1 Score: 176.407 bits (446), Expect = 2.718e-49
Identity = 88/165 (53.33%), Postives = 118/165 (71.52%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSK 1082
            A  AIP+L KL+ND DD VV+ +A MMV QLS+ DA   AI+NS +M++ ++ A+N     E  R  AG ++N+S  + GL  IF++  IP LVKLLG  +E+V+FYAITTLHNLLL+Q+G K AVR +G + KMVALL + N+KFL I TDCL +LA+ +Q SK
Sbjct:  135 ATRAIPELAKLLND-DDQVVVGQAAMMVHQLSRKDASRHAIMNSPQMVAALVRALNNMSDVETTRCAAGTLHNLSHHRQGLLSIFKSGGIPALVKLLGSQVEAVVFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLGRGNVKFLAIVTDCLHVLAYGNQESK 298          
BLAST of beta-catenin-1 vs. Ensembl Medaka
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:101166738])

HSP 1 Score: 439.884 bits (1130), Expect = 2.156e-140
Identity = 297/753 (39.44%), Postives = 407/753 (54.05%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENN----RNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + +    S  G  + D  D ++ + EW+   N N +     DI     M       +        EGM   S    YD  +  N      P                D   A  AIP+L KL+NDED  VV+N+A++MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L+ T       +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEDDVDNNQVMYEWEQGFNQNFSQDQVQDIDGQYAMTRAQRVRAAMFPETLEEGMQIPSTQ--YDAANPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKASVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--LHLT-------DP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Medaka
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:101166738])

HSP 1 Score: 439.884 bits (1130), Expect = 2.156e-140
Identity = 297/753 (39.44%), Postives = 407/753 (54.05%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENN----RNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASI-LHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + +    S  G  + D  D ++ + EW+   N N +     DI     M       +        EGM   S    YD  +  N      P                D   A  AIP+L KL+NDED  VV+N+A++MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L+ T       +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++ LH+ GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEDDVDNNQVMYEWEQGFNQNFSQDQVQDIDGQYAMTRAQRVRAAMFPETLEEGMQIPSTQ--YDAANPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKASVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG--LHLT-------DP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHY-GLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Medaka
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:101166738])

HSP 1 Score: 440.269 bits (1131), Expect = 9.264e-140
Identity = 294/752 (39.10%), Postives = 402/752 (53.46%), Query Frame = 3
Query:  237 DKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDI----CMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENN----RNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D+      WQQ  YL DSGI+S   + +    S  G  + D  D ++ + EW+   N N +     DI     M       +        EGM   S    YD  +  N      P                D   A  AIP+L KL+NDED  VV+N+A++MV QLSK +A   AI+ S +M+S ++  M      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL K N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I+++Y YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP IC LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N  P+RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   17 DRKAAVSHWQQQSYL-DSGIHSG-ATTTAPSLSGKGNPEEDDVDNNQVMYEWEQGFNQNFSQDQVQDIDGQYAMTRAQRVRAAMFPETLEEGMQIPSTQ--YDAANPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKASVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTV----------------LRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 670          
BLAST of beta-catenin-1 vs. Ensembl Medaka
Match: ENSORLT00000004536.2 (catenin beta-1 [Source:NCBI gene;Acc:101171502])

HSP 1 Score: 430.254 bits (1105), Expect = 3.417e-136
Identity = 288/758 (37.99%), Postives = 403/758 (53.17%), Query Frame = 3
Query:  222 DEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKY-----PSNTN----ANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPD----------FGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAID-AIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPK---DKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRY 2423
            D  + D       WQQ  YL DSGI S +   + +  S  G  + D E++   L +W++     P  T+    A          + P+T      L  G + +    L A +    +    P                D   A  AIP+L KL+NDED  VV+N+A +MV QLSK +A   A++ S +M+S ++ AM      E  R  AG ++N+S  + GL  IF++  IP LVK+LG  ++SVLFYAITTLHNLLL+Q+G K AVR +G + KMVALL   N+KFL I TDCLQILA+ +Q SKL IL  GGP  L++I++++ YEKLLWT +RVLKVLSVCS+NKP I+  GGM AL   L          +P                SQRL+ NCLWTLRNLSDAAT+    + LL  LVQ+L              D NV+TCAAGILSNLTCNN  NK+   ++GG+EA++RT+                      +DI EP +C LRH++SRH++AE AQ ++    GL ++++         L H  SH               W LIKA +GLIRNLA+ P N   +RE+G    ++ L+ RA  D   + S      +      +EEI+E   GALH+LA+D       +  +I  R +N          + +   LL++ +E+IQRV AG+L E++ ++      I     T  L E++HS NE ++TYA+A+L R +E+K + Y
Sbjct:   11 DMALGDSKAAVSQWQQQSYL-DSGIQSGV---TTTAPSLSGKGNPDIEEEDPTLYDWEFSQPFTPEPTDIEGYAMTRAQRVRAAMFPET------LEEGLQ-IPPTQLDAAHPTAVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ-VVVNKAAVMVHQLSKKEASRHALMRSPQMVSAVVRAMQNTGDVETARCSAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLSNTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTFTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL---------TDP----------------SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL-----------GSDDINVVTCAAGILSNLTCNNYSNKLMVCQVGGIEALVRTV----------------LRAGDREDITEPAVCALRHLTSRHQDAEMAQNAVRLHYGLPVVVK---------LLHPPSH---------------WPLIKATVGLIRNLALCPANHSALREQGAIPRLVQLLVRAHQDTQRRTSMGGNQQQFVEGVRMEEIVEGCTGALHILARD-------VHNRIVIRGLN---------TIPLFVQLLYSPVENIQRVAAGVLCELAQDKE-AAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY 663          
BLAST of beta-catenin-1 vs. Ensembl Medaka
Match: jupa (junction plakoglobin [Source:NCBI gene;Acc:101173369])

HSP 1 Score: 405.216 bits (1040), Expect = 4.554e-127
Identity = 252/663 (38.01%), Postives = 375/663 (56.56%), Query Frame = 3
Query:  591 AESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAI-DAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLN-FDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKL-LEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKN----KRYVAPHNYNIIPQNP---SNLRNNLSISLPANQANNSGYLNSILNSP 2549
            A  A+P+L KL+NDED   V++ A  +V QLS+ +A   A++ S +M++ ++ AM      E  R  A  ++N+S K+ GL  IF+++ IP LV++L   MESVLFYAITTLHNLLL+QDG K AVR +  + +MV LL+K+N KFL I TDCLQ+L+F +Q SKL IL +GGP  L+HI+++Y YEKLLWT +RVLKVLSVC +NKP I+  GGM AL   L                    NS      SQRL+ NCLWTLRNLSDAAT+ +  D LL++LV++L +            D N++TCA GILSNLTCNN +NK    +  G+EA++  I                      +DI EP +C LRH++SRH +AE AQ ++ +  G+  +I++++             QP        YY   W ++KA +GLIRNLA+   N   +R  G    ++ L+ +A  D    +S    + +  + +EEI+E   GALH+LA+DP  R++I  + I                + +   LL++ +++++RV AG+L E++ ++    + I     +  L E++HSNNE I+TYA+A+L R +E+K+    KR      +++   +P      RNN+S+  P     ++G+       P
Sbjct:  126 ATRAVPELTKLLNDEDQ-FVVSRAAQIVNQLSRKEASRQALMQSPQMVAAVVRAMQNTSDMETTRATASIMHNLSHKREGLLAIFKSSGIPALVRMLSSPMESVLFYAITTLHNLLLHQDGAKMAVRLADGLQRMVPLLKKSNPKFLAITTDCLQLLSFGNQESKLIILANGGPEGLVHIMRNYTYEKLLWTTSRVLKVLSVCPSNKPAIVAAGGMQALGKHL--------------------NSS-----SQRLMQNCLWTLRNLSDAATKEDGLDSLLQMLVRLLSSD-----------DINMLTCATGILSNLTCNNGHNKSLVTQNNGIEALIHAI----------------LRAAQREDIIEPAVCALRHLTSRHPQAELAQNAVRNHYGIPAIIKLVD-------------QP--------YY---WPVVKAAVGLIRNLALCQENQDALRAAGVLPRLVNLLIKAHQDTQKHDSSNQQTFQAGVRMEEIVEGCTGALHILARDPTNRAEIALLNI----------------IPLFVQLLYSSVDNVKRVAAGVLCELAIDKQS-AIKIEAEGASPPLMELLHSNNEGIATYAAAVLFRISEDKSLEHKKRVSMELTHSLFKHDPVAWEMARNNISMEPPYQDELDAGFQGGFAGYP 694          
BLAST of beta-catenin-1 vs. Planmine SMEST
Match: SMESG000039528.1 (SMESG000039528.1)

HSP 1 Score: 1821.21 bits (4716), Expect = 0.000e+0
Identity = 938/954 (98.32%), Postives = 939/954 (98.43%), Query Frame = 3
Query:  180 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 3041
            MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNP+               NNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK
Sbjct:    1 MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPT---------------NNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 939          
BLAST of beta-catenin-1 vs. Planmine SMEST
Match: SMESG000039528.1 (SMESG000039528.1)

HSP 1 Score: 1819.28 bits (4711), Expect = 0.000e+0
Identity = 937/953 (98.32%), Postives = 938/953 (98.43%), Query Frame = 3
Query:  183 MNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALEXXXXXXXXXXGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYXXXXXXXXXXXXXXXXXXXXXXXENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 3041
            MNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNP+               NNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK
Sbjct:    1 MNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSVSSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSCLRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLINDEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPMIVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVAPHNYNIIPQNPT---------------NNSGYLNSILNSPIMHNQPPCVSHRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPNFVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKSPSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWSPINK 938          
BLAST of beta-catenin-1 vs. Planmine SMEST
Match: SMESG000002541.1 (SMESG000002541.1)

HSP 1 Score: 169.474 bits (428), Expect = 2.666e-43
Identity = 159/583 (27.27%), Postives = 282/583 (48.37%), Query Frame = 3
Query:  684 SKTDAIDAIINSKEMISCMIEAMNKAEHAEAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRL-NFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILH---FQGLQILIRIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAM-SPCNFVPIRERGFGWPMIVLINRAQIDLLN----KNSCANISPKDKLLEEI-----IEVSCGALHMLAKDPGIRSQIISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSAERLGLELIISQIVITNKLNEMVHSNNEAISTYASAIL 2390
            S  + ID +   K+++SC     NK   AE +     ++ ++S+ + G   I   N IP L+ LL  +   ++   I+TL NL+ + +  ++ +R+S  I K+V  + +N++K LT+  +CL  L FN+  +K  +L   G   ++ I++ Y YEKLL+ A+++LKVLSVC+ANKP+++  G M+AL ++L                            S RL+ + LW++RNLSD ++ + +   LL+ L+++L              D +   C+ G L NLT  N  NK+ F + GGV+A+ + I   +                  +++ EP +  LRH++  +  A+ A   I+       L +LIR       PD         ++P            LIKAI+GL+RNL+M SP     + + G    +  +  R    + +    +NS  ++S +   +E +     +E++  AL  LAKD           + +++I+Y  ++ +QS V ++  ++  +   + R   GLL E+  E      I+       +L+E++HS N+AISTYA+ ++
Sbjct:  115 SDIEVIDGL--KKKIVSCK----NKNTKAECI----SSVQHISKGEQGATNIVNVNFIPILLDLLSSNDLKIVECVISTLDNLMYFVNQSRDIIRNSHGIEKLVEQMDRNDVKLLTVVLNCLHKLTFNNYEAKKTMLLSHGSEKVVQILRQYTYEKLLFAASKLLKVLSVCNANKPILVETGAMEALHSLLRSG-------------------------SPRLVLSSLWSIRNLSDYSSHIADMQKLLQKLIELL-----------GSDDEHTSICSMGCLCNLTSGNTENKLAFIEYGGVQAVCQLICERVG----------------QEEVVEPGVAALRHVTHNNHLAQQAIDIIIQSPLLSNLSVLIR-----GQPD--------KMLP------------LIKAIVGLLRNLSMISPQCRRSLIDLGITNSLCEIFYRTSKGISDLSQQRNSIVSVSSELSFIEGVRLDDLLELTLAALQALAKD----------NLAKKIISYENRL-LQSVVQMV--MIKENSVPLHRACLGLLAEM-VEYADCARILEGEGFNTRLSELIHSTNKAISTYAAIVM 596          
BLAST of beta-catenin-1 vs. Planmine SMEST
Match: SMESG000022923.1 (SMESG000022923.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.170e-11
Identity = 98/396 (24.75%), Postives = 173/396 (43.69%), Query Frame = 3
Query:  771 EAVRFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHNLLLYQDGGKEAVRSSGCIPKMVALLQK------NNIKFLTICTDCLQILAFNHQPSKLEILKHGGPLHLI--HIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREGGMDALTNILYHTIQK-NTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLRNLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSNLTCNNQYNKITFFKLGGVEAILRTIEWNLALXXXXXXXXXXXXXYFPDDIFEPCICTLRHISSRHEEAEAAQASILHFQGLQILI---RIIEMQLGPDLFHMQSHQPIMPNLFLSYYKINWSLIKAIIGLIRNL 1922
            + + +++G  + +S+   G +++ + N    L+ +L   +++V+FY+ITTLHN+LL        V  + CI  ++  + K         K L IC DCL  L++++   K++I +H   + +I  +++   + EKLL    ++LK+LS   + K  I        L   L+ +  K N+NV                            TLRNLSD   +   D   KV   +L      F   S   +  ++ CA GIL+N +C+   NK    K   +++IL+T+              T++   +  +  E     L H+ S HE +       L    +  L     II +    D+    S   I+    L+   I+WS+++A +GL+R+L
Sbjct:  139 QMLYWVSGCFHYISRTPFGCEMLLKNNS-DILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVKIQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFAILVLNLFKSKSKMNSNVWLVM----------------------FLTLRNLSDILFQPKSD-FWKVYHDVLYQICLRFDEISCLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTLS-----------VTTDKFKLWSGETLEAMYRCLHHLCSNHERSLYVINKCL-MSDMNFLTNASHIIILNSSKDI----SFANILSQS-LTDIPISWSILRAWLGLVRHL 493          
The following BLAST results are available for this feature:
BLAST of beta-catenin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTNNB12.378e-14039.46catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB12.643e-14039.46catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB11.622e-13943.11catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB12.592e-13942.86catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB12.828e-13942.86catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmp-21.989e-4626.37Beta-catenin-like protein hmp-2 [Source:UniProtKB... [more]
hmp-21.989e-4626.37Beta-catenin-like protein hmp-2 [Source:UniProtKB... [more]
hmp-22.167e-4626.37Beta-catenin-like protein hmp-2 [Source:UniProtKB... [more]
bar-18.913e-2525.18Beta-catenin/armadillo-related protein 1 [Source:... [more]
jac-11.016e-726.32Juxtamembrane domain-associated catenin [Source:U... [more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arm2.820e-15039.19gene:FBgn0000117 transcript:FBtr0089990[more]
arm1.678e-14839.19gene:FBgn0000117 transcript:FBtr0089991[more]
arm1.678e-14839.19gene:FBgn0000117 transcript:FBtr0089992[more]
arm1.678e-14839.19gene:FBgn0000117 transcript:FBtr0332583[more]
arm1.678e-14839.19gene:FBgn0000117 transcript:FBtr0089988[more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctnnb18.400e-13939.07catenin (cadherin-associated protein), beta 1 [Sou... [more]
ctnnb21.023e-13842.53catenin, beta 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
ctnnb12.229e-13738.60catenin (cadherin-associated protein), beta 1 [Sou... [more]
jupa6.142e-13339.41junction plakoglobin a [Source:ZFIN;Acc:ZDB-GENE-9... [more]
jupa6.142e-13339.41junction plakoglobin a [Source:ZFIN;Acc:ZDB-GENE-9... [more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dctn52.836e-14039.59dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963... [more]
dctn51.214e-13942.69dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963... [more]
dctn52.664e-13942.69dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963... [more]
dctn54.693e-13942.38dynactin subunit 5 [Source:Xenbase;Acc:XB-GENE-963... [more]
jup6.890e-12639.67junction plakoglobin [Source:NCBI gene;Acc:395011][more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctnnb12.180e-13943.11catenin (cadherin associated protein), beta 1 [Sou... [more]
Ctnnb12.180e-13943.11catenin (cadherin associated protein), beta 1 [Sou... [more]
Jup5.029e-12439.84junction plakoglobin [Source:MGI Symbol;Acc:MGI:96... [more]
Jup5.029e-12439.84junction plakoglobin [Source:MGI Symbol;Acc:MGI:96... [more]
Ctnnb15.238e-12146.47catenin (cadherin associated protein), beta 1 [Sou... [more]
back to top
BLAST of beta-catenin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35224|CTNB_URECA1.566e-14839.77Catenin beta OS=Urechis caupo OX=6431 PE=2 SV=1[more]
sp|Q02453|ARM_MUSDO1.889e-14839.06Armadillo segment polarity protein OS=Musca domest... [more]
sp|Q29I35|ARM_DROPS9.432e-14839.19Armadillo segment polarity protein OS=Drosophila p... [more]
sp|P18824|ARM_DROME1.682e-14739.19Armadillo segment polarity protein OS=Drosophila m... [more]
sp|Q7QHW5|ARM_ANOGA7.733e-14138.93Armadillo segment polarity protein OS=Anopheles ga... [more]
back to top
BLAST of beta-catenin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LMF50.000e+0100.00Beta-catenin-1 OS=Schmidtea mediterranea OX=79327 ... [more]
B1NTA70.000e+099.90Beta-catenin-like protein 1 OS=Schmidtea mediterra... [more]
A0A2S1BJK90.000e+091.20Beta-catenin-1 OS=Dugesia japonica OX=6161 PE=2 SV... [more]
G8DNQ10.000e+090.98Beta-catenin-1 (Fragment) OS=Dugesia japonica OX=6... [more]
T1E1F50.000e+072.68Beta-Catenin-1 OS=Dendrocoelum lacteum OX=27895 PE... [more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctnnb19.938e-14039.20catenin beta 1 [Source:NCBI gene;Acc:103035854][more]
ctnnb12.246e-13939.07catenin beta 1 [Source:NCBI gene;Acc:103035854][more]
ctnnb27.940e-13942.53catenin beta-1-like [Source:NCBI gene;Acc:10303457... [more]
ctnnb18.906e-13938.72catenin beta 1 [Source:NCBI gene;Acc:103035854][more]
jupa1.793e-12438.61junction plakoglobin-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTNNB15.668e-14439.51catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB11.376e-13640.22catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB15.277e-12336.92catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB18.951e-6738.54catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB11.070e-5535.62catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VAC85.079e-925.88Phosphorylated and palmitoylated vacuolar membrane... [more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO357291.317e-7737.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357282.718e-4953.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-catenin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctnnb12.156e-14039.44catenin beta 1 [Source:NCBI gene;Acc:101166738][more]
ctnnb12.156e-14039.44catenin beta 1 [Source:NCBI gene;Acc:101166738][more]
ctnnb19.264e-14039.10catenin beta 1 [Source:NCBI gene;Acc:101166738][more]
ENSORLT00000004536.23.417e-13637.99catenin beta-1 [Source:NCBI gene;Acc:101171502][more]
jupa4.554e-12738.01junction plakoglobin [Source:NCBI gene;Acc:1011733... [more]
back to top
BLAST of beta-catenin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039528.10.000e+098.32SMESG000039528.1[more]
SMESG000039528.10.000e+098.32SMESG000039528.1[more]
SMESG000002541.12.666e-4327.27SMESG000002541.1[more]
SMESG000022923.11.170e-1124.75SMESG000022923.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024824
GenBankABY85206.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024824 ID=SMED30024824|Name=beta-catenin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3183bp
GTTGTTTATATTTTTATTTTTGCTTTCTTTCGTTAATAATAAATATTTAT
TAATTTAAATTTATCTTTACATTATCGCAATCTTCAATGAAATAAAATTT
TATAAAGATATATATCATTAAGTCAACTTTTTATATTTAATTGAACTGAA
ATTTTTTTCATTGAATTAATGATATGTAAATGATGAACGAAAGTATGAAT
ATCGTCAATTCTCCTCTAGCAGATGAATTTATAAATGACAAAACAAATTT
CACAAGAACATGGCAGCAAAATCAATATCTTATTGATTCTGGAATAAATT
CAGCTTTAGAAAGTCATAGTCACAGTGTCAGCAGTAAACATGGATATGAT
GATATGGATTCTGAAGACCAAAGTAAAAATCTTAATGAATGGAAATATCC
TTCAAATACCAACGCAAATGATGGATTGTCTAATGATATATGTATGTTAA
CTCCAGATACTCCTGGTAGTACAAGTTGTTTAAGACATGGCGGTGAAGGT
ATGGCTGATGTAAGTCTGTCGGCTTGTTACGATAATAAAGATGAAAATAA
CAGAAATCCTGATTTTGGAATTGATATAGATAAAATAGAAGCTGAAAGTG
CGATACCAGATTTAATAAAGCTTATTAATGATGAAGATGATGCAGTTGTT
ATTAATGAAGCAACTATGATGGTTTTTCAATTGAGTAAAACTGATGCTAT
CGATGCTATTATTAATTCTAAAGAGATGATATCATGTATGATCGAAGCTA
TGAATAAAGCTGAGCATGCAGAAGCTGTGAGATTTTTAGCAGGAGCAATT
TATAACATGTCTCAAAAGAAGAATGGATTAAAGATAATATTTGAAGCGAA
TGTAATACCATGTTTGGTTAAATTGCTCGGTTTTTCAATGGAATCTGTTT
TATTTTATGCAATTACTACTTTACACAATTTATTGCTTTATCAAGATGGT
GGAAAAGAAGCCGTTCGATCAAGCGGATGTATTCCAAAAATGGTTGCTTT
ACTTCAGAAAAACAATATTAAATTTTTAACAATCTGTACTGATTGTTTAC
AAATTTTGGCTTTCAATCATCAACCGAGCAAATTAGAAATATTGAAACAT
GGCGGGCCTCTCCATTTGATTCATATAATTAAAAGTTATGACTATGAAAA
ACTTTTATGGACAGCTACGAGGGTTTTGAAGGTTTTGAGTGTGTGTTCTG
CTAATAAACCAGTCATTATTAGGGAAGGAGGAATGGATGCTTTGACGAAT
ATTTTGTACCATACAATACAGAAGAACACAAATGTCGAGCCGTATCCTCA
AGTTTTACCAGCGGAAAACAGTGAATCATATCCGCATTTCAGCCAGAGAC
TTCTCCATAATTGTCTTTGGACTTTGAGGAATTTGTCTGATGCTGCTACA
AGACTAAATTTCGATCATCTATTGAAGGTTTTAGTTCAAATACTGATGAA
TGCTTTCAATTCATTTCAAAGACAAAGCGCTCACATTGACACGAATGTAA
TCACTTGTGCCGCAGGAATTCTGTCGAATTTGACTTGCAATAACCAATAC
AACAAAATTACATTCTTCAAATTAGGTGGAGTTGAAGCAATTCTCAGGAC
TATCGAGTGGAATTTAGCTTTAACCAATCCAAATGCACCGAATAAAACCA
ATCAAAACAACTATTTTCCCGATGACATTTTCGAGCCGTGCATTTGCACA
CTGAGGCACATTTCGAGTCGTCACGAGGAAGCAGAAGCTGCGCAGGCTTC
AATATTACACTTTCAGGGATTGCAGATTCTCATTCGAATCATTGAAATGC
AATTGGGCCCCGATCTATTTCATATGCAATCACATCAACCAATTATGCCT
AATTTGTTTTTATCTTACTACAAAATCAATTGGAGTCTAATTAAAGCAAT
TATTGGTCTCATTAGAAATTTAGCAATGTCTCCTTGTAATTTCGTACCGA
TTCGGGAGCGAGGTTTCGGATGGCCAATGATAGTTTTGATTAATCGGGCT
CAGATAGATTTATTGAATAAGAATTCGTGTGCTAATATTTCGCCTAAAGA
TAAATTATTAGAAGAGATTATCGAAGTGTCATGTGGAGCGTTGCACATGT
TAGCTAAAGATCCTGGAATTCGTTCACAGATTATTTCAATGAAGATATGG
CAAAGATTAATCAATTATCCCCAGCAAATCGGTATTCAATCAGCTGTTTA
TGTTATCGCAAGTTTGCTGTTCAATCACTTGGAGTCGATTCAGAGAGTAA
CTGCTGGATTGTTGGTTGAGGTTTCTGCCGAACGGCTTGGACTGGAATTG
ATCATTAGCCAAATTGTCATTACAAACAAACTGAATGAGATGGTCCATTC
AAATAATGAAGCGATATCAACCTACGCTTCGGCAATTCTAATTAGAGCCA
CTGAGGAGAAAAATAAACGATATGTAGCTCCACACAACTACAATATCATT
CCTCAAAACCCGAGTAATCTGAGAAATAATTTGTCGATATCTTTACCAGC
TAATCAAGCCAATAATTCTGGATACTTAAATTCGATTTTGAATTCTCCGA
TTATGCACAACCAACCGCCATGTGTCAGCCATAGACACAATTCAGTAACA
CAATGTGGTGATCAAAATATTGCTACAAATGAAACTTTATGTCCAATCAA
TGACGTGGACGTTACAGATTACCATATGCCGTTTTCTAATACTCTACAAC
CGCAAAATCGATATCCGTACAATCCTAATTTCGTTGATCCAAATTACAGT
TTGATCAATCAAACTGGAAATTCTGAAATCGCAATGAGACACTTCAAACA
GATGGGCTCTATAAATATTAGCAATGAATGTGTTAATCAAGATGTTCAAA
AGGCTTACTCAAATTCAAGTTTCAAGAGCCCATCATCTCATTCTTTATCT
GTTAGTGGTAACTTGTGTTCGTCAAATGAAAATTCTAAAAAAGATATGAT
GGACGTATGTATGTTGGACGCGGACTGGATAGAAACCTGCTCTGACTTTT
CGCAAGGACATTCACAAAAATCTTGGTCTCCAATTAATAAATAAATTAAA
ATATTAATTGAAATTTACTTTTTGTTTGCTAGTTTGGTTTTCGTTATTAT
TTCGTAATTAAATATGTGATTTCGAATACAATGTAAAGCATCTTGATATT
TAAAAACGTCTCATGTGCATGTCTGTAATTTTT
back to top

protein sequence of SMED30024824-orf-1

>SMED30024824-orf-1 ID=SMED30024824-orf-1|Name=SMED30024824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=955bp
MMNESMNIVNSPLADEFINDKTNFTRTWQQNQYLIDSGINSALESHSHSV
SSKHGYDDMDSEDQSKNLNEWKYPSNTNANDGLSNDICMLTPDTPGSTSC
LRHGGEGMADVSLSACYDNKDENNRNPDFGIDIDKIEAESAIPDLIKLIN
DEDDAVVINEATMMVFQLSKTDAIDAIINSKEMISCMIEAMNKAEHAEAV
RFLAGAIYNMSQKKNGLKIIFEANVIPCLVKLLGFSMESVLFYAITTLHN
LLLYQDGGKEAVRSSGCIPKMVALLQKNNIKFLTICTDCLQILAFNHQPS
KLEILKHGGPLHLIHIIKSYDYEKLLWTATRVLKVLSVCSANKPVIIREG
GMDALTNILYHTIQKNTNVEPYPQVLPAENSESYPHFSQRLLHNCLWTLR
NLSDAATRLNFDHLLKVLVQILMNAFNSFQRQSAHIDTNVITCAAGILSN
LTCNNQYNKITFFKLGGVEAILRTIEWNLALTNPNAPNKTNQNNYFPDDI
FEPCICTLRHISSRHEEAEAAQASILHFQGLQILIRIIEMQLGPDLFHMQ
SHQPIMPNLFLSYYKINWSLIKAIIGLIRNLAMSPCNFVPIRERGFGWPM
IVLINRAQIDLLNKNSCANISPKDKLLEEIIEVSCGALHMLAKDPGIRSQ
IISMKIWQRLINYPQQIGIQSAVYVIASLLFNHLESIQRVTAGLLVEVSA
ERLGLELIISQIVITNKLNEMVHSNNEAISTYASAILIRATEEKNKRYVA
PHNYNIIPQNPSNLRNNLSISLPANQANNSGYLNSILNSPIMHNQPPCVS
HRHNSVTQCGDQNIATNETLCPINDVDVTDYHMPFSNTLQPQNRYPYNPN
FVDPNYSLINQTGNSEIAMRHFKQMGSINISNECVNQDVQKAYSNSSFKS
PSSHSLSVSGNLCSSNENSKKDMMDVCMLDADWIETCSDFSQGHSQKSWS
PINK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013284Beta-catenin
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0004871signal transducer activity
GO:0005515protein binding
GO:0005488binding
GO:0005198structural molecule activity
GO:0045294alpha-catenin binding
GO:0045296cadherin binding
Vocabulary: biological process
TermDefinition
GO:0034333adherens junction assembly
GO:0002159desmosome assembly
GO:0007155cell adhesion
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005913cell-cell adherens junction
GO:0016342catenin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013284Beta-cateninPRINTSPR01869BCATNINFAMLYcoord: 625..647
score: 33.7
coord: 161..182
score: 39.58
coord: 224..243
score: 58.54
coord: 310..334
score: 61.5
coord: 280..302
score: 68.12
IPR000225ArmadilloSMARTSM00185arm_5coord: 407..453
e-value: 310.0
score: 1.7
coord: 170..212
e-value: 19.0
score: 11.1
coord: 213..253
e-value: 0.0013
score: 28.0
coord: 297..338
e-value: 12.0
score: 12.6
coord: 254..295
e-value: 0.018
score: 24.2
coord: 455..513
e-value: 13.0
score: 12.3
coord: 339..404
e-value: 0.0014
score: 27.9
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 308..351
score: 9.397
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 224..266
score: 9.887
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 413..456
score: 8.767
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 130..741
e-value: 1.9E-169
score: 566.7
NoneNo IPR availablePANTHERPTHR45976:SF1ARMADILLO SEGMENT POLARITY PROTEINcoord: 386..539
coord: 22..365
coord: 567..751
NoneNo IPR availablePANTHERPTHR45976FAMILY NOT NAMEDcoord: 386..539
coord: 22..365
coord: 567..751
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 437..743
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 138..539