Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30024809
Length (bp)1237
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30024809) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30024809) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30024809) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30024809) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024809

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30024809h1SMcG0010743 dd_Smed_v4_3085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024809h1SMcG0010743 dd_Smed_v4_3085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30024809h1SMcG0010743 dd_Smed_v4_3085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30024809h1SMcG0010743 dd_Smed_v4_3085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024809h1SMcG0010743 dd_Smed_v4_3085_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP42 (ubiquitin specific peptidase 42 [Source:HGNC Symbol;Acc:HGNC:20068])

HSP 1 Score: 67.0106 bits (162), Expect = 3.303e-11
Identity = 82/325 (25.23%), Postives = 132/325 (40.62%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLE-IKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKR--------GQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGY---DIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIE---DYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEI-TYQNNDN-KPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDK-WYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + C+ N+ LQ L     L +     E  K  + E   +   +   IT + S   +  +    IN  +R         Q+D+ E L Y +  + K      N  D        L  +   GY    +KC N   ++      L + + I           +  S+   + +++   +++    Y C  C K    +          + S +L+         L   R+ N +  K+   +K  E L+I  Y +  N +PI   + L AV+VH+G N   GHY CY   S+  WY  +DS V  SDI++V+SQQ Y+LFY
Sbjct:  111 AGLQNLGNTCFANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVINEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQAT-TLVCQIFGGYLRSRVKCLNCKGVSDTFDPYLDITLEIK----------AAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKR----FTIHRSSNVLT---------LSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIV--YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFY 409          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP42 (ubiquitin specific peptidase 42 [Source:HGNC Symbol;Acc:HGNC:20068])

HSP 1 Score: 64.6994 bits (156), Expect = 1.012e-10
Identity = 41/97 (42.27%), Postives = 57/97 (58.76%), Query Frame = 3
Query:  798 LQRTRWINGSMKKLTDSIKIDEKLEI-TYQNNDN-KPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDK-WYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L   R+ N +  K+   +K  E L+I  Y +  N +PI   + L AV+VH+G N   GHY CY   S+  WY  +DS V  SDI++V+SQQ Y+LFY
Sbjct:  248 LSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIV--YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFY 342          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP42 (ubiquitin specific peptidase 42 [Source:HGNC Symbol;Acc:HGNC:20068])

HSP 1 Score: 65.4698 bits (158), Expect = 1.013e-10
Identity = 41/97 (42.27%), Postives = 57/97 (58.76%), Query Frame = 3
Query:  798 LQRTRWINGSMKKLTDSIKIDEKLEI-TYQNNDN-KPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDK-WYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L   R+ N +  K+   +K  E L+I  Y +  N +PI   + L AV+VH+G N   GHY CY   S+  WY  +DS V  SDI++V+SQQ Y+LFY
Sbjct:  161 LSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIV--YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFY 255          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP3 (ubiquitin specific peptidase 3 [Source:HGNC Symbol;Acc:HGNC:12626])

HSP 1 Score: 63.929 bits (154), Expect = 2.006e-10
Identity = 81/366 (22.13%), Postives = 147/366 (40.16%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAF--QSNLFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVPIIEKSNGKSDKISG--LSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIK-----IDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   ++ +  +  K++         AF  +S  ++ WK     RG  QQD+ E + Y +  ++ EL+     N + +  +  L     +    KCC N                  + + C  +       + L+L +P   +S    ++ +G   S++  +  +     LDETE+  Y+C               + +       +  LP+ +C+HL+R  W      K+   ++     +D K  +    N   P +  + L AV+VH G  +  GHY  Y     +W+  +DSTV  +D +TV+  + YILFY
Sbjct:   72 LRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQG--GFNGVSR--SAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETEL--YMC-----------HKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSG-PESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 419          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP3 (ubiquitin specific peptidase 3 [Source:HGNC Symbol;Acc:HGNC:12626])

HSP 1 Score: 63.929 bits (154), Expect = 2.181e-10
Identity = 81/366 (22.13%), Postives = 147/366 (40.16%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAF--QSNLFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVPIIEKSNGKSDKISG--LSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIK-----IDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   ++ +  +  K++         AF  +S  ++ WK     RG  QQD+ E + Y +  ++ EL+     N + +  +  L     +    KCC N                  + + C  +       + L+L +P   +S    ++ +G   S++  +  +     LDETE+  Y+C               + +       +  LP+ +C+HL+R  W      K+   ++     +D K  +    N   P +  + L AV+VH G  +  GHY  Y     +W+  +DSTV  +D +TV+  + YILFY
Sbjct:   84 LRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQG--GFNGVSR--SAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETEL--YMC-----------HKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSG-PESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 431          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-3 (Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;Acc:Q9GRV2])

HSP 1 Score: 58.151 bits (139), Expect = 5.556e-9
Identity = 72/333 (21.62%), Postives = 139/333 (41.74%), Query Frame = 3
Query:  171 NSASNCYLNSTLQGLAACTQL---------IDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAK-------VNAFQSNLF-INWKKRG--QQDSFEVLTYAISEVYKELRKKENV--------NDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITY---QNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            N  + C++N+ LQ LA+ ++          ++D+   E + +N  +        + +  S+SA+        N F+     +  + RG  Q DS E + Y +  ++ E+RK   +          I K+    L    I     + C N      + + L+L +P    +       S + +   ++ +     +E     +C+K  +K   +K           +  LP+ +C+H++R R   G    + D      +L++T     ++D  P T  +SL+++IVH G     GHY+ +   + +W+   D+ VK  D   V  Q+ Y+L Y
Sbjct:  233 NVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEPKNGGNYCYLTDEYRKLLISQSARSFREPTAPNEFREAFISVCPRFRGFRQHDSHEFMRYFMDSLHTEMRKCRKLPGMPDDKHTPISKYFEGTLQSSVI----CQTCRNCSNKIDEFMDLSLDIPAQRNA-------SKVRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSKQ--------MFIRKLPQVLCLHMKRFRDNGGKNDAIIDFPM--GQLDVTQFLTDDSDEAPCT--YSLQSIIVHIGYGCGSGHYIAFGKRNGRWFQFDDTVVKGVDEAHVSKQKAYVLLY 542          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: Y67D2.2 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q9BKQ6])

HSP 1 Score: 49.2914 bits (116), Expect = 3.549e-6
Identity = 25/63 (39.68%), Postives = 33/63 (52.38%), Query Frame = 3
Query:  915 FSLKAVIVHSGNIFFGHYVCYRLCS----DKWYFTSDSTVKESDIKTVMSQQPYILFYE*FYP 1091
            + L+AV  H G  + GH+V YR  S      WY+TSD+ V       V + Q Y+LFYE   P
Sbjct:  405 YQLRAVSEHRGGPYSGHFVTYRRASAPNHHTWYYTSDAQVTRVPYSHVAACQSYMLFYERVKP 467          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-33 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q93875])

HSP 1 Score: 48.1358 bits (113), Expect = 8.903e-6
Identity = 43/157 (27.39%), Postives = 69/157 (43.95%), Query Frame = 3
Query:  630 SIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQ-----FSLKAVIVHSG-NIFFGHYV--CYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            S++S ++++   + ++D     CSK +   +  KS  KA +       LP  I + L+R R        +  S K+ + +E   ++ D    T       + L   +VH G ++ FGHYV  C     ++WY   D  V   D   V   QPYIL Y
Sbjct:  403 SLESCLDRFFQNSTLQDDNQYSCSKCEVLVDATKS-TKAHR-------LPEVIIIQLKRFR------HTMFGSCKVGKVVEFPLRSQDFGRWTTSGEPALYDLVGFVVHEGRSLEFGHYVSYCRHEQDNQWYKFDDMVVTRCDATQVAKSQPYILMY 545          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: cyk-3 (Ubiquitin carboxyl-terminal hydrolase cyk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q8WT44])

HSP 1 Score: 48.521 bits (114), Expect = 9.005e-6
Identity = 31/105 (29.52%), Postives = 51/105 (48.57%), Query Frame = 3
Query:  774 LPRTICVHLQRTRWIN--GSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            LP+ + +HL+R  ++   G M K   ++    K         +KP  N +   A+  H G +  GH++ Y +   DKW   +D +V+E   + V  Q  Y+LFYE
Sbjct: 1067 LPKYLIIHLKRFEFLREQGRMGKCKRTVNFPLK-HFDPAPFVDKPDGNTYECIALANHYGQLSCGHFIAYAKSNEDKWLLLNDCSVREVSEEEVDKQGAYLLFYE 1170          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: cyk-3 (Ubiquitin carboxyl-terminal hydrolase cyk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q8WT44])

HSP 1 Score: 48.521 bits (114), Expect = 9.490e-6
Identity = 31/105 (29.52%), Postives = 51/105 (48.57%), Query Frame = 3
Query:  774 LPRTICVHLQRTRWIN--GSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            LP+ + +HL+R  ++   G M K   ++    K         +KP  N +   A+  H G +  GH++ Y +   DKW   +D +V+E   + V  Q  Y+LFYE
Sbjct: 1070 LPKYLIIHLKRFEFLREQGRMGKCKRTVNFPLK-HFDPAPFVDKPDGNTYECIALANHYGQLSCGHFIAYAKSNEDKWLLLNDCSVREVSEEEVDKQGAYLLFYE 1173          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp30 (gene:FBgn0029819 transcript:FBtr0343537)

HSP 1 Score: 82.4185 bits (202), Expect = 1.311e-16
Identity = 71/282 (25.18%), Postives = 115/282 (40.78%), Query Frame = 3
Query:  384 QQDSFEVLTYAISEVYKEL-RKKENVNDIEKWVNF-----ELPMRFIMGYDI---KCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWI-NGSMKKLTDSIKIDEKLEITYQN---------------------NDNKPITNQ---------------FSLKAVIVHSGNIFFGHYVCYRLCS----DKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            QQ   E L   +S   + L R       +  W N        P +  MG  I    C +   +   K  ++ L++P          + +GLS+  L+++Y+   ++ D  CD C       NE  +  K+  F++    LP  +C+H+ RT W+  G + K  D +   E L +   +                     + + P+ N                + L AV+VHSG    GH+V YR  S     +WY+TSD+ V+E  I  V+S   Y+LFY+
Sbjct:  286 QQQQDEGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNLP--------PQRRTGLSLGHLLSEYITSEDLSDVKCDSC-------NETTTHTKSVTFAK----LPACLCIHVARTVWLPTGQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWYYTSDTIVREVSIDEVLSVPAYLLFYD 548          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp30 (gene:FBgn0029819 transcript:FBtr0070828)

HSP 1 Score: 82.4185 bits (202), Expect = 1.311e-16
Identity = 71/282 (25.18%), Postives = 115/282 (40.78%), Query Frame = 3
Query:  384 QQDSFEVLTYAISEVYKEL-RKKENVNDIEKWVNF-----ELPMRFIMGYDI---KCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWI-NGSMKKLTDSIKIDEKLEITYQN---------------------NDNKPITNQ---------------FSLKAVIVHSGNIFFGHYVCYRLCS----DKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            QQ   E L   +S   + L R       +  W N        P +  MG  I    C +   +   K  ++ L++P          + +GLS+  L+++Y+   ++ D  CD C       NE  +  K+  F++    LP  +C+H+ RT W+  G + K  D +   E L +   +                     + + P+ N                + L AV+VHSG    GH+V YR  S     +WY+TSD+ V+E  I  V+S   Y+LFY+
Sbjct:  286 QQQQDEGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNLP--------PQRRTGLSLGHLLSEYITSEDLSDVKCDSC-------NETTTHTKSVTFAK----LPACLCIHVARTVWLPTGQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWYYTSDTIVREVSIDEVLSVPAYLLFYD 548          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp20-33 (gene:FBgn0033916 transcript:FBtr0087535)

HSP 1 Score: 60.8474 bits (146), Expect = 1.422e-9
Identity = 43/147 (29.25%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  681 YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQ--------FSLKAVIVHSGNIFFGHYVCY--RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE*FYP 1091
            Y C+ C+K  +            K+S++L+ LP  +C+HL+R R        L+ S KI   +    +  D +P  ++        ++L +VI H G +  GHY C+     + KWY   D  V E   + V S Q Y+LFY    P
Sbjct:  414 YSCERCNKLRT----------GIKYSRVLT-LPEVLCIHLKRFR------NDLSYSSKISSDVYFPLEGFDMRPYIHKDCKSEVAIYNLSSVICHHGTVGGGHYTCFARNTLNGKWYEFDDQFVTEVSSELVQSCQAYVLFYHKHNP 543          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: not (gene:FBgn0013717 transcript:FBtr0346438)

HSP 1 Score: 48.9062 bits (115), Expect = 5.854e-6
Identity = 35/114 (30.70%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  747 KKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITN--QFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            K+FS  L  LP  +  HL+R        +K++  I+   + ++T   ++ K      +FSL AV+ H G I  GHY  Y R   D W    D  +  + +K V+  + Y+LFY 
Sbjct:  378 KQFS--LRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYH 489          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: not (gene:FBgn0013717 transcript:FBtr0290259)

HSP 1 Score: 48.9062 bits (115), Expect = 5.854e-6
Identity = 35/114 (30.70%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  747 KKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITN--QFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            K+FS  L  LP  +  HL+R        +K++  I+   + ++T   ++ K      +FSL AV+ H G I  GHY  Y R   D W    D  +  + +K V+  + Y+LFY 
Sbjct:  378 KQFS--LRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYH 489          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp18 (ubiquitin specific peptidase 18 [Source:ZFIN;Acc:ZDB-GENE-100210-2])

HSP 1 Score: 83.5741 bits (205), Expect = 2.197e-17
Identity = 86/328 (26.22%), Postives = 142/328 (43.29%), Query Frame = 3
Query:  156 VARLINSASNCYLNSTLQGLAACTQLIDDFRQLE----IKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKR-GQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIE---DYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITY------QNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDK-WYFTSDSTVKESDIKTVMS-----QQPYILFY 1076
            V  L N   +C +N+ LQ  +A T+L+D   +      I+  NI  L++ N LL     S SA    F   L+ +   R  QQD+ E+    ++   K++   E   +I      E+  +      + C +   I        +L + I E  N         +++S +  +  + ++E    + CD C K            +   + Q L  LP+ +CVHL+R R  +G +KKL   +   E L+I+       +N  +      +SL AVIVH G+  FGHY  + R   D+ WY+ +DS V ++  K V       +  Y+L Y
Sbjct:   28 VRGLFNDGLSCCVNALLQSFSATTELLDILNKWNPSDGIEQSNI-PLQLRNTLLSVRDPSHSAPHKGFLDCLYRHAICRYTQQDADEIFHMILNLSLKQMPDHELAQEIRSLYTIEVETQ------VTCMDCTFIHRLPNSYFSLPLVIHEGEN---------TLESCIKSFFKKQKLEVSEKFFCDRCEKK-----------QPCAYEQKLVSLPQILCVHLKRFRNEHGLIKKLDSKVTFPETLKISVFAAGQSENAASDSPQADYSLFAVIVHIGSAMFGHYTAFIRQTQDQMWYYANDSRVNQATWKDVQDTYKGRETAYLLLY 328          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp18 (ubiquitin specific peptidase 18 [Source:ZFIN;Acc:ZDB-GENE-100210-2])

HSP 1 Score: 83.5741 bits (205), Expect = 2.299e-17
Identity = 83/310 (26.77%), Postives = 135/310 (43.55%), Query Frame = 3
Query:  147 KMYVARLINSASNCYLNSTLQGLAACTQLIDDFRQLE----IKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKR-GQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIE---DYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITY------QNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDK-WYFTSDSTVKE 1028
            + YV  L N   +C +N+ LQ  +A T+L+D   +      I+  NI  L++ N LL     S SA    F   L+ +   R  QQD+ E+    ++   K++   E   +I      E+  +      + C +   I        +L + I E  N         +++S +  +  + ++E    + CD C K      E K           L  LP+ +CVHL+R R  +G +KKL   +   E L+I+       +N  +      +SL AVIVH G+  FGHY  + R   D+ WY+ +DS V +
Sbjct:   24 RGYVRGLFNDGLSCCVNALLQSFSATTELLDILNKWNPSDGIEQSNI-PLQLRNTLLSVRDPSHSAPHKGFLDCLYRHAICRYTQQDADEIFHMILNLSLKQMPDHELAQEIRSLYTIEVETQ------VTCMDCTFIHRLPNSYFSLPLVIHEGEN---------TLESCIKSFFKKQKLEVSEKFFCDRCEKKQPCAYEQK-----------LVSLPQILCVHLKRFRNEHGLIKKLDSKVTFPETLKISVFAAGQSENAASDSPQADYSLFAVIVHIGSAMFGHYTAFIRQTQDQMWYYANDSRVNQ 306          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp3 (ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5142])

HSP 1 Score: 63.1586 bits (152), Expect = 2.534e-10
Identity = 86/363 (23.69%), Postives = 146/363 (40.22%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSN--LFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMR------FIMGY--------------DIKC--CNNHVIACPKQVALALHVPIIEKSNGKSDKISGLS------IQSLVN-KYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIK-----IDEKLEITYQNNDNKPITNQFSLKAVIVHSGN-IFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+        F++L                  + Q   S+ +  +  K++         AF  +   ++ WK     RG  QQD+ E L Y +  +++E++  +N +     V  + P        FI G               ++ C  C          + L+L +P   +     D+  G +      ++S  + + LDETE+  Y+C  C          K +   KKF   +  LP+ +C+HL+R  W      K+   ++     +D K  +    N + P    + L AV+VH G+ I  GHY  Y     +WY  +DSTV     + V+  + YILFY
Sbjct:  165 LRNLGNTCFMNAILQSLSNIQVFSCYFKELPSVALRSGKTAGRRMYHTRSQGDSSVSLVEEFRKTLCSLWQGSQTAFSPDALFYVIWKIMPSFRGYQQQDAHEFLRYLLDHLHREMQGNKNGSPSPP-VTSDEPNHASESKCFINGTSTIVTSVFGGVLQNEVYCLICGTESRKFDPFLDLSLDIPNQFRIKTTKDQEPGPTCTLSDCLRSFTDLEELDETEL--YMCHKC---------KKRQKSTKKF--WIQKLPKVLCLHLKRFHWTAFLRNKVDTYVEFPMCGLDMKSYLLEPEN-SLPERCLYDLAAVVVHHGSGIGSGHYTAYGRHEGQWYHFNDSTVTLVSEEAVLKAKAYILFY 512          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp42 (ubiquitin specific peptidase 42 [Source:ZFIN;Acc:ZDB-GENE-030131-5739])

HSP 1 Score: 62.003 bits (149), Expect = 8.168e-10
Identity = 44/134 (32.84%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  681 YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSD-KWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            Y C  C K  +          +K+F+   S     + + L+R    NG   K+T  ++  E L++    + +      ++L AV+VHSG +   GHY CY   S+ +WY  +DS+V  SDI+TV++QQ Y+LFY
Sbjct:  291 YKCSKCKKMVTA---------SKRFTVHRSS--NVLTISLKRFTNFNGG--KITKDVRYAEHLDLRPFMSQSHGEPQIYALYAVLVHSGFSCHAGHYYCYIKASNGQWYQMNDSSVSLSDIRTVLNQQAYLLFY 411          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp42 (ubiquitin specific peptidase 42 [Source:ZFIN;Acc:ZDB-GENE-030131-5739])

HSP 1 Score: 62.003 bits (149), Expect = 8.168e-10
Identity = 44/134 (32.84%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  681 YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSD-KWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            Y C  C K  +          +K+F+   S     + + L+R    NG   K+T  ++  E L++    + +      ++L AV+VHSG +   GHY CY   S+ +WY  +DS+V  SDI+TV++QQ Y+LFY
Sbjct:  291 YKCSKCKKMVTA---------SKRFTVHRSS--NVLTISLKRFTNFNGG--KITKDVRYAEHLDLRPFMSQSHGEPQIYALYAVLVHSGFSCHAGHYYCYIKASNGQWYQMNDSSVSLSDIRTVLNQQAYLLFY 411          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: eif1b (eukaryotic translation initiation factor 1B [Source:Xenbase;Acc:XB-GENE-1010215])

HSP 1 Score: 71.2478 bits (173), Expect = 9.785e-13
Identity = 39/99 (39.39%), Postives = 60/99 (60.61%), Query Frame = 3
Query:  786 ICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            + + L+R    NG   KL+  IK  E L++    +D       + L AV++H+G +   GHY CY + C+D+WY  +DSTV  +DI+TV++QQ Y+LFY
Sbjct:  285 LTLSLKRFASFNGG--KLSKEIKYPEYLDLRPYTSDPNGEPVIYVLYAVLIHTGFSCHGGHYYCYVKACNDQWYLMNDSTVSTTDIRTVLNQQAYLLFY 381          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: eif1b (eukaryotic translation initiation factor 1B [Source:Xenbase;Acc:XB-GENE-1010215])

HSP 1 Score: 71.2478 bits (173), Expect = 1.095e-12
Identity = 40/101 (39.60%), Postives = 63/101 (62.38%), Query Frame = 3
Query:  786 ICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNND--NKPITNQFSLKAVIVHSG-NIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            + + L+R    NG   KL+  IK  E L++    +D   +P+   + L AV++H+G +   GHY CY + C+D+WY  +DSTV  +DI+TV++QQ Y+LFY
Sbjct:  300 LTLSLKRFASFNGG--KLSKEIKYPEYLDLRPYTSDPNGEPVI--YVLYAVLIHTGFSCHGGHYYCYVKACNDQWYLMNDSTVSTTDIRTVLNQQAYLLFY 396          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: rpl7l1 (ribosomal protein L7 like 1 [Source:Xenbase;Acc:XB-GENE-5911163])

HSP 1 Score: 64.6994 bits (156), Expect = 5.797e-11
Identity = 80/314 (25.48%), Postives = 142/314 (45.22%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIE-SLKIFNKLLKSITGSKS-AKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKE-LRKKENVNDIEKWVNFELPMRFIMGY---DIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIF-FGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + CY+NS LQ L     L + F   E   + ++    +   + K I   KS +   A Q+ +  ++K+  Q+D+ E L YA+  + +  L   ++++    +++     +   GY   +++C N   ++      L L + I +K+N         S+   + +Y+    + +  C  CSK       N+     K FS    P   T+C++    R+   S  K++  +   E ++I    ++    T  + L AV+VH+GN    GHY CY +  + KWY  +D  V   DI TV+  + Y+LFY
Sbjct:   34 AGLRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFCMMCLMQKHIAQVKSVSGRGANQARIAGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIH-----QVFGGYLRSEVRCLNCSGVSDTFDQFLDLQLDI-KKAN---------SVIEALKEYVRPENLGE-SCYKCSKC------NEMVTATKTFSIHQPPNVLTLCLN----RFDVFSDNKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFY 321          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000030414.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:124917763:124921450:-1 gene:ENSXETG00000003555.1 transcript:ENSXETT00000030414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.206e-9
Identity = 79/312 (25.32%), Postives = 138/312 (44.23%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKE-LRKKENVNDIEKWVNFELPMRFIMGY---DIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIF-FGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + CY+NS LQ L     L + F   E   + ++  K F   +  +     A+V     +    +K+  Q+D+ E L YA+  + +  L   ++++    +++     +   GY   +++C N   ++      L L + I +K+N         S+   + +Y+    + +  C  CSK       NK     K FS    P   T+C++    R+   S  K++  +   E ++I    ++    T  + L AV+VH+GN    GHY CY +  + KWY  +D  V   DI TV+  + Y+LFY
Sbjct:   34 AGLRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVK--KGF--CMMCLMQKHIAQVKRIAGH----FKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIH-----QVFGGYLRSEVRCLNCSGVSDTFDQFLDLQLDI-KKAN---------SVIEALKEYVRPENLGE-SCYKCSKC------NKMVTATKTFSIHQPPNVLTLCLN----RFDVFSENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFY 311          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000014911.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:124917318:124921450:-1 gene:ENSXETG00000003555.1 transcript:ENSXETT00000014911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.208e-9
Identity = 77/312 (24.68%), Postives = 136/312 (43.59%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKE-LRKKENVNDIEKWVNFELPMRFIMGY---DIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIF-FGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + CY+NS LQ L     L + F   E   + ++        +  +     A+V     +    +K+  Q+D+ E L YA+  + +  L   ++++    +++     +   GY   +++C N   ++      L L + I +K+N         S+   + +Y+    + +  C  CSK       NK     K FS    P   T+C++    R+   S  K++  +   E ++I    ++    T  + L AV+VH+GN    GHY CY +  + KWY  +D  V   DI TV+  + Y+LFY
Sbjct:   34 AGLRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKK----GFCMMCLMQKHIAQVKRIAGH----FKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIH-----QVFGGYLRSEVRCLNCSGVSDTFDQFLDLQLDI-KKAN---------SVIEALKEYVRPENLGE-SCYKCSKC------NKMVTATKTFSIHQPPNVLTLCLN----RFDVFSENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFY 311          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp17lb (ubiquitin specific peptidase 17-like B [Source:MGI Symbol;Acc:MGI:3051498])

HSP 1 Score: 66.6254 bits (161), Expect = 1.765e-11
Identity = 84/327 (25.69%), Postives = 139/327 (42.51%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLID-----DFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKEL----RKKENVNDIEKWVNFELPMRFIMG----YDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSM-KKLTDSIKIDEKLEITYQNNDNKPITNQ-------FSLKAVIVHSG-NIFFGHY-VCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N+ ++CYLN+ LQ L     L D     +  Q     +  +   +   + +S+  + S  V     NL   + KR Q+D+ E L + +  +++      R+ E  ++         P+  I G      IKC  +H           L +P+          IS  S+QS V + L +TE  + +C + S    +  + K   K  K    L   P+ + + L+R    +GSM KKL   +   E L++       KP  +Q       ++L AV+VH G     GHY  C +    KWY   D+ V   D+ +V+++  Y+LFY
Sbjct:   52 LQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHTHSGDVMKPSQNLTSAFHKRKQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSS------PIHDIFGGWWRSQIKC--HHCQGTSYSYDPFLDIPL---------DIS--SVQS-VKQALQDTEKAEELCGENSYYCGRCRQKKPASKTLK----LYSAPKVLMLVLKR---FSGSMGKKLDRKVSYPEFLDL-------KPYLSQPTGGPLPYALYAVLVHEGATCHSGHYFCCVKAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFY 344          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp17lb (ubiquitin specific peptidase 17-like B [Source:MGI Symbol;Acc:MGI:3051498])

HSP 1 Score: 66.6254 bits (161), Expect = 2.133e-11
Identity = 84/327 (25.69%), Postives = 139/327 (42.51%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLID-----DFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKEL----RKKENVNDIEKWVNFELPMRFIMG----YDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSM-KKLTDSIKIDEKLEITYQNNDNKPITNQ-------FSLKAVIVHSG-NIFFGHY-VCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N+ ++CYLN+ LQ L     L D     +  Q     +  +   +   + +S+  + S  V     NL   + KR Q+D+ E L + +  +++      R+ E  ++         P+  I G      IKC  +H           L +P+          IS  S+QS V + L +TE  + +C + S    +  + K   K  K    L   P+ + + L+R    +GSM KKL   +   E L++       KP  +Q       ++L AV+VH G     GHY  C +    KWY   D+ V   D+ +V+++  Y+LFY
Sbjct:   53 LQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHTHSGDVMKPSQNLTSAFHKRKQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSS------PIHDIFGGWWRSQIKC--HHCQGTSYSYDPFLDIPL---------DIS--SVQS-VKQALQDTEKAEELCGENSYYCGRCRQKKPASKTLK----LYSAPKVLMLVLKR---FSGSMGKKLDRKVSYPEFLDL-------KPYLSQPTGGPLPYALYAVLVHEGATCHSGHYFCCVKAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFY 345          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp3 (ubiquitin specific peptidase 3 [Source:MGI Symbol;Acc:MGI:2152450])

HSP 1 Score: 63.929 bits (154), Expect = 1.502e-10
Identity = 81/366 (22.13%), Postives = 147/366 (40.16%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAF--QSNLFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVPIIEKSNGKSDKISG--LSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIK-----IDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   ++ +  +  K++         AF  +S  ++ WK     RG  QQD+ E + Y +  ++ EL+     N + +  +  L     +    KCC N                  + + C  +       + L+L +P   +S    ++ +G   S++  +  +     LDETE+  Y+C               + +       +  LP+ +C+HL+R  W      K+   ++     +D K  +    N   P +  + L AV+VH G  +  GHY  Y +   +W+  +DSTV  +D +TV   + YILFY
Sbjct:  161 LRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDSNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQG--GFNGVSR--SAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETEL--YMC-----------HKCKKKQKSTKKFWIQKLPKALCLHLKRFHWTAYLRNKVDTYVQFPLRGLDMKCYLLEPENSG-PDSCLYDLAAVVVHHGSGVGSGHYTAYAVHEGRWFHFNDSTVTVTDEETVGKAKAYILFY 508          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp3 (ubiquitin specific peptidase 3 [Source:MGI Symbol;Acc:MGI:2152450])

HSP 1 Score: 63.5438 bits (153), Expect = 1.756e-10
Identity = 81/366 (22.13%), Postives = 147/366 (40.16%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAF--QSNLFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVPIIEKSNGKSDKISG--LSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIK-----IDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   ++ +  +  K++         AF  +S  ++ WK     RG  QQD+ E + Y +  ++ EL+     N + +  +  L     +    KCC N                  + + C  +       + L+L +P   +S    ++ +G   S++  +  +     LDETE+  Y+C               + +       +  LP+ +C+HL+R  W      K+   ++     +D K  +    N   P +  + L AV+VH G  +  GHY  Y +   +W+  +DSTV  +D +TV   + YILFY
Sbjct:  117 LRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDSNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQG--GFNGVSR--SAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETEL--YMC-----------HKCKKKQKSTKKFWIQKLPKALCLHLKRFHWTAYLRNKVDTYVQFPLRGLDMKCYLLEPENSG-PDSCLYDLAAVVVHHGSGVGSGHYTAYAVHEGRWFHFNDSTVTVTDEETVGKAKAYILFY 464          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp42 (ubiquitin specific peptidase 42 [Source:MGI Symbol;Acc:MGI:1924050])

HSP 1 Score: 63.929 bits (154), Expect = 2.309e-10
Identity = 83/325 (25.54%), Postives = 133/325 (40.92%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLE-IKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKR--------GQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGY---DIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIE---DYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEI-TYQNNDN-KPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDK-WYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + C+ N+ LQ L     L +     E  K  + E   +   +   IT + S   +  +    IN  +R         Q+D+ E L Y +  + K      N  D        L  +   GY    +KC N   ++      L + + I           +  S+   + +++   +++    Y C  C K             +K+F+   S    TI +     R+ N +  K+   +K  E L+I  Y +  N +PI   + L AV+VH+G N   GHY CY   S+  WY  +DS V  SDI+ V++QQ Y+LFY
Sbjct:  110 AGLQNLGNTCFANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQTHITQALSNPGDVIKPMFVINEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQAT-TLVCQIFGGYLRSRVKCLNCKGVSDTFDPYLDITLEIK----------AAQSVTKALEQFVKPEQLDGENSYKCSKCKKMVPA---------SKRFTIHRSSNVLTISL----KRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPII--YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRAVLNQQAYVLFY 408          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9UUD6|UBP11_SCHPO (Ubiquitin carboxyl-terminal hydrolase 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp11 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.169e-17
Identity = 85/318 (26.73%), Postives = 145/318 (45.60%), Query Frame = 3
Query:  174 SASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFIN---------WKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKW---VNFELPMRFI--MGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQ--QPYILFYE 1079
            S ++C+LN  LQ LA+   L      LEI      S  ++  L + +    S   N      F+N           +  QQD+ E L + +  +  EL+K        KW   ++F +   FI  M   ++CC    I+     A ++ + +  + +G S+    +S+ SL+     E  I DY CD C K+  K+++  S I+   +       P  + + L+RT +    + +   SI    KL +      NK   + + L+++I HSG++ +GHY+CYRL  D W+  +DS + +S +   +SQ     +LFYE
Sbjct:   55 SGNDCFLNCVLQSLASQESL------LEILKLRCSSSTLYATLYELLQKLNSGPGNPITPGSFLNSLEIATNKKLVRSIQQDAQEFLQHLVETL--ELQKPHTY----KWSKVLSFPVDSPFIGTMEQKVQCCQCLAISISYSTATSIQLCLPPEYSGNSN----VSLLSLMEAD-REQHISDYKCDSCFKSSPKHSKT-SCIRTVDWKNP----PTILQIQLERTSYTCQGLTRNNVSISFPSKLIL-----KNK---HHYILRSLITHSGSVTYGHYLCYRLQDDIWWKANDSLITKSSLNEALSQTRSACLLFYE 342          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9W462|UBP30_DROME (Ubiquitin carboxyl-terminal hydrolase 30 homolog OS=Drosophila melanogaster OX=7227 GN=Usp30 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.404e-15
Identity = 71/282 (25.18%), Postives = 115/282 (40.78%), Query Frame = 3
Query:  384 QQDSFEVLTYAISEVYKEL-RKKENVNDIEKWVNF-----ELPMRFIMGYDI---KCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWI-NGSMKKLTDSIKIDEKLEITYQN---------------------NDNKPITNQ---------------FSLKAVIVHSGNIFFGHYVCYRLCS----DKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            QQ   E L   +S   + L R       +  W N        P +  MG  I    C +   +   K  ++ L++P          + +GLS+  L+++Y+   ++ D  CD C       NE  +  K+  F++    LP  +C+H+ RT W+  G + K  D +   E L +   +                     + + P+ N                + L AV+VHSG    GH+V YR  S     +WY+TSD+ V+E  I  V+S   Y+LFY+
Sbjct:  286 QQQQDEGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNLP--------PQRRTGLSLGHLLSEYITSEDLSDVKCDSC-------NETTTHTKSVTFAK----LPACLCIHVARTVWLPTGQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWYYTSDTIVREVSIDEVLSVPAYLLFYD 548          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|E9Q9U0|U17PB_MOUSE (Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.492e-10
Identity = 84/327 (25.69%), Postives = 139/327 (42.51%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLID-----DFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKEL----RKKENVNDIEKWVNFELPMRFIMG----YDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSM-KKLTDSIKIDEKLEITYQNNDNKPITNQ-------FSLKAVIVHSG-NIFFGHY-VCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N+ ++CYLN+ LQ L     L D     +  Q     +  +   +   + +S+  + S  V     NL   + KR Q+D+ E L + +  +++      R+ E  ++         P+  I G      IKC  +H           L +P+          IS  S+QS V + L +TE  + +C + S    +  + K   K  K    L   P+ + + L+R    +GSM KKL   +   E L++       KP  +Q       ++L AV+VH G     GHY  C +    KWY   D+ V   D+ +V+++  Y+LFY
Sbjct:   53 LQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHTHSGDVMKPSQNLTSAFHKRKQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSS------PIHDIFGGWWRSQIKC--HHCQGTSYSYDPFLDIPL---------DIS--SVQS-VKQALQDTEKAEELCGENSYYCGRCRQKKPASKTLK----LYSAPKVLMLVLKR---FSGSMGKKLDRKVSYPEFLDL-------KPYLSQPTGGPLPYALYAVLVHEGATCHSGHYFCCVKAGHGKWYKMDDTKVTSCDVTSVLNENAYVLFY 345          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9SB51|UBP16_ARATH (Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.506e-10
Identity = 50/155 (32.26%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  651 KYLDETEIED----YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVH---SGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE*FYPT 1094
            +    TEI D    Y C  C          KS  +AKK  +I  P P  + + L+R  +  G   KL   I+  E L++    +     ++ + L  VIVH       F GHYVCY    +KWY   DSTV  SD++ ++++  Y+LFY    PT
Sbjct:  709 RRFTRTEILDGENKYRCGSC----------KSYERAKKKLKITEP-PNVLTIALKR--FQAGKFGKLNKLIRFPETLDLAPYVSGGSEKSHDYKLYGVIVHLDVMNAAFSGHYVCYIRNQNKWYKADDSTVVTSDVERILTKGAYMLFYARCTPT 850          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9H9J4|UBP42_HUMAN (Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 1.588e-10
Identity = 82/325 (25.23%), Postives = 132/325 (40.62%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLE-IKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKR--------GQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGY---DIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIE---DYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEI-TYQNNDN-KPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDK-WYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + C+ N+ LQ L     L +     E  K  + E   +   +   IT + S   +  +    IN  +R         Q+D+ E L Y +  + K      N  D        L  +   GY    +KC N   ++      L + + I           +  S+   + +++   +++    Y C  C K    +          + S +L+         L   R+ N +  K+   +K  E L+I  Y +  N +PI   + L AV+VH+G N   GHY CY   S+  WY  +DS V  SDI++V+SQQ Y+LFY
Sbjct:  111 AGLQNLGNTCFANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVINEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQAT-TLVCQIFGGYLRSRVKCLNCKGVSDTFDPYLDITLEIK----------AAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKR----FTIHRSSNVLT---------LSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIV--YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFY 409          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: E9G0U3 (USP domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_307077 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.502e-20
Identity = 88/346 (25.43%), Postives = 158/346 (45.66%), Query Frame = 3
Query:  156 VARLINSASNCYLNSTLQGLAACTQLI---DDFRQ----------LEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWK-KRGQQDSFEVLTYAISEVYKELRKKE------NVNDIEKWVNF-----ELPMRFIMGYDIKC--CNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWIN-GSMKKLTDSIKIDEKLEI---TYQN---NDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCS----DKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            +A L+N  + C++N+TLQ LA+C   I   D   +          LE       ++ + N    +I+          QS     W  K  +QD+ E      + + +E+ KK       +++D +            P R  +   + C  C +  +       L++ +P ++  N      + L++Q L+ ++L    + +  CD+CS T+ K       +  K+ S  L  LP+ +C+H+QR  W N G + K  D +K  E+L +    Y N    + KP+T  + L+AV+ H G    GH+V +R  +     KW++TSD+ ++ + ++ V+   PY+LFYE
Sbjct:   49 LAGLVNEGNTCFINTTLQALASCPIFIWWIDSILEKPSSDAAGNCLETTSSLNLTMAVINNQHPTISADLFNTRQLIQSLEKHGWNLKSEEQDAHEFFNMLFTTIDEEINKKSKIVKGISIDDEQDTTTVCQSISSSPFRGNLASQLCCLTCGHKSVRYDAFECLSIPLPKLDMRNA----FTMLNVQGLLKQFLAAETVGEVQCDNCSVTNGK------IVFMKQLS--LGKLPQCLCLHIQRCDWTNAGQLTKRQDLVKFSEELNVGNVVYTNRLSGNLKPVT--YRLRAVVEHLGMADSGHFVTFRRNAVDGRAKWFYTSDTYIRTATLEEVLKSSPYMLFYE 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A067RGY8 (Ubiquitin carboxyl-terminal hydrolase 30 OS=Zootermopsis nevadensis OX=136037 GN=L798_15182 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 9.822e-19
Identity = 90/388 (23.20%), Postives = 163/388 (42.01%), Query Frame = 3
Query:  156 VARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKS---ITGSKSAKVNAFQSNLFI------NWK-KRGQQDSFEVLTYAISEVYKELRKK------------ENVNDIEK---------------W----VNFELPMRFIMGYDIKCCN---NHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDE--------------------KLEITYQNNDNKPITNQ----------FSLKAVIVHSGNIFFGHYVCYRLCSDK----WYFTSDSTVKESDIKTVMSQQPYILFYE*F 1085
            V  L+N    C+LN+ LQ LA+C  ++D       K+QN  + K F   L++   +   K    + +  +  I       W    G+QD+ E+    ++ + +E+++K            + + +I++               W    +   LP + +    ++C +      +      +L+L +P      G  D+    ++Q L+  Y+    + D  CD C   D+      +++K+  F +    LPR +C+H+ RT W  G   K  D I+  E                    KL++  Q+  N  I +           + L AV+VH G++F+GH++ YR    K    W++TSD+ V+E+ +  VM    Y+LFY  F
Sbjct:   39 VLGLVNLGYTCFLNTLLQALASCPVVLDWLS----KHQNSANKKSFIAALQNTLQVLNGKEGSEDPYTPSKLIQSLHGHGWIISPGEQDAHELFLVIVTTLEEEVQQKLPKVCSLSAAVEDGLREIQQHGLQATLLSPKPSSWWQEAKLKGPLPFQGLFASQLQCMSCKYKSAVHYATFYSLSLVLPPRLSVLGTMDEF--YTLQELIGHYVTSRVVNDVTCDGCGCRDT------AQVKSLNFGK----LPRCLCIHIARTIW-EGEPLKRDDHIRFPEILVMDPYTYNYIQQTQLSNSKLQVGDQSCTNGLINSSSLTRKRFRHLYQLTAVVVHKGSLFYGHFITYRRGVGKYYNSWFYTSDAEVRETTLHEVMQASAYMLFYTKF 409          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A0P5ZGD0 (Ubiquitin carboxyl-terminal hydrolase OS=Daphnia magna OX=35525 GN=APZ42_024076 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.707e-18
Identity = 87/348 (25.00%), Postives = 154/348 (44.25%), Query Frame = 3
Query:  156 VARLINSASNCYLNSTLQGLAACT---QLIDDF---RQLEIKYQNIESLKIFNKLLKSITGSK-SAKVNAFQSNLFI------NWK-KRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWV-------------NFELPMRFIMGYDIKC--CNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWIN-GSMKKLTDSIKIDEKLEI---TYQN---NDNKPITNQFSLKAVIVHSGNIFFGHYVCYRL----CSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            ++ LIN  + C++N+TLQ LA+C      ID     +  +I    + +    N  +  I     +  V+ F S   I       W  K  +QD+ E      + + +E+ K    N I K +             N   P R  +   + C  C +  +       L++ +P ++  N      + L+++ L+ ++L    + +  CD CS  + K+      +  K+ S  L  LP+ +C+H+QR  W N G + K  D ++  E+L +    Y N    + KP+T  + L+AV+ H G    GH+V +R        +W++TSD+  + +    V+   PY+LFYE
Sbjct:   49 LSGLINEGNTCFINATLQALASCPIFFNWIDSVLTRKTSDITEHYLRTTCSLNMTMAVINNQHPTIDVHTFNSRQLIQSLEKHGWNLKSEEQDAHEFFNMLSTTIDEEINKN---NKISKGISIDEQATTSVCQPNSSSPFRGYLASQLCCLSCGHKSVRYDAFECLSIPLPKLDVRNA----FTMLNVEGLLKQFLAAETVGEVQCDSCSLKNGKS------VFLKQLS--LGKLPQCLCLHIQRCDWTNAGQLTKRQDLVRFSEELNVGNFVYTNRLSGNFKPVT--YRLRAVVEHLGMADSGHFVTFRRNIVDGRTRWFYTSDTFTRTATFDEVLKSSPYMLFYE 379          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0EB12 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00025213001 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.675e-15
Identity = 96/330 (29.09%), Postives = 150/330 (45.45%), Query Frame = 3
Query:  147 KMYVARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQS---NLFINWKKRGQQDSFEVLTYAISEVYKEL----RKKENVNDIEK-WV-----NFELPMRFIMGYDI-----KCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIED-YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            ++ +  L N    CYLNS LQ L +   L +    ++ K Q  + L  + +LL++I  S S    A QS   N    ++   QQDS E L + + ++ +EL    + K+  N  E+ W      N+++      G        K CN        QV    + PI + S   S   +G+ +   +  Y  E  I D + CD C KT      NKS +K + F   +S  P+ + +  +R      S +K+ DSI   EKL+I  Q   +K +  ++ LKA+I H G+I  GHY  Y    D WY   D TV + + K +  +  Y+L Y+
Sbjct:  263 QLPIVGLRNPRYYCYLNSALQVLLSIDSLSEGILAVQPK-QGQKYLVAYQELLRTIKRSGSFSAIAAQSVWENCSGKFQFNQQQDSHEFLLFFLGKIQEELVGKYKNKQEFNSAEQAWSDYTSKNYDIVDTIFAGQSTSQSFCKSCN--------QVCEG-YDPIWDLSLPISKSYTGVDLMDCLKSYYREEVINDTWKCDKCKKT------NKS-VKRRMF---ISQTPKYLIIQFKRFTTFPTS-QKINDSISYPEKLDI--QEFCSKGLQTKYKLKALITHMGSINGGHYKAYAERYDNWYLFDDETVSKINGKQLSDRSAYVLLYQ 569          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: E7EYZ1 (Ubiquitin-specific peptidase 18 OS=Danio rerio OX=7955 GN=usp18 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.917e-14
Identity = 86/328 (26.22%), Postives = 142/328 (43.29%), Query Frame = 3
Query:  156 VARLINSASNCYLNSTLQGLAACTQLIDDFRQLE----IKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKR-GQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIE---DYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITY------QNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDK-WYFTSDSTVKESDIKTVMS-----QQPYILFY 1076
            V  L N   +C +N+ LQ  +A T+L+D   +      I+  NI  L++ N LL     S SA    F   L+ +   R  QQD+ E+    ++   K++   E   +I      E+  +      + C +   I        +L + I E  N         +++S +  +  + ++E    + CD C K            +   + Q L  LP+ +CVHL+R R  +G +KKL   +   E L+I+       +N  +      +SL AVIVH G+  FGHY  + R   D+ WY+ +DS V ++  K V       +  Y+L Y
Sbjct:   28 VRGLFNDGLSCCVNALLQSFSATTELLDILNKWNPSDGIEQSNI-PLQLRNTLLSVRDPSHSAPHKGFLDCLYRHAICRYTQQDADEIFHMILNLSLKQMPDHELAQEIRSLYTIEVETQ------VTCMDCTFIHRLPNSYFSLPLVIHEGEN---------TLESCIKSFFKKQKLEVSEKFFCDRCEKK-----------QPCAYEQKLVSLPQILCVHLKRFRNEHGLIKKLDSKVTFPETLKISVFAAGQSENAASDSPQADYSLFAVIVHIGSAMFGHYTAFIRQTQDQMWYYANDSRVNQATWKDVQDTYKGRETAYLLLY 328          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp3 (ubiquitin specific peptidase 3 [Source:NCBI gene;Acc:103025074])

HSP 1 Score: 70.4774 bits (171), Expect = 7.530e-13
Identity = 91/379 (24.01%), Postives = 148/379 (39.05%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSN--LFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMG------YDIKCCNN------------------HVIACPKQ-------VALALHVPIIEKSNGKSDKISG---------LSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNK----------PITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L    +    F+ L                  + Q   S+ +  +L K++         AF  +   ++ WK     RG  QQD+ E L Y +  +++E++  +N           LP   ++        + KCC N                  + + C  +       + L+L +P   +     D+  G         LS   L  + LDETE+  Y+C  C          K +   KKF   +  LP+ +C+HL+R  W    ++      K+D  +E   +  D K          P +  ++L AV+VH G  +  GHY  Y L   +WY  +DSTV     +TV   + YILFY
Sbjct:  111 LRNLGNTCFMNAILQSLRNIPEFSCYFKDLPAVALRSGKTAGRRMYHTRSQGDTSVSLVEELRKTLCSLWQGNQTAFSPDALFYVIWKIMPSFRGYQQQDAHEFLRYLLDHLHREMQGSKN----------GLPGPSLLSDRPNPTSEGKCCINGTPTVVTSVFSGVLQNEVNCLICGTESRKFDPFLDLSLDIPSQFRVKRTKDQEPGPTCNLYHCLLSFTDL--EELDETEL--YMCHKC---------KKRQKSTKKF--WVQKLPKVLCLHLKRFHW-TAFLRN-----KVDTYVEFPLRGLDMKRFLLEPENSLPESGLYNLAAVVVHHGSGVGSGHYTAYGLHEGRWYHFNDSTVTLVSEETVTKAKAYILFY 458          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp3 (ubiquitin specific peptidase 3 [Source:NCBI gene;Acc:103025074])

HSP 1 Score: 70.4774 bits (171), Expect = 9.405e-13
Identity = 91/373 (24.40%), Postives = 148/373 (39.68%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSN--LFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVPIIEKSNGKSDKISG---------LSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNK----------PITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L    +    F+ L                  + Q   S+ +  +L K++         AF  +   ++ WK     RG  QQD+ E L Y +  +++E++  +N       ++ + P     G   KCC N                  + + C  +       + L+L +P   +     D+  G         LS   L  + LDETE+  Y+C  C          K +   KKF   +  LP+ +C+HL+R  W    ++      K+D  +E   +  D K          P +  ++L AV+VH G  +  GHY  Y L   +WY  +DSTV     +TV   + YILFY
Sbjct:  160 LRNLGNTCFMNAILQSLRNIPEFSCYFKDLPAVALRSGKTAGRRMYHTRSQGDTSVSLVEELRKTLCSLWQGNQTAFSPDALFYVIWKIMPSFRGYQQQDAHEFLRYLLDHLHREMQGSKNGLPGPSLLS-DRPNPTSEG---KCCINGTPTVVTSVFSGVLQNEVNCLICGTESRKFDPFLDLSLDIPSQFRVKRTKDQEPGPTCNLYHCLLSFTDL--EELDETEL--YMCHKC---------KKRQKSTKKF--WVQKLPKVLCLHLKRFHW-TAFLRN-----KVDTYVEFPLRGLDMKRFLLEPENSLPESGLYNLAAVVVHHGSGVGSGHYTAYGLHEGRWYHFNDSTVTLVSEETVTKAKAYILFY 507          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp30 (ubiquitin specific peptidase 30 [Source:NCBI gene;Acc:103037211])

HSP 1 Score: 62.003 bits (149), Expect = 3.974e-10
Identity = 52/253 (20.55%), Postives = 98/253 (38.74%), Query Frame = 3
Query:  564 ALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKF-SQI-LSPLPRTICVHLQRTRW-INGSMKKLTDSIKIDEKLEI----------------------------------------TYQNNDNKPITNQ----------------------------FSLKAVIVHSGNIFFGHYVCYRLC----------SDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            +L+L +P ++           +++   +  ++    I++  C++C+KT +    N  E +   F  Q+ L  LP+ +C+HLQR  W   G+  K  + ++  E L +                                           +N+NKP++N                             F L AV+VH G++  GH++ YR            S +W + SD +V+++ ++  +S   Y+LFYE
Sbjct:  220 SLSLSIPAVQWGRP-------VTLDQCLQHFISSETIKEVECENCTKTQTGELVNGQESQRTTFIKQLKLGKLPQCLCIHLQRLTWSTEGTPIKRQEHVQFSEYLSMDRYKHCSAAQRLQKPSRANKPSSTGATADAHDQTVANGLDPEHHNNNKPLSNGAFPSVFIHSPSLSPQLNLTCDYSSSEYLFRLTAVLVHHGDMHSGHFITYRRGPPSPRSTAPFSPQWLWVSDDSVRKASLQEALSSSAYLLFYE 465          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000052072.1 (ubiquitin carboxyl-terminal hydrolase 17-like protein 13 [Source:NCBI gene;Acc:111194559])

HSP 1 Score: 62.003 bits (149), Expect = 5.251e-10
Identity = 86/322 (26.71%), Postives = 142/322 (44.10%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLIDDFRQLE-----IKYQNIESLKIFNKLLKSITGSKSAKVNA---FQSNLFINWKKRGQQ-DSFEVLTYAISEVYKELRKKENVNDIEKWVN--FELPMRFIMGYDIKC--CNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIED-YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSD-KWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            A L N  + C++NS LQ L+    L +     E      +Y    S  + N +  +I  S +A V A    Q NL       GQQ D+ E L Y +  + +     + +      +N  FE  MR      +KC  C +        + +AL +       G  D      +   + +++   ++ D Y C  C  T   +      +   + S +L     TIC  L+R  + NG  +K++  +K  + L++    ++++  +  + L AV+VH+G N  FGHY CY   SD KWY   D  V  +D ++V++QQ Y+LFY
Sbjct:   22 AGLWNVGNTCFMNSVLQCLSYTAPLANYMLSGEHLRTCSRYSFCMSCTLQNHITHTIMNSGTAIVPASVVTQLNLIGEQFCFGQQEDAHEFLRYTVRALQQSYPDGKMLGRETNLINQIFEGCMR----SRVKCLNCKSDSDTFEPYMDVALDI------TGAKD------LNESLQRFVKPEQLSDGYKCTRCMVTSPASKT----LTIHRSSNVL-----TIC--LKRFDF-NG--QKISTLVKYPKHLDMRPFMSESEGESQVYKLYAVLVHAGYNRHFGHYYCYVKASDRKWYKMDDKQVSVADERSVLNQQAYMLFY 313          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:103036803])

HSP 1 Score: 58.9214 bits (141), Expect = 5.089e-9
Identity = 45/181 (24.86%), Postives = 78/181 (43.09%), Query Frame = 3
Query:  567 LALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIED--YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMK-KLTDSIKIDEKLEITY-----QNNDNKPITNQFSLKAVIVHSGNIFF-GHYV--CYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L+L  P    SN K        +  ++ K+ +   +E   Y CD C+    +    +  +   +   ++  LP  + +HL+R RW   + + K+   +K +++L +        N   +P    + L AV++H G  F  GHY   CY      W   +DS +    ++ V   Q YILFY
Sbjct:  497 LSLEFPERYHSNSKDAAQVPCGLTEMLAKFTETEALEGAIYACDHCNNKRRRFCSKQVVLTEAQKQLMVYKLPHVLRLHLKRFRWSGRNHREKIGVHVKFEQELNMEPYCCKDSNTSPRPQHFLYQLSAVVMHHGKGFGSGHYTAFCYNTEGGFWVHCNDSKLSVCAVEEVCKAQAYILFY 677          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp3 (ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5142])

HSP 1 Score: 56.9954 bits (136), Expect = 1.724e-9
Identity = 37/114 (32.46%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  774 LPRTICVHLQRTRW-----------INGSMKKL-TDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            LP  +C+HL+R  W           +   +K L   S  ++EK E    +N     ++ + L AV+VH G  +  GHY  Y   +  W+  +DSTV  S+  TV   + YILFY
Sbjct:  150 LPAVLCLHLKRFHWTAYMRNKIDTYVEFPLKGLDVKSFLLEEKGEPPGSSNS----SSLYDLAAVVVHHGSGVGSGHYTAYAAHNGLWFHFNDSTVTRSEEDTVARAKAYILFY 259          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001070.1 (pep scaffold:Pmarinus_7.0:GL491036:3110:6028:-1 gene:ENSPMAG00000000961.1 transcript:ENSPMAT00000001070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.551e-8
Identity = 47/171 (27.49%), Postives = 76/171 (44.44%), Query Frame = 3
Query:  612 DKISGLSIQSLVNKYLDETEIED----YVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMK-KLTDSIKIDEKLEIT-YQNNDNKPI-------TNQFSLKAVIVHSGNIFF-GHYV--CYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            D   G ++  ++ K+  ETE  D    Y CD C       NE + ++       ++  LPR + +HL+R RW   + + K+   +  +++L +T Y + D            + + L AV++H G  F  GHY   CY      W   +DS +    +  V   Q YILFY
Sbjct:   56 DTNGGCTLTEMLAKF-TETEALDGGKVYSCDTC-------NEAQKQL-------LVHRLPRVLRLHLKRFRWSGRNHREKIGVHVAFEQRLCMTPYCSRDGGSGSGSGGADPSTYDLSAVVMHHGRGFGSGHYTAYCYNAEGGFWVHCNDSRLDVVSVAEVCRAQAYILFY 211          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 50.0618 bits (118), Expect = 5.730e-7
Identity = 31/117 (26.50%), Postives = 55/117 (47.01%), Query Frame = 3
Query:  774 LPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEIT--------------YQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            LP   C HL+R        +K++  +    +L++T              YQ  ++    N++SL AV+ H G +  GHY  + RL  D+W+   D+ +  + +  V+  + Y+LFY 
Sbjct:  355 LPIVACFHLKRFEHSARLRRKISTYVSFPLELDMTPFMNSSKDSRVNGQYQTGEST-NENKYSLFAVVNHQGTLESGHYTSFIRLHRDQWFKCDDAVITHASVTDVLDSEGYLLFYH 470          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 48.9062 bits (115), Expect = 7.767e-7
Identity = 32/118 (27.12%), Postives = 53/118 (44.92%), Query Frame = 3
Query:  774 LPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEIT--------------YQ-NNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            LP   C HL+R        KK+T  +    +L++T              +Q   D     N++SL AV+ H G +  GHY  + R   D+W+   D+ +  +  + V+  + Y+LFY 
Sbjct:  141 LPIVACFHLKRFEHSAKLRKKITTYVSFPLELDMTPFMASSKESRVNGQHQVGGDALSSENKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITHAGARDVLDSEGYLLFYH 258          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010866.1 (pep scaffold:Pmarinus_7.0:GL477036:107271:109164:1 gene:ENSPMAG00000009846.1 transcript:ENSPMAT00000010866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 1.601e-6
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  864 KLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            + E +  +++ KPI   + L A+  HSG +  GHYV Y R  + KWY  +DS+ KE     + +   Y+LFYE
Sbjct:    1 ETETSEDSDETKPI---YDLYAISCHSGIMGGGHYVTYARNPNTKWYCYNDSSCKEVHEDEIDTDSAYLLFYE 70          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP16 (Deubiquitinating enzyme anchored to the outer mitochondrial membrane; probably not important for general mitochondrial functioning, but may perform a more specialized function at mitochondria [Source:SGD;Acc:S000005993])

HSP 1 Score: 47.3654 bits (111), Expect = 2.789e-6
Identity = 37/129 (28.68%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  612 DKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQ-ILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEIT-YQNNDNKPITN----QFSLKAVIVHSGNIFFGHYVCYR 980
            D++   + ++ +N+ L   E+E YV     K  SK N   S IK K   + ++  LP  + VHL R+ +   +  +   ++K  E++ ++ Y   ++  IT     +++LK+V+ H+G+   GHY+CYR
Sbjct:  290 DRLKNYATKAPINENLP-FEVEQYV-----KRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVKYNLKSVVKHTGSHSSGHYMCYR 412          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP1 (Ubiquitin-specific protease; removes ubiquitin from ubiquitinated proteins; cleaves at the C terminus of ubiquitin fusions irrespective of their size; capable of cleaving polyubiquitin chains [Source:SGD;Acc:S000002280])

HSP 1 Score: 46.2098 bits (108), Expect = 6.603e-6
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  900 PITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQP-YILFYE 1079
            P+T  +SL++VIVH G   +GHY+ +R     W+  SD TV   D   V+S    ++LFYE
Sbjct:  678 PLT--YSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYE 736          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO32736 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SU92])

HSP 1 Score: 59.3066 bits (142), Expect = 9.399e-10
Identity = 39/118 (33.05%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  729 KSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            K ++ A K   I  P P  + + L+R  + +    K++  I   E L++     + K    ++ L  V+VHSG +   GHY CY R  +D WY  +DS V++  + TV++QQ Y+LFY
Sbjct:  277 KKKVPAHKQVLIHRP-PNILTIQLKRFDYHHMFGGKVSKEITYTEHLDLRPFMTNPKGPPLKYKLYGVLVHSGYSCNSGHYYCYVRGSNDCWYNMNDSMVRQVGLNTVLAQQAYLLFY 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44586 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVJ3])

HSP 1 Score: 54.299 bits (129), Expect = 4.311e-8
Identity = 62/284 (21.83%), Postives = 112/284 (39.44%), Query Frame = 3
Query:  159 ARLINSASNCYLNSTLQGLAACTQLI---DDF--RQLEIKYQNIESLKIFNKLLKSI---------TGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMG----------YDIKCCNNHV----------------IACPKQV----ALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMK-KLTDSIKIDEKLEI 875
            A L N  + C++NS LQGLA+    +   D+F  R+ ++        +   +L+K +           S    + A Q + ++      QQD+FE      S + +EL +   + D     + E     + G          Y  +C   HV                  CP +     +++L +P+  +         GLS++ L+ K++    ++   C  C    S+N    S IK     +    LP+ +C+H++RT W N  M  K+   ++  E L +
Sbjct:   10 AGLYNLGNTCFMNSVLQGLASIASFVSWTDEFTWRKEQLNQDGNLLGEAIVELMKELNIEWNEDDAVLSAGPIIQALQHHGWV--IPSNQQDAFEFFQVLSSTLEEELGELSAILDFSSITSVEKSKGGLDGSVRHRISRVSYGRRCVKKHVPFRGLLASQLVCKECRFKCPVKFDGFDSISLSLPMTLQV--------GLSLEDLLQKFVCSESVDSVECKGCGNLGSENTNKSSFIKRLTVGK----LPQCLCIHVKRTYWHNNGMPYKINTFVRFGEYLNL 279          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37466 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SFT1])

HSP 1 Score: 52.373 bits (124), Expect = 1.776e-7
Identity = 43/155 (27.74%), Postives = 69/155 (44.52%), Query Frame = 3
Query:  666 TEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKID-EKLEIT------YQNNDNKPITNQFSLKAVIVHSGN-IFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE*FYPTFTCI 1106
             E E Y+C  C          K E   KKF   +  LP  +C+HL+R R+      K+   ++     L+++       +  + KP+   + L AV+VH G+ +  GHY  +      WY  +DS+V   D + V   + YI FY   +P  + I
Sbjct:  306 AESELYMCLKC---------KKKEQSTKKF--WIQRLPNVLCLHLKRFRFQAFLRSKIDTYVQFPIRGLDMSPYTLKGQEKGETKPVL--YDLAAVVVHHGSGVSAGHYTTFAFHDGAWYNFNDSSVSRIDEEMVAKCKGYIFFYTRRHPDLSII 447          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO42651 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7S0W3])

HSP 1 Score: 51.6026 bits (122), Expect = 3.168e-7
Identity = 34/126 (26.98%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  705 TDSKNNENKSEIKAKKFSQI-LSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            ++SK   NK +   +   Q+ +  LP  +C HL+R      S KK++  I   ++L++         +++++SL AV+ HSG +  GHY  +    + W+   D+ + ++ I  V+  + Y+LFY 
Sbjct:  337 SESKIKCNKCQSYQESTKQLSMRKLPIVVCFHLKRFEHSKKS-KKISTYIPFPQELDMA------PFLSSKYSLFAVVNHSGTLEVGHYTAFIRQQNNWFKCDDAWITKATIDDVLQSEGYLLFYH 455          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO29579 (Battenin [Source:UniProtKB/TrEMBL;Acc:A7T389])

HSP 1 Score: 48.1358 bits (113), Expect = 3.697e-6
Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  846 SIKIDEKLEITYQNNDNK------------PITNQFSLKAVIVHSGNIFF-GHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            SI I EK+  T + ND K               + ++LKA +VHSG     GHYV Y L   +W+   D+ V+   +  V++ + YIL YE
Sbjct:  153 SISITEKVSFTGRQNDPKNNRRAKMSARTSEKKSSYALKAFLVHSGTTCMNGHYVTYCLKDRQWFRLDDAIVQLVLLAQVLASRAYILLYE 243          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 65.4698 bits (158), Expect = 4.700e-11
Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 3
Query:  798 LQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L   R+ N +  K+T  +K  E L++    + ++     + L AV+VHSG +   GHY CY +  + +WY  +DS+V  SDI++V++QQ Y+LFY
Sbjct:  299 LSLKRFANFTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFY 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp3 (ubiquitin specific peptidase 3 [Source:NCBI gene;Acc:101173543])

HSP 1 Score: 65.0846 bits (157), Expect = 5.874e-11
Identity = 84/365 (23.01%), Postives = 148/365 (40.55%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSN--LFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVP--IIEKSNGKSDKISGLSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEK-LEIT---YQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   S+ +  +  K++         AF  +   +  WK     RG  QQD+ E + Y +  +++EL+   N       V+ +  +R +   + KCC N                  + + C  +       + L+L +P    +K +   +     +++  +  +     LDETE+  Y C  C          K +   KKF   +  LP+ +C+HL+R  W      K+   ++   K L++     +  ++ P +  + L AV+VH G  +  GHY  Y      WY  +DSTV  ++  TV   + YILFY
Sbjct:  117 LRNLGNTCFMNAILQSLSNIEQFSCYFKELPAVALRSGKTAGRRMYHTRSQGDNSVSLVEEFRKTLCSLWQGNQTAFSPDSLFYAIWKIMPSFRGYQQQDAHEFMRYLLDHLHRELQYSRN--GASHPVSPQDGVR-LSSAEGKCCTNGAPSVVTSIFGGLLQNEVNCLICGTESRKFDPFLDLSLDIPSQFRQKRSKDQEPSPTCTLRDCLYSFTDLEELDETEL--YYCHKC---------KKRQKSTKKF--WIHNLPKVLCLHLKRFHWTAFLRNKIDTYVEFPLKGLDMRGYLLEPENSLPGSCLYDLVAVVVHHGSGVGSGHYTAYGSHEACWYHFNDSTVTLTNEDTVRKAKAYILFY 465          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp3 (ubiquitin specific peptidase 3 [Source:NCBI gene;Acc:101173543])

HSP 1 Score: 64.6994 bits (156), Expect = 6.908e-11
Identity = 84/365 (23.01%), Postives = 148/365 (40.55%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSN--LFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVP--IIEKSNGKSDKISGLSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEK-LEIT---YQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   S+ +  +  K++         AF  +   +  WK     RG  QQD+ E + Y +  +++EL+   N       V+ +  +R +   + KCC N                  + + C  +       + L+L +P    +K +   +     +++  +  +     LDETE+  Y C  C          K +   KKF   +  LP+ +C+HL+R  W      K+   ++   K L++     +  ++ P +  + L AV+VH G  +  GHY  Y      WY  +DSTV  ++  TV   + YILFY
Sbjct:  162 LRNLGNTCFMNAILQSLSNIEQFSCYFKELPAVALRSGKTAGRRMYHTRSQGDNSVSLVEEFRKTLCSLWQGNQTAFSPDSLFYAIWKIMPSFRGYQQQDAHEFMRYLLDHLHRELQYSRN--GASHPVSPQDGVR-LSSAEGKCCTNGAPSVVTSIFGGLLQNEVNCLICGTESRKFDPFLDLSLDIPSQFRQKRSKDQEPSPTCTLRDCLYSFTDLEELDETEL--YYCHKC---------KKRQKSTKKF--WIHNLPKVLCLHLKRFHWTAFLRNKIDTYVEFPLKGLDMRGYLLEPENSLPGSCLYDLVAVVVHHGSGVGSGHYTAYGSHEACWYHFNDSTVTLTNEDTVRKAKAYILFY 510          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp3 (ubiquitin specific peptidase 3 [Source:NCBI gene;Acc:101173543])

HSP 1 Score: 64.6994 bits (156), Expect = 7.564e-11
Identity = 84/365 (23.01%), Postives = 148/365 (40.55%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQL----------------EIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSN--LFINWKK----RG--QQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNN------------------HVIACPKQ-------VALALHVP--IIEKSNGKSDKISGLSIQSLVNKY-----LDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEK-LEIT---YQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            L N  + C++N+ LQ L+   Q    F++L                  + Q   S+ +  +  K++         AF  +   +  WK     RG  QQD+ E + Y +  +++EL+   N       V+ +  +R +   + KCC N                  + + C  +       + L+L +P    +K +   +     +++  +  +     LDETE+  Y C  C          K +   KKF   +  LP+ +C+HL+R  W      K+   ++   K L++     +  ++ P +  + L AV+VH G  +  GHY  Y      WY  +DSTV  ++  TV   + YILFY
Sbjct:  134 LRNLGNTCFMNAILQSLSNIEQFSCYFKELPAVALRSGKTAGRRMYHTRSQGDNSVSLVEEFRKTLCSLWQGNQTAFSPDSLFYAIWKIMPSFRGYQQQDAHEFMRYLLDHLHRELQYSRN--GASHPVSPQDGVR-LSSAEGKCCTNGAPSVVTSIFGGLLQNEVNCLICGTESRKFDPFLDLSLDIPSQFRQKRSKDQEPSPTCTLRDCLYSFTDLEELDETEL--YYCHKC---------KKRQKSTKKF--WIHNLPKVLCLHLKRFHWTAFLRNKIDTYVEFPLKGLDMRGYLLEPENSLPGSCLYDLVAVVVHHGSGVGSGHYTAYGSHEACWYHFNDSTVTLTNEDTVRKAKAYILFY 482          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 65.0846 bits (157), Expect = 7.837e-11
Identity = 34/91 (37.36%), Postives = 56/91 (61.54%), Query Frame = 3
Query:  810 RWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSG-NIFFGHYVCY-RLCSDKWYFTSDSTVKESDIKTVMSQQPYILFY 1076
            R+ N +  K+T  +K  E L++    + ++     + L AV+VHSG +   GHY CY +  + +WY  +DS+V  SDI++V++QQ Y+LFY
Sbjct:  320 RFANFTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFY 410          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039982.1 (SMESG000039982.1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 309/310 (99.68%), Postives = 309/310 (99.68%), Query Frame = 3
Query:  150 MYVARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            MYVARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFN LLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE
Sbjct:    1 MYVARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNNLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 310          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039981.1 (SMESG000039981.1)

HSP 1 Score: 213.386 bits (542), Expect = 1.425e-65
Identity = 119/331 (35.95%), Postives = 189/331 (57.10%), Query Frame = 3
Query:  153 YVARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRK-KENVNDIE-----KWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVC--DDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQN--------------NDNKPITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            + + L N  +NCYLNS LQ +++ +  +D   QL   Y ++E L+ F  L+++I        +  +  +F NW K GQQD FE+L+Y +++VY E+RK KE +N+IE     +W+N  LPMR I+ Y I+C   +++  P    LALHVPII      SDK   + +QSLV+++L + EI +Y C  + C KT           KA + ++++ PLP TIC+HLQRT W   +MKK+       E L++  +N              ND +   +++ L + IVH G++  GHYVCY+   ++W+ T+D+ VK  ++  +++ Q Y+LFYE
Sbjct:   30 FPSPLRNIGTNCYLNSVLQAISSSSAFVDGIVQLHENYGSLEKLEFFTDLIQNIHSGNQNLKDISKHQIFKNWNKSGQQDCFELLSYVLNQVYSEIRKYKETMNEIETKNLLEWLNQSLPMRIIVSYTIRCECGNLVDVPLHSELALHVPII------SDKKQPIELQSLVDQFLGDNEITNYECYSNKCIKT-----------KALRETKLVKPLPNTICLHLQRTFWNGKTMKKIDKIFAETENLDLFVRNYVETIIETSVKAIQNDCEVYGDEYRLTSFIVHRGSVKGGHYVCYKSMRNRWFLTNDNQVKPVELHKILNCQAYLLFYE 343          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039986.1 (SMESG000039986.1)

HSP 1 Score: 207.994 bits (528), Expect = 6.386e-59
Identity = 117/315 (37.14%), Postives = 180/315 (57.14%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDD--CSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWI-NGSMKKLTDSIKIDEKLEIT-----YQNNDNKPITNQFS--LKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            LIN  +NCYLNS LQ ++AC+  + D    ++K  N   LK  N L+K +       V+  +  +F  W K GQQDSFE+L + +++VYKE +K   +N+++ W+  +LPMR I+ + I CC+ +      Q  +ALH+ I  + N +SD I    +Q L++ Y  +  IED++C++  C  T            AKK  ++  PLP TIC+HLQR  +  +  MKK+ D +K +EK+ I        +N    + N++   LK+VI H GN  FGHY+CY+  ++ W++TSDS + + DI  V + Q YILFYE
Sbjct:   78 LINYGANCYLNSGLQAISACSNFVKDLNDCQMKNPNFPKLKTLNNLIKILCYGNKKYVDLSRDEIFAGWNKTGQQDSFELLAFIVNQVYKEFKK---LNEVDDWLKVQLPMRIILEHHITCCSKYGGHNVMQSEIALHITI--RKNQRSDPI---ILQDLIDFYFKKELIEDFICEESKCPGTS-----------AKKQIKLCLPLPNTICIHLQRLHYTADNIMKKVEDKVKFEEKIIIRKAFCKRSDNSFSELLNEYDYHLKSVIAHYGNASFGHYICYKKFNNSWFYTSDSFIYKEDIDHVFNCQAYILFYE 373          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039986.1 (SMESG000039986.1)

HSP 1 Score: 207.608 bits (527), Expect = 7.973e-59
Identity = 115/315 (36.51%), Postives = 179/315 (56.83%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKKENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKSNGKSDKISGLSIQSLVNKYLDETEIEDYVCDD--CSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWI-NGSMKKLTDSIKIDEKLEIT-----YQNNDNKPITNQFS--LKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            LIN  +NCYLNS LQ ++AC+  + D    ++K  N   LK  N L+K +       V+  +  +F  W K GQQDSFE+L + +++VYKE +K   +N+++ W+  +LPMR I+ + I CC+ +      Q  +ALH+ I +    ++D I    +Q L++ Y  +  IED++C++  C  T            AKK  ++  PLP TIC+HLQR  +  +  MKK+ D +K +EK+ I        +N    + N++   LK+VI H GN  FGHY+CY+  ++ W++TSDS + + DI  V + Q YILFYE
Sbjct:   78 LINYGANCYLNSGLQAISACSNFVKDLNDCQMKNPNFPKLKTLNNLIKILCYGNKKYVDLSRDEIFAGWNKTGQQDSFELLAFIVNQVYKEFKK---LNEVDDWLKVQLPMRIILEHHITCCSKYGGHNVMQSEIALHITIRKNQRSETDPI---ILQDLIDFYFKKELIEDFICEESKCPGTS-----------AKKQIKLCLPLPNTICIHLQRLHYTADNIMKKVEDKVKFEEKIIIRKAFCKRSDNSFSELLNEYDYHLKSVIAHYGNASFGHYICYKKFNNSWFYTSDSFIYKEDIDHVFNCQAYILFYE 375          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039999.1 (SMESG000039999.1)

HSP 1 Score: 162.54 bits (410), Expect = 1.740e-44
Identity = 94/254 (37.01%), Postives = 144/254 (56.69%), Query Frame = 3
Query:  165 LINSASNCYLNSTLQGLAACTQLIDDFRQLEIKY-QNIESLKIFNKLLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRK---------KENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHV--PIIEKSNGKSD-----KISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAKKFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEI 875
            L+N  +NCYLNS  QG+++C + + D   L  KY   +E L +F +L+  + G KS  +   ++ +F NW K GQQDSFE+L + +++VY ++RK         K+N   I++W+  ELPMR I+ Y+I C    +I  P Q  LALHV  P+    N   D      I G ++Q LVN + +   IEDY C +    D K+        A +++++++PLPRT+C+HLQ+T W    M+K+T  IK   +L I
Sbjct:   21 LLNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGEKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKN---IQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDC-ETEGCDGKS--------AFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNI 262          

HSP 2 Score: 64.6994 bits (156), Expect = 4.874e-11
Identity = 27/58 (46.55%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  906 TNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVMSQQPYILFYE 1079
            T  + L +VIVH G ++ GHYVCYR  + +WY T+DS+V     + V++ + YILFYE
Sbjct:  494 TENYLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSVYPVREEDVLNSEAYILFYE 551          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP423.303e-1125.23ubiquitin specific peptidase 42 [Source:HGNC Symbo... [more]
USP421.012e-1042.27ubiquitin specific peptidase 42 [Source:HGNC Symbo... [more]
USP421.013e-1042.27ubiquitin specific peptidase 42 [Source:HGNC Symbo... [more]
USP32.006e-1022.13ubiquitin specific peptidase 3 [Source:HGNC Symbol... [more]
USP32.181e-1022.13ubiquitin specific peptidase 3 [Source:HGNC Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp-35.556e-921.62Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;... [more]
Y67D2.23.549e-639.68Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
usp-338.903e-627.39Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
cyk-39.005e-629.52Ubiquitin carboxyl-terminal hydrolase cyk-3 [Sour... [more]
cyk-39.490e-629.52Ubiquitin carboxyl-terminal hydrolase cyk-3 [Sour... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp301.311e-1625.18gene:FBgn0029819 transcript:FBtr0343537[more]
Usp301.311e-1625.18gene:FBgn0029819 transcript:FBtr0070828[more]
Usp20-331.422e-929.25gene:FBgn0033916 transcript:FBtr0087535[more]
not5.854e-630.70gene:FBgn0013717 transcript:FBtr0346438[more]
not5.854e-630.70gene:FBgn0013717 transcript:FBtr0290259[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp182.197e-1726.22ubiquitin specific peptidase 18 [Source:ZFIN;Acc:Z... [more]
usp182.299e-1726.77ubiquitin specific peptidase 18 [Source:ZFIN;Acc:Z... [more]
usp32.534e-1023.69ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZD... [more]
usp428.168e-1032.84ubiquitin specific peptidase 42 [Source:ZFIN;Acc:Z... [more]
usp428.168e-1032.84ubiquitin specific peptidase 42 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif1b9.785e-1339.39eukaryotic translation initiation factor 1B [Sourc... [more]
eif1b1.095e-1239.60eukaryotic translation initiation factor 1B [Sourc... [more]
rpl7l15.797e-1125.48ribosomal protein L7 like 1 [Source:Xenbase;Acc:XB... [more]
ENSXETT00000030414.11.206e-925.32pep primary_assembly:Xenopus_tropicalis_v9.1:5:124... [more]
ENSXETT00000014911.12.208e-924.68pep primary_assembly:Xenopus_tropicalis_v9.1:5:124... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp17lb1.765e-1125.69ubiquitin specific peptidase 17-like B [Source:MGI... [more]
Usp17lb2.133e-1125.69ubiquitin specific peptidase 17-like B [Source:MGI... [more]
Usp31.502e-1022.13ubiquitin specific peptidase 3 [Source:MGI Symbol;... [more]
Usp31.756e-1022.13ubiquitin specific peptidase 3 [Source:MGI Symbol;... [more]
Usp422.309e-1025.54ubiquitin specific peptidase 42 [Source:MGI Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UUD6|UBP11_SCHPO8.169e-1726.73Ubiquitin carboxyl-terminal hydrolase 11 OS=Schizo... [more]
sp|Q9W462|UBP30_DROME2.404e-1525.18Ubiquitin carboxyl-terminal hydrolase 30 homolog O... [more]
sp|E9Q9U0|U17PB_MOUSE1.492e-1025.69Ubiquitin carboxyl-terminal hydrolase 17-like prot... [more]
sp|Q9SB51|UBP16_ARATH1.506e-1032.26Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabid... [more]
sp|Q9H9J4|UBP42_HUMAN1.588e-1025.23Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo s... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9G0U34.502e-2025.43USP domain-containing protein OS=Daphnia pulex OX=... [more]
A0A067RGY89.822e-1923.20Ubiquitin carboxyl-terminal hydrolase 30 OS=Zooter... [more]
A0A0P5ZGD03.707e-1825.00Ubiquitin carboxyl-terminal hydrolase OS=Daphnia m... [more]
A0EB128.675e-1529.09Uncharacterized protein OS=Paramecium tetraurelia ... [more]
E7EYZ14.917e-1426.22Ubiquitin-specific peptidase 18 OS=Danio rerio OX=... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp37.530e-1324.01ubiquitin specific peptidase 3 [Source:NCBI gene;A... [more]
usp39.405e-1324.40ubiquitin specific peptidase 3 [Source:NCBI gene;A... [more]
usp303.974e-1020.55ubiquitin specific peptidase 30 [Source:NCBI gene;... [more]
ENSAMXT00000052072.15.251e-1026.71ubiquitin carboxyl-terminal hydrolase 17-like prot... [more]
usp445.089e-924.86ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp31.724e-932.46ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000001070.11.551e-827.49pep scaffold:Pmarinus_7.0:GL491036:3110:6028:-1 ge... [more]
usp225.730e-726.50ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
usp227.767e-727.12ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
ENSPMAT00000010866.11.601e-636.99pep scaffold:Pmarinus_7.0:GL477036:107271:109164:1... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
UBP162.789e-628.68Deubiquitinating enzyme anchored to the outer mito... [more]
UBP16.603e-640.98Ubiquitin-specific protease; removes ubiquitin fro... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327369.399e-1033.05Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO445864.311e-821.83Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO374661.776e-727.74Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO426513.168e-726.98Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO295793.697e-634.07Battenin [Source:UniProtKB/TrEMBL;Acc:A7T389][more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp424.700e-1136.84ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp35.874e-1123.01ubiquitin specific peptidase 3 [Source:NCBI gene;A... [more]
usp36.908e-1123.01ubiquitin specific peptidase 3 [Source:NCBI gene;A... [more]
usp37.564e-1123.01ubiquitin specific peptidase 3 [Source:NCBI gene;A... [more]
usp427.837e-1137.36ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039982.10.000e+099.68SMESG000039982.1[more]
SMESG000039981.11.425e-6535.95SMESG000039981.1[more]
SMESG000039986.16.386e-5937.14SMESG000039986.1[more]
SMESG000039986.17.973e-5936.51SMESG000039986.1[more]
SMESG000039999.11.740e-4437.01SMESG000039999.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024809 ID=SMED30024809|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1237bp
TACAGACCTTAATTATAAAATACGAAAATATTTAAATCACTTTGTTAACT
AAAATATCATAGGGATGCAAGCATGATTTAACTAAAGAAATTTTATTAAA
TATTTTCGTAATTTAATTATTTAAATTATAGTTTTGAACTTAATTTAAAA
TGTATGTTGCAAGATTAATTAATAGTGCATCGAATTGTTACTTGAACTCA
ACTTTACAAGGCTTAGCAGCCTGTACTCAACTTATTGATGATTTCAGACA
ATTGGAAATAAAATATCAAAACATTGAATCATTGAAAATTTTCAATAAAC
TGTTGAAATCTATCACGGGCTCGAAATCAGCAAAAGTGAATGCTTTTCAA
AGTAATTTATTTATAAACTGGAAAAAAAGAGGTCAACAAGATAGTTTTGA
AGTGTTAACATATGCAATTAGCGAAGTTTATAAGGAGCTACGGAAAAAGG
AAAATGTAAATGATATTGAAAAATGGGTGAATTTTGAACTACCGATGAGA
TTCATCATGGGGTATGATATTAAATGTTGTAATAATCATGTCATTGCATG
TCCTAAGCAAGTTGCACTTGCTCTCCATGTTCCAATTATTGAAAAGTCGA
ACGGTAAATCTGATAAGATTTCAGGTCTTTCCATACAATCTTTGGTGAAT
AAATATCTCGATGAAACGGAAATCGAAGATTATGTTTGTGATGATTGCAG
CAAAACAGACTCGAAAAATAATGAAAACAAATCCGAAATTAAGGCCAAAA
AATTTTCACAAATCTTAAGTCCTCTTCCTCGAACAATTTGTGTCCATTTG
CAAAGAACTAGATGGATCAATGGATCAATGAAGAAACTTACAGATTCAAT
AAAGATTGATGAAAAATTAGAAATAACTTATCAGAATAATGATAACAAAC
CAATAACGAATCAATTCTCATTAAAGGCGGTTATAGTTCACAGTGGGAAC
ATTTTCTTCGGACATTATGTTTGCTACAGGCTGTGTAGTGACAAATGGTA
TTTCACCAGTGATAGCACTGTGAAAGAATCTGATATTAAAACCGTTATGT
CACAACAGCCTTACATCTTGTTTTATGAATAGTTTTATCCGACATTTACC
TGCATATACTTATTAGTTATTGTGACCTTGCTCTAGAATCTCTTTCTTAT
CCACATTTGTGTTTATTGATTATGTATTAATGGTTATATTAAAAATATGA
TCTGTCTATTTTTTAATAAATTCTGCATTAATCTAAA
back to top

protein sequence of SMED30024809-orf-1

>SMED30024809-orf-1 ID=SMED30024809-orf-1|Name=SMED30024809-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MYVARLINSASNCYLNSTLQGLAACTQLIDDFRQLEIKYQNIESLKIFNK
LLKSITGSKSAKVNAFQSNLFINWKKRGQQDSFEVLTYAISEVYKELRKK
ENVNDIEKWVNFELPMRFIMGYDIKCCNNHVIACPKQVALALHVPIIEKS
NGKSDKISGLSIQSLVNKYLDETEIEDYVCDDCSKTDSKNNENKSEIKAK
KFSQILSPLPRTICVHLQRTRWINGSMKKLTDSIKIDEKLEITYQNNDNK
PITNQFSLKAVIVHSGNIFFGHYVCYRLCSDKWYFTSDSTVKESDIKTVM
SQQPYILFYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005739mitochondrion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 6..310
e-value: 6.8E-41
score: 142.7
NoneNo IPR availablePANTHERPTHR24006FAMILY NOT NAMEDcoord: 6..310
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..25
score: 5.0
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 79..310
e-value: 1.67579E-26
score: 102.947
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 6..309
e-value: 1.6E-27
score: 96.6
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 256..273
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 4..310
score: 25.726
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 6..310