Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30024805
Length (bp)2156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30024805) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30024805) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30024805) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30024805) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024805SMESG000057601.1 PL08011X1F02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30024805SMESG000057601.1 dd_Smed_v4_4760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024805SMESG000057601.1 dd_Smed_v4_4760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024805SMESG000057601.1 dd_Smed_v4_4760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024805SMESG000071508.1 Contig3759GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024805SMESG000057601.1 Contig3759GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30024805SMESG000057601.1 dd_Smed_v4_4760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9UUD6|UBP11_SCHPO (Ubiquitin carboxyl-terminal hydrolase 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp11 PE=3 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.155e-7
Identity = 74/290 (25.52%), Postives = 118/290 (40.69%), Query Frame = 3
Query:  942 GLENVT-NECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAI-------HNEMKKMNIKIDLP----MKSEV-IYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDL--------IKEYFAISIIDG--KETETS--RLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLAND 1736
            GL NV+ N+C++N  +Q+LAS E +L+ +   K   + S +  T   L++ LN+  G      +     ++       +  QQDA +FL      +       +   K ++  +D P    M+ +V   Q L    S     +I   L L   Y     V L+ L        I +Y   S      K ++TS  R   +K  P   IL IQ  R       + +         N+ +  P K+      +   K  Y L ++I HSG+++ GHY+  R   D W  AND
Sbjct:   50 GLYNVSGNDCFLNCVLQSLASQESLLEIL---KLRCSSSTLYATLYELLQKLNSGPGNPITPGSFLNSLEIATNKKLVRSIQQDAQEFLQHLVETLELQKPHTYKWSKVLSFPVDSPFIGTMEQKVQCCQCLAISISYSTATSI--QLCLPPEYSGNSNVSLLSLMEADREQHISDYKCDSCFKSSPKHSKTSCIRTVDWKNPPT--ILQIQLERTSYTCQGLTR--------NNVSISFPSKL------ILKNKHHYILRSLITHSGSVTYGHYLCYRLQDDIWWKAND 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A1I8IFN2 (Ubiquitin carboxyl-terminal hydrolase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.029e-8
Identity = 77/311 (24.76%), Postives = 128/311 (41.16%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFIDQTKEF-----LNGSEILMTFSNLI----EGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMK------SEVIYQTLG--------SHASEKA-QYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETET----------SRLFFYKQIPNVLILHI---QANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKC-EYSLVAVIHHSGTISNGHY--VTNRKFKDSWLLANDIQVEAA 1754
            GL N+ N CYMNS +Q L+ +E +L+     + F      NGS +   ++NL+        +  G                   +   +QQDA +FL      +H ++  ++++  LP +      S V+   +G         H S K+  ++    L L    + R    L   +K +     +DG E  T           + F   ++P+VL++H+      R+  ++N +V        E  M+L++    E  D + RL +  +Y L AV  H+GT   GHY  V        WL  ND +VE A
Sbjct:  129 GLNNLGNTCYMNSILQCLSHTEPLLRHFVLERRFQPSAGRNGSGLAKAYANLMLRMWAASASPTGADCTSPTELKQCVAQYAPRFRGYSQQDAQEFLRYLLEGLHEDLNLVSVRPKLPPRYLQQENSPVVEAFVGQLKSTLECCHCSHKSVTFDPFWDLALPIPGKSR--TSLDACLKLFTNQETLDGNERPTCDRCRCRRKCVKRFHLYRLPSVLVIHLMRFSGERFKTKLNTLV--------EYPMELDV---SEFLDKKCRLRQTPQYRLYAVSEHAGTPYGGHYTAVVRHAGTGRWLRYNDNRVEEA 426          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A1I8G214 (USP domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.079e-8
Identity = 76/311 (24.44%), Postives = 129/311 (41.48%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFIDQTKEF-----LNGSEILMTFSNLI----EGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMK------SEVIYQTLG--------SHASEKA-QYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETET----------SRLFFYKQIPNVLILHI---QANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKC-EYSLVAVIHHSGTISNGHY--VTNRKFKDSWLLANDIQVEAA 1754
            GL N+ N CYMNS +Q L+ +E +L+     + F      NGS +   ++NL+        +  G                   +   +QQDA +FL      +H ++  ++++  LP +      S V+   +G         H S K+  ++    L L    + R  ++    +K +     +DG E  T           + F   ++P+VL++H+      R+  ++N +V        E  M+L++    E  D + RL +  +Y L AV  H+GT   GHY  V        WL  ND +VE A
Sbjct:   22 GLNNLGNTCYMNSILQCLSHTEPLLRHFVLERRFQPSAGRNGSGLAKAYANLMLRMWAASASPTGADCTSPTELKQCVAQYAPRFRGYSQQDAQEFLRYLLEGLHEDLNLVSVRPKLPPRYLQQENSPVVEAFVGQLKSTLECCHCSHKSVTFDPFWDLALPIPGKSRTSLDAC--LKLFTNQETLDGNERPTCDRCRCRRKCVKRFHLYRLPSVLVIHLMRFSGERFKTKLNTLV--------EYPMELDV---SEFLDKKCRLRQTPQYRLYAVSEHAGTPYGGHYTAVVRHAGTGRWLRYNDNRVEEA 319          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A553R391 (USP domain-containing protein OS=Danionella translucida OX=623744 GN=DNTS_024264 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.721e-7
Identity = 71/298 (23.83%), Postives = 118/298 (39.60%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFI-----DQTKEFLNGSEILMTFSNLIEGL--NNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIK----IDLPMK-------SEVIYQTLGSHASE---------KAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYE-ENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEA 1751
            GL N+ N C++N+ MQ L+ +  +  +       Q K       ++  FS ++ GL   N  G  +V            +  ++  +QQDA +FL    + +H E+ +   K    I+L  +       SE  +     H              Q    LH  +  HY     V   DL      +     + TE+++    ++ P +L++H+  NR+ M    + K T  I +    + L     V+   V        Y L AV +HSGT++ GHY    + +D W   ND  V A
Sbjct:   63 GLRNIGNTCFLNAIMQCLSHTRSLRDYCLMRTYIQDKHSSQEPVLMNEFSKVLAGLWDCNNGGESTVNPGKFYHVFKESVPYFNGYSQQDAQEFLRFLLDRLHTEINRRPSKRPAVIELKQQTYSRFRISEEAFAVWQRHLDRDDSKIVDLFSGQLRSSLHCSVCSHYSNTFDV-FCDLSLPIPKMCERCNRCTESTKRLSIQRFPRILVIHL--NRFAMSKFSISKSTVSISFPLRGLDLGPFGPVDCGPVL-------YDLYAVCYHSGTVNMGHYTAACREQDGWSCYNDSCVNA 350          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A075ART8 (Ubiquitin carboxyl-terminal hydrolase OS=Rozella allomycis (strain CSF55) OX=988480 GN=O9G_003153 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.160e-6
Identity = 63/277 (22.74%), Postives = 112/277 (40.43%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELP----VKVERTDV---ELRLEKCE-----YSLVAVIHHSGTISNGHYVTNRKFKDSWLLAND 1736
            GL+N+ N CY+N+ +Q L+  + ++ +    K   N S ++ TF N +        T   + +S           +    Q DA +FL +    +H+EM ++        K +  +    S  S+       +  G+         V L D ++ +F+  IID            K    V     +A   + +M+ +  P   ++ + N ++ LP    +     DV   +     C      Y L A+ +H+GT+SNGHY  N K  + W + ND
Sbjct:  187 GLQNLGNTCYINAVLQCLSCIKPLVVYFKNKKP--NASVVITTFENWLRQY--WISTSICDGSSIKSIVENHNSTFQGNEQHDAHEFLNSLLVLLHDEMNRVKFNAKFNFKQKDQHLVSNSFLSD-------IFCGMLESKGPPTKVNLEDCLETFFSSEIID------------KSANYVCSQCTKAQMIEKKMSVITHPQILVIRKLNTQIVLPELLNINALGADVPEQQSDQNHCSKLDLSYELFAICNHNGTLSNGHYYANVKLNEKWYIVND 440          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3Q3J145 (Ubiquitin carboxyl-terminal hydrolase OS=Monopterus albus OX=43700 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.715e-6
Identity = 74/302 (24.50%), Postives = 122/302 (40.40%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXX-----QQDAFDFLTATTNAIHN-------EMKKMNIKIDLPMKSEVIYQTL--------GSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIID----GKETETSRLFFYKQIPNVLILHIQANRW--DMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSG-TISNGHYVTNRKF-------KDSWLLANDIQV 1745
            G  N+   CYMNST+Q L + +  +   +  K   N +        L+E L     + S+     LL      +           QQDA +FL    + + +       E   M      P+ + + +Q L        G  ++ +  Y   L L L       PG  +   +++Y   S ++        E+S+ + +  +PNVLILH++  R+    E+ K+V P         +  EL V  E +  +  + +  YSLV+VI H G T  +GHY+ +  +        D WL  ND  V
Sbjct:  302 GFPNLAQTCYMNSTLQGLLTLKHFVHEFNSQKTVWNTNAKCQIIRCLVE-LEACRTSNSMSRRKQLLAAFKQSVAEFNSEFDDDGQQDAHEFLICVLDKMRSLSLELQEEACSMGFSYTCPVNAHIAFQMLNTMTCRRCGVQSTREEDY-TALSLDLV------PGSSVWQCLQQYLKGSYLEYHCECGAKESSQQWSFLTLPNVLILHLKRLRFTPSFEVEKVVSPII-------LSRELVVHSEPSSTQQTMSR--YSLVSVISHLGYTAHSGHYICDGAYPEEPGDVTDRWLTYNDKHV 586          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 53.9138 bits (128), Expect = 4.321e-7
Identity = 67/327 (20.49%), Postives = 131/327 (40.06%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFI-------DQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMK-----------------------SEVIYQTLGSHASEKAQYNIG-----------LHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETET----------SRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCE------YSLVAVIHHSGTISNGHYVTNRKFKDS--WLLANDIQV 1745
            GL N+ N C+MNS +Q L+++  +  +        D        + ++  F+ L + L  +    ++  +    +       +   NQQDA +FL    + +HNE+ +++++  +P++                       S+V+   +G   S       G           L L ++    E   V L+D ++ +    ++DG E  T          ++ F  ++ P VL+LH++  R+     K  K + ++          P+K    +++LR    +      Y+L AV +H+GT   GHY    +   +  W   ND +V
Sbjct:  183 GLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLNNNCRANAALMEEFAKLTQILWTSASNEAISPSDFKTQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRVPVEDFDHLSDDEKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKSSGE---VALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLK--RFSEARVKTAKLSTFV--------NFPIK----ELDLREFASDNSMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTGEWYTYNDSRV 492          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 53.1434 bits (126), Expect = 6.652e-7
Identity = 67/327 (20.49%), Postives = 131/327 (40.06%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFI-------DQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYN----------IGLHLG-----------------------LSGHYQERPG-VELVDLIKEYFAISIIDGKETET----------SRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCE------YSLVAVIHHSGTISNGHYVTNRKFKDS--WLLANDIQV 1745
            GL N+ N C+MNS +Q L+++  +  +        D        + ++  F+ L + L  +    ++  +    +       +   NQQDA +FL    + +HNE+ +++++  +P++    +  L      K  +N          + L +G                       LS    +  G V L+D ++ +    ++DG E  T          ++ F  ++ P VL+LH++  R+     K  K + ++          P+K    +++LR    +      Y+L AV +H+GT   GHY    +   +  W   ND +V
Sbjct:   63 GLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLNNNCRANAALMEEFAKLTQILWTSASNEAISPSDFKTQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRVPVED---FDHLSDDEKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLK--RFSEARVKTAKLSTFV--------NFPIK----ELDLREFASDNSMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTGEWYTYNDSRV 372          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 52.7582 bits (125), Expect = 7.513e-7
Identity = 67/326 (20.55%), Postives = 131/326 (40.18%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFI-------DQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYN----------IGLHLG-----------------------LSGHYQERPG-VELVDLIKEYFAISIIDGKETET----------SRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCE-----YSLVAVIHHSGTISNGHYVTNRKFKDS--WLLANDIQV 1745
            GL N+ N C+MNS +Q L+++  +  +        D        + ++  F+ L + L  +    ++  +    +       +   NQQDA +FL    + +HNE+ +++++  +P++    +  L      K  +N          + L +G                       LS    +  G V L+D ++ +    ++DG E  T          ++ F  ++ P VL+LH++  R+     K  K + ++          P+K    +++LR    +     Y+L AV +H+GT   GHY    +   +  W   ND +V
Sbjct:   42 GLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLNNNCRANAALMEEFAKLTQILWTSASNEAISPSDFKTQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRVPVED---FDHLSDDEKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLK--RFSEARVKTAKLSTFV--------NFPIK----ELDLREFASDNMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTGEWYTYNDSRV 350          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000057601.1 (SMESG000057601.1)

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 422/423 (99.76%), Postives = 423/423 (100.00%), Query Frame = 3
Query:  510 MHVNLPIFRFEMKFPYSLAIFFLFSVFAYPVKGDMSVDVSLRXXXXXXXXXXXXXXXXXXXXXXFKRPVEYEPILNIDSSSEESYPIENGCPKNEFISEPEGPRYINGDNLGVIINQGISSVETDKLQNVQXXXXXXXXXXXXCGLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP 1778
            MHVNLPIFRFEMKFPYSLAIFFLFSVFAYPVKGDMSVDVSLRVLLPVVICAIIIIMLIIVCYCIFKRPVEYEPILNIDSSSEESYPIENGCPKNEFISEPEGPRYINGDNLGVIINQGISSVETDKLQNVQKEDEFLEEEFKLCGLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVENNSNLLKKLILLINWSKLNQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVEL+DLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP
Sbjct:    1 MHVNLPIFRFEMKFPYSLAIFFLFSVFAYPVKGDMSVDVSLRVLLPVVICAIIIIMLIIVCYCIFKRPVEYEPILNIDSSSEESYPIENGCPKNEFISEPEGPRYINGDNLGVIINQGISSVETDKLQNVQKEDEFLEEEFKLCGLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVENNSNLLKKLILLINWSKLNQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELLDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP 423          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000057810.1 (SMESG000057810.1)

HSP 1 Score: 208.379 bits (529), Expect = 3.365e-61
Identity = 120/279 (43.01%), Postives = 172/279 (61.65%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP 1778
            GL N+   CYMNS +Q+LASS+K++    + ++     +++    +++  +NN++ T   E NS+ L K   L+NW K  QQD FDFL A    I  E+K  ++    P+K +V+Y+  G     K Q ++GL LGL G+Y   PGV   DL+KEYF  ++ID  ET+TS+LF Y  +P+VLI+HIQAN+WD  + +M KP Y+I+YE+   +    KV  T  E+      Y L AVI+H G IS+GHY+T RKF+D W LAND Q+E   F+ DVCP
Sbjct:   37 GLRNMNENCYMNSLIQSLASSDKIINQFKELQKIDGEHKLVDLLIDILTSVNNSESTP--EENSSKLMKFSELMNWGKDRQQDTFDFLCAIIKNIQLEIKDKSM-FQCPLKIKVMYKITGMEIPNKTQDHLGLSLGLCGNYSVSPGVLFDDLVKEYFTATLIDDDETKTSQLFIYGNVPDVLIIHIQANKWDSNLGEMYKPKYHIIYEKYPNISF--KVMSTSNEMMEINYTYDLHAVIYHMGEISSGHYITYRKFQDKWFLANDTQIEEVLFNCDVCP 310          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000057810.1 (SMESG000057810.1)

HSP 1 Score: 202.216 bits (513), Expect = 1.921e-59
Identity = 117/271 (43.17%), Postives = 168/271 (61.99%), Query Frame = 3
Query:  966 CYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP 1778
            CYMNS +Q+LASS+K++    + ++     +++    +++  +NN++ T   E NS+ L K   L+NW K  QQD FDFL A    I  E+K  ++    P+K +V+Y+  G     K Q ++GL LGL G+Y   PGV   DL+KEYF  ++ID  ET+TS+LF Y  +P+VLI+HIQAN+WD  + +M KP Y+I+YE+   +    KV  T  E+      Y L AVI+H G IS+GHY+T RKF+D W LAND Q+E   F+ DVCP
Sbjct:    5 CYMNSLIQSLASSDKIINQFKELQKIDGEHKLVDLLIDILTSVNNSESTP--EENSSKLMKFSELMNWGKDRQQDTFDFLCAIIKNIQLEIKDKSM-FQCPLKIKVMYKITGMEIPNKTQDHLGLSLGLCGNYSVSPGVLFDDLVKEYFTATLIDDDETKTSQLFIYGNVPDVLIIHIQANKWDSNLGEMYKPKYHIIYEKYPNISF--KVMSTSNEMMEINYTYDLHAVIYHMGEISSGHYITYRKFQDKWFLANDTQIEEVLFNCDVCP 270          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000057792.1 (SMESG000057792.1)

HSP 1 Score: 199.134 bits (505), Expect = 2.436e-57
Identity = 115/281 (40.93%), Postives = 174/281 (61.92%), Query Frame = 3
Query:  942 GLENVTNECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGT-GSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIK-IDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP 1778
            G +N+   CYMN+ +QA ASS+ ++       E    S  L  F +++ G+N  D +   +  N+N L+ LI L+NW+K NQQDAF+  TA    I +E K  NI  I++P+K +++Y+  G    ++ QY++GL LGLSG Y+ +PGV L  LI E+F+ ++IDG   +TS+LFF K  P+VL+LHIQAN+WD    KM+KP Y+I+Y++ M +   +        ++     Y L AV+ H GTIS GHYV  RK++++W L +D QVE  +F  ++CP
Sbjct:   66 GFKNLAETCYMNAIIQAAASSQILISQFQHLHETYKESMSLKCFYDVLIGVNTPDDSYVRLCKNTNQLETLIRLVNWTKTNQQDAFELFTALIKGISDEFKAQNIDDIEMPLKLKMVYRFKGLDIPDRTQYHLGLSLGLSGPYETKPGVTLEFLILEHFSPTLIDGDPNKTSQLFFLKGAPDVLLLHIQANKWDSVKEKMIKPKYHIVYDQEMTIWFDIITALNKDNVKRISVTYRLTAVVQHMGTISGGHYVAYRKWRNNWYLVSDEQVELMEFSGNICP 346          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000057810.1 (SMESG000057810.1)

HSP 1 Score: 196.052 bits (497), Expect = 3.251e-57
Identity = 115/269 (42.75%), Postives = 166/269 (61.71%), Query Frame = 3
Query:  972 MNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDGTGSVEXXXXXXXXXXXXXXXXXXXQQDAFDFLTATTNAIHNEMKKMNIKIDLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEYFAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYILYEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKFKDSWLLANDIQVEAAKFDPDVCP 1778
            MNS +Q+LASS+K++    + ++     +++    +++  +NN++ T   E NS+ L K   L+NW K  QQD FDFL A    I  E+K  ++    P+K +V+Y+  G     K Q ++GL LGL G+Y   PGV   DL+KEYF  ++ID  ET+TS+LF Y  +P+VLI+HIQAN+WD  + +M KP Y+I+YE+   +    KV  T  E+      Y L AVI+H G IS+GHY+T RKF+D W LAND Q+E   F+ DVCP
Sbjct:    1 MNSLIQSLASSDKIINQFKELQKIDGEHKLVDLLIDILTSVNNSESTP--EENSSKLMKFSELMNWGKDRQQDTFDFLCAIIKNIQLEIKDKSM-FQCPLKIKVMYKITGMEIPNKTQDHLGLSLGLCGNYSVSPGVLFDDLVKEYFTATLIDDDETKTSQLFIYGNVPDVLIIHIQANKWDSNLGEMYKPKYHIIYEKYPNISF--KVMSTSNEMMEINYTYDLHAVIYHMGEISSGHYITYRKFQDKWFLANDTQIEEVLFNCDVCP 264          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9UUD6|UBP11_SCHPO4.155e-725.52Ubiquitin carboxyl-terminal hydrolase 11 OS=Schizo... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IFN23.029e-824.76Ubiquitin carboxyl-terminal hydrolase OS=Macrostom... [more]
A0A1I8G2143.079e-824.44USP domain-containing protein OS=Macrostomum ligna... [more]
A0A553R3915.721e-723.83USP domain-containing protein OS=Danionella transl... [more]
A0A075ART81.160e-622.74Ubiquitin carboxyl-terminal hydrolase OS=Rozella a... [more]
A0A3Q3J1451.715e-624.50Ubiquitin carboxyl-terminal hydrolase OS=Monopteru... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
usp2b4.321e-720.49ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2b6.652e-720.49ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2b7.513e-720.55ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057601.10.000e+099.76SMESG000057601.1[more]
SMESG000057810.13.365e-6143.01SMESG000057810.1[more]
SMESG000057810.11.921e-5943.17SMESG000057810.1[more]
SMESG000057792.12.436e-5740.93SMESG000057792.1[more]
SMESG000057810.13.251e-5742.75SMESG000057810.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024805 ID=SMED30024805|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=2156bp
GTTTAAAGTTGTTGACAATTTTGTTTTCGAAAGGAATGATATTTTTAATA
TGTATACTTCAATACAGACTTCTTTAAACATAATAAACCCATGTTTCATG
CAATTTGTGTAAATATATGGGAATACTCATCATATCAATTTTTTGTAGTC
ATTCGAGTTCCGAATTTCATTCACTCTGTCCTTTACTAGCATCTTAGTAG
CATAATCTTTTAATTAATTTCAAAATCAGTTTTTGTTCGAAGGGGATAAG
TGACAGAATGTGTGATCAAATATTGTTGGGATGAAATTTTTTACAAAAAT
AGTATTATGGTATTTTTAATGCAAAATACAGTGGAAGATATTGAAACAAA
AAAGAACTGAAATTAAGAGAGGTTAAATCAGTTGATGTAGTCAGGGAAGT
TACAACAATAATGGAAGAAATTCAAAAAGAACTATTAAATGAATAAATAA
ATGTATTAATCACTGCTTTGTATTAATCGCACTTGTCTTTAAATAATGAA
GTTAATGAAATGCATGTGAATTTACCTATTTTCAGATTTGAAATGAAATT
CCCTTATTCTTTGGCAATTTTCTTTCTTTTTAGCGTATTCGCATATCCAG
TTAAAGGTGATATGTCGGTCGATGTATCGCTGCGGGTCCTGCTGCCGGTC
GTCATCTGTGCTATTATTATTATCATGCTAATAATTGTGTGTTATTGCAT
TTTTAAAAGGCCCGTCGAATATGAACCAATATTAAATATAGATTCTTCAT
CGGAAGAATCATATCCAATTGAAAATGGTTGTCCGAAGAATGAATTTATA
TCTGAACCGGAAGGACCAAGATATATTAATGGGGATAATTTGGGAGTCAT
AATTAATCAAGGAATTTCGTCCGTCGAAACCGATAAATTGCAGAATGTTC
AGAAAGAGGATGAATTTTTAGAAGAAGAGTTTAAATTATGTGGTCTAGAA
AATGTTACAAATGAATGTTATATGAATAGTACCATGCAAGCTCTAGCGTC
CAGTGAAAAGGTATTACAATTTATAGACCAAACGAAAGAATTCCTTAATG
GAAGTGAAATATTGATGACATTCAGCAACCTTATTGAAGGTCTTAATAAT
ACAGATGGTACTGGGAGTGTTGAAAACAATTCTAATCTTTTGAAGAAACT
AATACTTTTAATAAATTGGAGTAAATTAAACCAACAAGATGCATTTGACT
TCTTAACGGCGACAACCAATGCCATTCACAACGAAATGAAAAAAATGAAT
ATTAAGATTGACCTCCCAATGAAAAGTGAAGTAATTTACCAAACCCTTGG
ATCGCATGCATCAGAGAAAGCTCAATATAATATTGGTTTGCACCTGGGTT
TGAGTGGACATTATCAAGAACGTCCAGGAGTTGAACTAGTTGATCTTATA
AAGGAATATTTTGCCATTTCAATTATCGACGGAAAGGAAACTGAAACTTC
GCGACTATTTTTCTACAAACAAATCCCAAATGTTTTAATTTTACACATTC
AGGCCAACAGATGGGATATGGAAATGAACAAAATGGTTAAACCAACATAC
TATATACTATACGAGGAAAATATGAAATTGGAACTGCCTGTCAAAGTGGA
ACGGACTGATGTCGAATTGCGCCTGGAGAAATGTGAGTACAGTTTGGTAG
CGGTCATTCACCACTCGGGAACAATATCAAATGGTCATTATGTCACTAAT
CGCAAATTCAAAGATTCCTGGCTTTTAGCTAATGATATTCAAGTAGAAGC
GGCAAAGTTTGATCCAGATGTTTGCCCCTATCTGCTAATTTATGAAAAAT
TATTAAAAAAAACGAAATAATATTTATTTTCTGAATTTAAATGTATTGTA
TACCTTTTCTGGCGCTTTGTAAATGTTTTTAGTGTTCATTGACACTAGTG
TTGAATAATTATTGCGCGCTAGTTGTGGCTTTCAAATAATCTCAATTGCT
GATTATGGCTATAAATACTCTGATATCAAATATTATCATTTCATTTCTGT
AAATAAACTCTCAAACTATATTTTATATAAAGATTATAACTTATATGTGA
ACAGTTACTCAGACATATGAGTTTTATTTATAAGGATTATAATACGGGTA
AGACTTTATCACTGATTTTGATTGGTTATTCCATTAACCCACAAGAATGT
CATCCC
back to top

protein sequence of SMED30024805-orf-1

>SMED30024805-orf-1 ID=SMED30024805-orf-1|Name=SMED30024805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MHVNLPIFRFEMKFPYSLAIFFLFSVFAYPVKGDMSVDVSLRVLLPVVIC
AIIIIMLIIVCYCIFKRPVEYEPILNIDSSSEESYPIENGCPKNEFISEP
EGPRYINGDNLGVIINQGISSVETDKLQNVQKEDEFLEEEFKLCGLENVT
NECYMNSTMQALASSEKVLQFIDQTKEFLNGSEILMTFSNLIEGLNNTDG
TGSVENNSNLLKKLILLINWSKLNQQDAFDFLTATTNAIHNEMKKMNIKI
DLPMKSEVIYQTLGSHASEKAQYNIGLHLGLSGHYQERPGVELVDLIKEY
FAISIIDGKETETSRLFFYKQIPNVLILHIQANRWDMEMNKMVKPTYYIL
YEENMKLELPVKVERTDVELRLEKCEYSLVAVIHHSGTISNGHYVTNRKF
KDSWLLANDIQVEAAKFDPDVCPYLLIYEKLLKKTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 144..431
e-value: 3.3E-36
score: 127.2
NoneNo IPR availablePANTHERPTHR24006FAMILY NOT NAMEDcoord: 127..430
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 145..429
e-value: 8.57727E-23
score: 94.8574
NoneNo IPR availableTMHMMTMhelixcoord: 15..31
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 144..428
e-value: 3.6E-26
score: 92.2
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 377..394
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 144..431
score: 25.068
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 142..430