RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30024800
Length (bp)1409
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30024800) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30024800) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30024800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30024800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30024800SMESG000036117.1 SMESG000036064.1 SMESG000000776.1 SMESG000000765.1 SMESG000000754.1 SMESG000000687.1 SMESG000000587.1 dd_Smed_v4_4074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024800SMESG000036117.1 SMESG000036064.1 SMESG000000776.1 SMESG000000765.1 SMESG000000754.1 SMESG000000687.1 SMESG000000587.1 dd_Smed_v4_4074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30024800SMESG000036117.1 SMESG000000754.1 SMESG000000587.1 Contig31191newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024800SMESG000036117.1 SMESG000000754.1 SMESG000000587.1 Contig31191uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30024800SMESG000036117.1 SMESG000036064.1 SMESG000000776.1 SMESG000000765.1 SMESG000000754.1 SMESG000000687.1 SMESG000000587.1 dd_Smed_v4_4074_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024800SMESG000036117.1 SMESG000036064.1 SMESG000000776.1 SMESG000000765.1 SMESG000000754.1 SMESG000000687.1 SMESG000000587.1 dd_Smed_v4_4074_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: AL136295.10 (novel transcript)

HSP 1 Score: 124.79 bits (312), Expect = 1.002e-29
Identity = 94/338 (27.81%), Postives = 157/338 (46.45%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  +  C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C E NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + I  K        + C K+T     GLC  H+KEY+ +LI
Sbjct:  677 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRV-IEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLI 1010          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 124.79 bits (312), Expect = 1.002e-29
Identity = 94/338 (27.81%), Postives = 157/338 (46.45%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  +  C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C E NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + I  K        + C K+T     GLC  H+KEY+ +LI
Sbjct:  677 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRV-IEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLI 1010          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 124.79 bits (312), Expect = 1.002e-29
Identity = 94/338 (27.81%), Postives = 157/338 (46.45%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  +  C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C E NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + I  K        + C K+T     GLC  H+KEY+ +LI
Sbjct:  677 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRV-IEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLI 1010          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: AL136295.5 (novel transcript)

HSP 1 Score: 124.79 bits (312), Expect = 1.002e-29
Identity = 94/338 (27.81%), Postives = 157/338 (46.45%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  +  C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C E NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + I  K        + C K+T     GLC  H+KEY+ +LI
Sbjct:  677 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRV-IEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLI 1010          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 124.405 bits (311), Expect = 1.398e-29
Identity = 94/338 (27.81%), Postives = 157/338 (46.45%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  +  C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C E NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + I  K        + C K+T     GLC  H+KEY+ +LI
Sbjct:  522 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRV-IEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLI 855          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.6918 bits (143), Expect = 3.236e-9
Identity = 47/202 (23.27%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN-HVNDKIKC--PKCNELSCKKCKNKWHENEFCDFTKQN--------GNQNIFQDFSHNLID----------CPKCKAKFY-LDKGGCLHL 987
            +CPLC    P S    +  C  + C+ C + +V E+ +  +  ++ CP C        ++ L+    + ++    TL   Y    +  ++  +A+  WC    C + F  +      ++KC  P C  L C  CK +WH N+ CD  ++           + I +   H   D          CP+CK     +D G C H+
Sbjct:   54 ECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYV-ELSITENRVEVPCPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHM 246          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.6918 bits (143), Expect = 3.236e-9
Identity = 47/202 (23.27%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN-HVNDKIKC--PKCNELSCKKCKNKWHENEFCDFTKQN--------GNQNIFQDFSHNLID----------CPKCKAKFY-LDKGGCLHL 987
            +CPLC    P S    +  C  + C+ C + +V E+ +  +  ++ CP C        ++ L+    + ++    TL   Y    +  ++  +A+  WC    C + F  +      ++KC  P C  L C  CK +WH N+ CD  ++           + I +   H   D          CP+CK     +D G C H+
Sbjct:   54 ECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYV-ELSITENRVEVPCPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHM 246          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.3066 bits (142), Expect = 3.682e-9
Identity = 47/202 (23.27%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN-HVNDKIKC--PKCNELSCKKCKNKWHENEFCDFTKQN--------GNQNIFQDFSHNLID----------CPKCKAKFY-LDKGGCLHL 987
            +CPLC    P S    +  C  + C+ C + +V E+ +  +  ++ CP C        ++ L+    + ++    TL   Y    +  ++  +A+  WC    C + F  +      ++KC  P C  L C  CK +WH N+ CD  ++           + I +   H   D          CP+CK     +D G C H+
Sbjct:   84 ECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYV-ELSITENRVEVPCPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHM 276          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.3066 bits (142), Expect = 3.682e-9
Identity = 47/202 (23.27%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN-HVNDKIKC--PKCNELSCKKCKNKWHENEFCDFTKQN--------GNQNIFQDFSHNLID----------CPKCKAKFY-LDKGGCLHL 987
            +CPLC    P S    +  C  + C+ C + +V E+ +  +  ++ CP C        ++ L+    + ++    TL   Y    +  ++  +A+  WC    C + F  +      ++KC  P C  L C  CK +WH N+ CD  ++           + I +   H   D          CP+CK     +D G C H+
Sbjct:   84 ECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYV-ELSITENRVEVPCPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHM 276          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.3066 bits (142), Expect = 3.818e-9
Identity = 47/202 (23.27%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN-HVNDKIKC--PKCNELSCKKCKNKWHENEFCDFTKQN--------GNQNIFQDFSHNLID----------CPKCKAKFY-LDKGGCLHL 987
            +CPLC    P S    +  C  + C+ C + +V E+ +  +  ++ CP C        ++ L+    + ++    TL   Y    +  ++  +A+  WC    C + F  +      ++KC  P C  L C  CK +WH N+ CD  ++           + I +   H   D          CP+CK     +D G C H+
Sbjct:   84 ECPLCAAKMPGSAFPKLKGCQHRSCRACLRQYV-ELSITENRVEVPCPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHM 276          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331216)

HSP 1 Score: 112.849 bits (281), Expect = 5.959e-26
Identity = 95/337 (28.19%), Postives = 159/337 (47.18%), Query Frame = 1
Query:  436 ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTS---LYFLSFQEIVNS--DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC----DFTKQNG----NQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREG-CKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXX------PCYKDT------------------GLCTDHFKEYIAALIFK 1317
            +LQ++C LC++ +P+++M +ML C  + CK C K +    I + S +   CP C  PE++   ++      YF +    + S  D  +  ++  K     + +D N  WC   +CS GF  +     ++ CP C  ++C +C+  W   HE   C    ++ ++N      Q + +  + N IDCPKCK ++ L +GGC+H  C +CK EFC  C + F+    C           HAHHP+ C ++LRD    ++  Q+Q   K +N       ++I ++SS +SK         P  K+T                  G+C  H+ EY+A  + K
Sbjct: 2509 MLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCI--QCSSGF-FARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRD----KIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAK 2838          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331218)

HSP 1 Score: 112.849 bits (281), Expect = 6.056e-26
Identity = 95/337 (28.19%), Postives = 159/337 (47.18%), Query Frame = 1
Query:  436 ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTS---LYFLSFQEIVNS--DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC----DFTKQNG----NQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREG-CKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXX------PCYKDT------------------GLCTDHFKEYIAALIFK 1317
            +LQ++C LC++ +P+++M +ML C  + CK C K +    I + S +   CP C  PE++   ++      YF +    + S  D  +  ++  K     + +D N  WC   +CS GF  +     ++ CP C  ++C +C+  W   HE   C    ++ ++N      Q + +  + N IDCPKCK ++ L +GGC+H  C +CK EFC  C + F+    C           HAHHP+ C ++LRD    ++  Q+Q   K +N       ++I ++SS +SK         P  K+T                  G+C  H+ EY+A  + K
Sbjct: 2468 MLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCI--QCSSGF-FARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRD----KIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAK 2797          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331220)

HSP 1 Score: 112.849 bits (281), Expect = 6.164e-26
Identity = 95/337 (28.19%), Postives = 159/337 (47.18%), Query Frame = 1
Query:  436 ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTS---LYFLSFQEIVNS--DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC----DFTKQNG----NQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREG-CKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXX------PCYKDT------------------GLCTDHFKEYIAALIFK 1317
            +LQ++C LC++ +P+++M +ML C  + CK C K +    I + S +   CP C  PE++   ++      YF +    + S  D  +  ++  K     + +D N  WC   +CS GF  +     ++ CP C  ++C +C+  W   HE   C    ++ ++N      Q + +  + N IDCPKCK ++ L +GGC+H  C +CK EFC  C + F+    C           HAHHP+ C ++LRD    ++  Q+Q   K +N       ++I ++SS +SK         P  K+T                  G+C  H+ EY+A  + K
Sbjct: 2456 MLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCI--QCSSGF-FARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRD----KIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAK 2785          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331221)

HSP 1 Score: 112.464 bits (280), Expect = 6.922e-26
Identity = 95/337 (28.19%), Postives = 159/337 (47.18%), Query Frame = 1
Query:  436 ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTS---LYFLSFQEIVNS--DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC----DFTKQNG----NQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREG-CKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXX------PCYKDT------------------GLCTDHFKEYIAALIFK 1317
            +LQ++C LC++ +P+++M +ML C  + CK C K +    I + S +   CP C  PE++   ++      YF +    + S  D  +  ++  K     + +D N  WC   +CS GF  +     ++ CP C  ++C +C+  W   HE   C    ++ ++N      Q + +  + N IDCPKCK ++ L +GGC+H  C +CK EFC  C + F+    C           HAHHP+ C ++LRD    ++  Q+Q   K +N       ++I ++SS +SK         P  K+T                  G+C  H+ EY+A  + K
Sbjct: 2415 MLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCI--QCSSGF-FARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRD----KIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAK 2744          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: ari-1 (gene:FBgn0017418 transcript:FBtr0089508)

HSP 1 Score: 51.2174 bits (121), Expect = 1.381e-6
Identity = 42/213 (19.72%), Postives = 86/213 (40.38%), Query Frame = 1
Query:  364 SEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHENEFCDFTKQ-----NGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHL 987
            + VI P++  +A+   T  +  ++     C +C    P   M   L C  +FC  C+ +++   I+     + +  +    +    + ++  L       +D  +R  Y +   + F++ +    WC +  C+Y   +      ++ C KC  + C  C   WH+   C + K+     + +       + N  +CP+C      D GGC H+
Sbjct:  109 AHVINPFNATEAIKQKTSRSQCEE-----CEICFSQLPPDSMAG-LECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLV------TDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRRVHC-KCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKD-GGCNHM 307          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-181m9.8 (si:dkey-181m9.8 [Source:ZFIN;Acc:ZDB-GENE-070912-399])

HSP 1 Score: 114.39 bits (285), Expect = 1.000e-26
Identity = 101/365 (27.67%), Postives = 166/365 (45.48%), Query Frame = 1
Query:  346 DKQEVYSEVIE-------PYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTSLYFLSF---QEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIK--CPKCNELSCKKCKNKW---HENEFCDFTK--------QNGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREG--CKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFE-------KPKNS----TLTLCDIEIYNXXXXX-----XXXXXPCYKDTGLCTDHFKEYIAALI 1311
            DK E++  ++          DV++A+     +      L   CP+C +    ++M  M +C+C FC++C+K +   VI   +    +CP C  P++   ++  ++ + S    Q     D  +  ++  K     +    N  WC +  C +G     H  D+++  CP C + +C KCK  W   HE   C+  K        +  N  + Q  S N IDCPKCK +F+L +GGCLH  C +C+HEFC  C + F ++G  C           HAHHP+ C Y LRD  V  L + +Q +         PK+     +  +C +  + ++         + + P Y  +G CT H+KE +  LI
Sbjct:  176 DKAEMFRSIMSLEGCSFSSTDVLEAVQSCRDLPSALKYLCHDCPICQEQVSFNRMVTMTHCSCTFCESCFKKYFSSVIKEKNIVHAVCPLCNLPDVRGGRREDTMEYFSLLDTQIRYYLDSQIHELFQRKLRDRALQEMPNFRWCAH--CCFGL---LHEADRLRMDCPSCGKSTCFKCKRPWAPQHEGISCEKFKEWEQLNSPEYQNSRLEQLLSRNKIDCPKCKFRFFLARGGCLHFRCTQCQHEFCGGCSQPF-KQGSTCNFSIECAAKGLHAHHPRNCLYHLRDWSVPRLRTLLQRYGVSHPLMFSPKHPMGRHSKGICGVMEFQETGAVKEEACGRQAFPEY--SGYCTLHYKEVLVELI 532          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: FO834800.1 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:100334178])

HSP 1 Score: 110.153 bits (274), Expect = 3.607e-25
Identity = 78/273 (28.57%), Postives = 136/273 (49.82%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ 1161
            DV+QA+ +    + I+ +L ++CP+CL  FP SKM ++  C C  C  C++      + +     ++CP C E +         + S  +I   D   + VY  + K+++E  + +D   +WC++  CSYGF I +    K+ C +C +  C +CK  W          +F  + ++N      Q +      N I CP C+ ++ L +GGC+H +C +C+++FC  C   F    C    C +    HAHHP+ C ++LRD +   L++ +Q
Sbjct:  665 DVVQAVRESPDRDFIRRVLNKECPICLSVFPHSKMRSLTSCQCSVCCGCFQQHFTIAVRDKHIRDMVCPVCTEPDINDPEHLNSYFSTLDIQLRDCLEQEVYELFHKKLTEQALIKDPKFLWCSH--CSYGF-IYDDDQLKVTCSQCRKSFCAQCKKTWEPQHMGLSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCSGCNNPF-HTTCAVNQCTV-TGLHAHHPRDCLFYLRDWEPARLQALLQ 932          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: FO834800.2 (E3 ubiquitin-protein ligase RNF31-like [Source:NCBI gene;Acc:108179742])

HSP 1 Score: 78.9518 bits (193), Expect = 4.406e-16
Identity = 65/239 (27.20%), Postives = 114/239 (47.70%), Query Frame = 1
Query:  487 MHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCD----FTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ 1161
            M ++  C C  C  C++      + +     ++CP C E +         + S  +I   D   + VY  + K+++E  + +D   +WC++  CSYGF I +    K+ C +C +  C +CK  W   H    C+    + ++N      Q +      N I CP C+ ++ L +GGC+H +C +C+++FC  C   F    C    C +    HAHHP+ C ++LRD +   L++ +Q
Sbjct:    1 MRSLTSCQCSVCCGCFQQHFTIAVRDKHIRDMVCPVCTEPDINDPEHLNSYFSTLDIQLRDCLEQEVYELFHKKLTEQALIKDPKFLWCSH--CSYGF-IYDDDQLKVTCSQCRKSFCAQCKKTWEPQHMGLSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCSGCNNPF-HTTCAVNQCTV-TGLHAHHPRDCLFYLRDWEPARLQALLQ 234          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf144ab (ring finger protein 144ab [Source:NCBI gene;Acc:437000])

HSP 1 Score: 57.7658 bits (138), Expect = 7.944e-9
Identity = 48/197 (24.37%), Postives = 81/197 (41.12%), Query Frame = 1
Query:  424 DIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCP--SCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN---HVNDKIKCPKCNELSCKKCKNKWHENEFCD--------FTKQNGNQNI-FQDFSHNLIDCPKCKAKFYLDKG 972
            D+  +L   C LCL  FPL +M  +  C C FC  C K +V  +I       + CP  +CP+     +N         E + + E +++ Y   +    +  D    WC +  C     ++     +   ++CP+C+   C  C+   H  + C            +NG+ N+  Q+    +  CPKCK     D+G
Sbjct:   13 DLAPLL--SCKLCLGEFPLEQMTTISQCQCIFCSLCLKQYVELLIKEGLETAISCPDSTCPKQGHLLENEI-------ECMVAGEVMQH-YKRLQFEREVLLDPCRTWCPSSSCQAVCQLNEAEVQLPQPVQCPECSLRFCSACRADCHTGQACQEMLPITTFLPGENGSSNLKSQEDEAPIKRCPKCKVYIERDEG 199          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-278j3.3 (si:ch211-278j3.3 [Source:ZFIN;Acc:ZDB-GENE-041014-147])

HSP 1 Score: 58.151 bits (139), Expect = 1.257e-8
Identity = 49/206 (23.79%), Postives = 82/206 (39.81%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTKQ------NGNQNIFQDFSHN--------LIDCPKCKAKFY-LDKGGCLHLN 990
            +CPLCL   P +    +  C  + C  C + ++R  I  S    + CP CPE        +L     + I++ D  L   + E ++  F+  D +T WC    CSY             C +C +LSC +          C+  WH ++ CD  ++      +G  ++   +  N        +  CP+C A     + G C  +N
Sbjct:  111 ECPLCLLSQPRAHFPRLSSCQHRACTDCLRQYLRIEISESRVG-IACPQCPE--------ALALPDVRAILD-DGALLERFEEFQLRRFLAADPDTRWCPAPDCSYAV-------IAYGCAECPKLSCGREGCETEFCYHCRQLWHPDQTCDQARRQRARHTSGANDVSTLYVFNEEPGDAEEIKPCPRCGAYIMKTNDGSCNRMN 299          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 129.798 bits (325), Expect = 2.122e-31
Identity = 99/334 (29.64%), Postives = 165/334 (49.40%), Query Frame = 1
Query:  376 EPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHE-------NEFCDFTKQNGNQNIFQDFS----HNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELES--QIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            E  DV++A+ +    + IK +L ++C +C    P +KM ++  C C  C  C++      +       ++CP+C E   + +   L++ S  +I+  D    + Y  + K+++E  + +D   +WCT+  CS+GF I       +KCP+C    C+KCK  W E       ++F ++ ++N  +   Q  +     N I CP CK  + L +GGC+H  C +C+H+FC  C   F  R  C   +C +  S HAHHP+ C ++LRD DV  L+   Q+    + K + L  C + +  K        + C K T     GLC  H+KEY+ + I
Sbjct:  588 ELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGF-IYERDQLDVKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGTLLCGCRV-MEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRI 917          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 128.257 bits (321), Expect = 5.715e-31
Identity = 95/329 (28.88%), Postives = 160/329 (48.63%), Query Frame = 1
Query:  376 EPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHE-------NEFCDFTKQNGNQNIFQDFS----HNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELES--QIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDTGLCTDHFKEYIAALI 1311
            E  DV++A+ +    + IK +L ++C +C    P +KM ++  C C  C  C++      +       ++CP+C E   + +   L++ S  +I+  D    + Y  + K+++E  + +D   +WCT+  CS+GF I       +KCP+C    C+KCK  W E       ++F ++ ++N  +   Q  +     N I CP CK  + L +GGC+H  C +C+H+FC  C   F  R  C   +C +  S HAHHP+ C ++LRD DV  L+   Q+    + K     +   EI +     +          GLC  H+KEY+ + I
Sbjct:  589 ELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGF-IYERDQLDVKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGGCRVMEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRI 914          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 127.872 bits (320), Expect = 7.553e-31
Identity = 95/329 (28.88%), Postives = 160/329 (48.63%), Query Frame = 1
Query:  376 EPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHE-------NEFCDFTKQNGNQNIFQDFS----HNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELES--QIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDTGLCTDHFKEYIAALI 1311
            E  DV++A+ +    + IK +L ++C +C    P +KM ++  C C  C  C++      +       ++CP+C E   + +   L++ S  +I+  D    + Y  + K+++E  + +D   +WCT+  CS+GF I       +KCP+C    C+KCK  W E       ++F ++ ++N  +   Q  +     N I CP CK  + L +GGC+H  C +C+H+FC  C   F  R  C   +C +  S HAHHP+ C ++LRD DV  L+   Q+    + K     +   EI +     +          GLC  H+KEY+ + I
Sbjct:  535 ELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGF-IYERDQLDVKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGGCRVMEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRI 860          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 127.872 bits (320), Expect = 8.537e-31
Identity = 95/329 (28.88%), Postives = 160/329 (48.63%), Query Frame = 1
Query:  376 EPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHE-------NEFCDFTKQNGNQNIFQDFS----HNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELES--QIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDTGLCTDHFKEYIAALI 1311
            E  DV++A+ +    + IK +L ++C +C    P +KM ++  C C  C  C++      +       ++CP+C E   + +   L++ S  +I+  D    + Y  + K+++E  + +D   +WCT+  CS+GF I       +KCP+C    C+KCK  W E       ++F ++ ++N  +   Q  +     N I CP CK  + L +GGC+H  C +C+H+FC  C   F  R  C   +C +  S HAHHP+ C ++LRD DV  L+   Q+    + K     +   EI +     +          GLC  H+KEY+ + I
Sbjct:  539 ELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGF-IYERDQLDVKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGGCRVMEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRI 864          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 118.627 bits (296), Expect = 9.466e-28
Identity = 98/338 (28.99%), Postives = 161/338 (47.63%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHE-------NEFCDFTKQNGNQNIFQDFS----HNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVN-----ELESQIQDFEKPKNSTLTL----CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+ +    + IK +L ++C +C    P +KM ++  C C  C  C++      +       ++CP+C E   + +   L++ S  +I+  D    + Y  + K+++E  + +D   +WCT+  CS+GF I       +KCP+C    C+KCK  W E       ++F ++ ++N  +   Q  +     N I CP CK  + L +GGC+H  C +C+H+FC  C   F  R  C   +C +  S HAHHP+ C ++LRD DV           +Q    P   T T     C + +  K        + C K T     GLC  H+KEY+ + I
Sbjct:  639 DVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGF-IYERDQLDVKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQMLLVQFNTDPPAGTQTAPGGGCRV-MEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRI 972          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf31 (ring finger protein 31 [Source:MGI Symbol;Acc:MGI:1934704])

HSP 1 Score: 123.635 bits (309), Expect = 1.473e-29
Identity = 92/338 (27.22%), Postives = 159/338 (47.04%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  ++ C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C + NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + +  K   +    + C K+T     GLC  H+KEY+ +LI
Sbjct:  517 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDAYALFHKKLTEAVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRV-MEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLI 850          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf31 (ring finger protein 31 [Source:MGI Symbol;Acc:MGI:1934704])

HSP 1 Score: 123.635 bits (309), Expect = 1.596e-29
Identity = 92/338 (27.22%), Postives = 159/338 (47.04%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  ++ C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C + NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + +  K   +    + C K+T     GLC  H+KEY+ +LI
Sbjct:  671 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDAYALFHKKLTEAVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRV-MEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLI 1004          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf19b (ring finger protein 19B [Source:MGI Symbol;Acc:MGI:1922484])

HSP 1 Score: 62.003 bits (149), Expect = 1.154e-9
Identity = 48/204 (23.53%), Postives = 76/204 (37.25%), Query Frame = 1
Query:  451 CPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTKQNGNQNIFQDFSH-------------NLIDCPKCKAKFY-LDKGGCLHLN 990
            CPLCL   P  +   +L C  + C+ C + ++R  I  S    + CP C E      +  L          +D  L + Y E  +  ++  D +  WC    C Y             C  C +L+C++          CK  WH N+ CD  +Q   Q +     H             ++  CP+C A    ++ G C H+ 
Sbjct:  116 CPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV-PISCPECSE-RLNPHDIRLLL--------ADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVI-------AYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPDDIKPCPRCSAYIIKMNDGSCNHMT 302          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf19b (ring finger protein 19B [Source:MGI Symbol;Acc:MGI:1922484])

HSP 1 Score: 61.6178 bits (148), Expect = 1.327e-9
Identity = 48/205 (23.41%), Postives = 76/205 (37.07%), Query Frame = 1
Query:  451 CPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTKQNGNQNIFQDFSH--------------NLIDCPKCKAKFY-LDKGGCLHLN 990
            CPLCL   P  +   +L C  + C+ C + ++R  I  S    + CP C E      +  L          +D  L + Y E  +  ++  D +  WC    C Y             C  C +L+C++          CK  WH N+ CD  +Q   Q +     H              ++  CP+C A    ++ G C H+ 
Sbjct:  116 CPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV-PISCPECSE-RLNPHDIRLLL--------ADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVI-------AYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCNHMT 303          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf31 (ring finger protein 31 [Source:MGI Symbol;Acc:MGI:1934704])

HSP 1 Score: 55.8398 bits (133), Expect = 2.232e-9
Identity = 33/80 (41.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  928 IDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD 1164
            IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C + NC +  S H HHP+ C ++LRD     L+  +Q 
Sbjct:    3 IDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQG 82          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96EP0|RNF31_HUMAN (E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.812e-29
Identity = 94/338 (27.81%), Postives = 157/338 (46.45%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  +  C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C E NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + I  K        + C K+T     GLC  H+KEY+ +LI
Sbjct:  677 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRV-IEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLI 1010          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q924T7|RNF31_MOUSE (E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.117e-28
Identity = 92/338 (27.22%), Postives = 159/338 (47.04%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHEN-------EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF-VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD------FEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV++A+        ++ +L ++C +C    P ++M  ++ C C  C  C++      +       ++CP+C   +       L + S  +I   +    + Y  + K+++E  + RD   +WC   +CS+GF I      +  CP+C++  C +CK +W E        +F ++ + N      Q +      N IDCPKCK  + L +GGC+H +C +C+H+FC  C   F  +  C + NC +  S H HHP+ C ++LRD     L+  +QD       E P  +       C + +  K   +    + C K+T     GLC  H+KEY+ +LI
Sbjct:  671 DVVEAVRHSQDRAFLRRLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDAYALFHKKLTEAVLMRDPKFLWCA--QCSFGF-IYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRV-MEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLI 1004          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IPJ3|LUBEL_DROME (E3 ubiquitin-protein ligase lubel OS=Drosophila melanogaster OX=7227 GN=LUBEL PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 5.973e-25
Identity = 95/337 (28.19%), Postives = 159/337 (47.18%), Query Frame = 1
Query:  436 ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTS---LYFLSFQEIVNS--DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC----DFTKQNG----NQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREG-CKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXX------PCYKDT------------------GLCTDHFKEYIAALIFK 1317
            +LQ++C LC++ +P+++M +ML C  + CK C K +    I + S +   CP C  PE++   ++      YF +    + S  D  +  ++  K     + +D N  WC   +CS GF  +     ++ CP C  ++C +C+  W   HE   C    ++ ++N      Q + +  + N IDCPKCK ++ L +GGC+H  C +CK EFC  C + F+    C           HAHHP+ C ++LRD    ++  Q+Q   K +N       ++I ++SS +SK         P  K+T                  G+C  H+ EY+A  + K
Sbjct: 2509 MLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCI--QCSSGF-FARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRD----KIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAK 2838          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A2A7Q9|RN19B_MOUSE (E3 ubiquitin-protein ligase RNF19B OS=Mus musculus OX=10090 GN=Rnf19b PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 9.285e-9
Identity = 48/205 (23.41%), Postives = 76/205 (37.07%), Query Frame = 1
Query:  451 CPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTKQNGNQNIFQDFSH--------------NLIDCPKCKAKFY-LDKGGCLHLN 990
            CPLCL   P  +   +L C  + C+ C + ++R  I  S    + CP C E      +  L          +D  L + Y E  +  ++  D +  WC    C Y             C  C +L+C++          CK  WH N+ CD  +Q   Q +     H              ++  CP+C A    ++ G C H+ 
Sbjct:  116 CPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV-PISCPECSE-RLNPHDIRLLL--------ADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVI-------AYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCNHMT 303          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZMZ0|RN19B_HUMAN (E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens OX=9606 GN=RNF19B PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 9.868e-9
Identity = 48/206 (23.30%), Postives = 77/206 (37.38%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTKQNGNQNIFQDFSH--------------NLIDCPKCKAKFY-LDKGGCLHLN 990
            +CPLCL   P  +   +L C  + C+ C + ++R  I  S    + CP C E      +  L          +D  L + Y E  +  ++  D +  WC    C Y             C  C +L+C++          CK  WH N+ CD  +Q   Q +     H              ++  CP+C A    ++ G C H+ 
Sbjct:  118 ECPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV-PISCPECSE-RLNPHDIRLLL--------ADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVI-------AYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCNHMT 306          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2T7NIC0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19059 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.510e-30
Identity = 102/342 (29.82%), Postives = 167/342 (48.83%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSEF-IDRDANTMWCTNDRCSYGFDISNHVNDKIK--CPKCNELSCKKCKNKWHEN-------EFCDFTKQNGNQN----IFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGC--KEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFE------KPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALIFKKN 1323
            DV++A+ +          L ++C +C   +P+SK+ N+ +C C+ C  C K     VI         CP C + +   +     +++F  ++   +  + VY  +E ++ ++ + +D +  WC +  C  GF I++  + ++K  CP C++ +C +CK +W E        +F  +   N   N    + +    N IDCP CK ++ L KGGC+H  C +C HEFC  C + F + G   + +NC M N  HAHHP+ C ++LRD DV  L+  +Q+         P N   T     I  K   + K  + C KD+     GLC  H+KEY+  LI K N
Sbjct: 1448 DVVEAVRNCEDKRSALVYLMQECQICFSHYPMSKIRNLNFCQCKICSDCLKQNFEVVIREKHVRHWTCPLCSKPDLNDEELGSEYINFLGMLLQMQVDKEVYDLFETKVRDWHLQKDPHFRWCAH--CGNGF-IADGGDRQLKMVCPHCSQKTCYQCKKQWEEQHEGVTCEQFAQWKIDNDPNNQAVGLARHLEENGIDCPSCKMRYALAKGGCMHFKCPQCGHEFCSGCCQPFYQRGMCNRLKNCKM-NGLHAHHPRDCFFYLRDCDVQHLQVLLQNANVEFNTVPPANQEETSRCPVIEQKEFDSGKRDESCGKDSGDGLAGLCLLHYKEYLVGLINKNN 1785          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: H2ZW95 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 GN=RNF31 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.232e-30
Identity = 101/338 (29.88%), Postives = 168/338 (49.70%), Query Frame = 1
Query:  382 YDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSE-FIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HEN----EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ------DFEKPKNSTLTL---CDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            +DV++A+      + IK +L ++C +C   FP ++M ++  C C  C  C+K +    +   +   L+CP C +   + +   L + S  +I   D   ++ Y  + K+++E  +  D   +WC++  CS+GF I +    K+ C +C +  C KCK  W   H+     EF ++ ++N      Q +      N I CP CK  + L +GGC+H NC +C+HEFC  C   F +  C  +NC M  + HAHHP+ C ++LRD DV  L+  ++      + E P  +       C + +  K   +    +PC K T     GLC  H+KEY+ +LI
Sbjct:  692 HDVVEAVKQSHDKHFIKRMLSQECAVCFYSFPRNRMQSLTSCECTICPDCFKQYFTITVKEKNIKDLVCPQCSKPEISDEGELLNYFSTLDIQLRDCLDKDAYDLFHKKLTERTLMNDPKFVWCSH--CSFGF-IYDGDQLKVTCLQCKKSFCIKCKRPWEVQHQGITCEEFQNWKRENDPEYQAQGLAAYLKENGIICPHCKFAYALARGGCMHFNCSQCRHEFCSGCYNTFAKNDCTFKNCTMGKTLHAHHPRDCLFYLRDWDVARLQVLLKKDGVNFNMEPPHGTQAAPGGGCRV-LEQKELPSGVKDEPCAKVTPAGYAGLCISHYKEYLVSLI 1025          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: M3ZQS2 (Ring finger protein 31 OS=Xiphophorus maculatus OX=8083 GN=RNF31 PE=4 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 1.535e-29
Identity = 99/333 (29.73%), Postives = 160/333 (48.05%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSEF-IDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCD----FTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDF-----EKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            DV+QA+ +      I+ +L  +CP+CL  FP SKM ++  C C  C  C++      + +     ++CP+C E +         + S  +I   D     VY  + K+++E  + +D   +WC +  C+ GF I++    K+ CP C +  C +CK  W   H++  C+    + ++N      Q +      N I CP+CK ++ L KGGC+H  C +C+H+FC  C   + +  CK   C  P   HAHHP+ C ++LRD D + L++ +Q         P N T T     +  K         PC   T     GLC  H++EY+ +LI
Sbjct:  729 DVVQAVKESQDREFIRRLLNTECPVCLSIFPRSKMQSLTSCQCSVCHECFRQHFTIAVRDKHIRDMVCPACSEPDINDPEQLDSYFSTLDIQLRDCLEHEVYELFHKKLTEHALMKDPKFLWCCH--CTSGF-INDGNQLKVTCPSCRKSFCAQCKKPWEPQHQDVSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPECKFQYALTKGGCMHFTCSQCRHQFCSGCNNPYYKMECKIPQCKFPG-LHAHHPRDCLFYLRDWDADRLQALLQRSGVAFNTDPSNETQTDSCGVMEQKDEGGQPADSPCGLQTQPGQAGLCMKHYREYLVSLI 1057          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: V4A3V4 (RING-type domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_52443 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.195e-29
Identity = 124/417 (29.74%), Postives = 191/417 (45.80%), Query Frame = 1
Query:  172 ISDKAKRQKLSKSLSNIAEINDTDQYDDI---YSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYS----EVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIV---NSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCDFTKQ-----NGNQNIFQDFSH---NLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPM---PNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTL----TLCDIEIYNXXXXXXXXXXPCYKD-----TGLCTDHFKEYIAALIFKKN 1323
            I  K  +  L   +  + E  D  +Y DI    SN R  RT  + ++      G  +       E  S    E+    DVI+A  +          LQ++C +C   FP++K+ ++  C C+ C  C K      + + +  +  CP C   N A  +T+  +L+F  I+     DE  ++++ +K     I +DAN  WC +  C  GF I       + CP C + +C +CK +W   HEN  C+  +Q     + N   F   +H   N IDCP CK ++ L KGGC+H  C +C HEFC  C + F  E      CP+       H HHP+ C +FLRD + + L+  +Q   K  N+ +    + C +    + S +S   + C K+      GLC DH+KEY+  LI K N
Sbjct:   63 IETKLNQIALQPFMDRVWEDEDGSEYSDICNSVSNSR--RTRMVFMEGKLKSWGRAETVIKIVDEELSKSCLEMSSLEDVIEACRNCLGFKTSLGYLQQECEICYTKFPMNKITSLNICQCKLCIECMKQHFEYCVKDMNVKRWSCPVCSRPNMADYDTAQNYLAFLTILIRNYCDEPTQDLFDKKANLWSIQQDANFRWCAH--CETGF-IYQGNQLCMTCPNCYKKTCFRCKKEWEIQHENITCEEFEQWKYDNDPNNQAFGLANHLKENGIDCPSCKMRYSLSKGGCMHFTCPECSHEFCSGCCQPFYHEN----TCPLECVGKGLHCHHPRDCFFFLRDEEPSTLQELLQMHAKSFNTEVSESSSGCPVMEQKERSHSSNYDEACGKEVKEGWAGLCIDHYKEYLVGLINKHN 470          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: V9KFD6 (RING finger protein 31 OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.838e-29
Identity = 102/337 (30.27%), Postives = 160/337 (47.48%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY---YEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HEN----EFCDFTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQF--VREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ----DF--EKPKNSTLTLCD-IEIYNXXXXXXXXXXPCYKD-----TGLCTDHFKEYIAALI 1311
            DV+ +  +    + IK +L   CP+C + FP  KM ++  C C  C  C+K+    ++       L+CP C +    +++  + + S  ++   D   + VY   ++K +   + +D    WC  + CS GF I +    ++ CP+C    C KC   W   H+N    EF D+ + N      Q +      N I CP CK ++ L KGGC+H  C  C+HEFC  C   F  +++ C + NC +  + HAHHP+ C ++LRD  V  L+S ++    DF  E PK +     D   +  +         PC KD      GLC  H+KEY+  LI
Sbjct:  336 DVVDSAKESQDKSFIKRMLSHPCPICFEMFPRHKMQSLTSCECLMCSGCFKEHFTLIVKERHIKDLVCPICGKPEIDEESELINYFSTLDVQLRDCLEKEVYSLFHKKLIERTLMKDPKFKWC--NHCSNGF-IYDGNQLRVTCPQCYHSFCFKCNRPWESQHQNISCDEFQDWKRLNDPEYQAQGLAAYLQDNGIACPGCKFRYALAKGGCMHFTCYFCRHEFCSGCYNTFYGLKKVCPDGNCRLLKALHAHHPRDCLFYLRDWSVERLQSLLKNNKVDFNTEPPKGAQTVPGDKCRVMEQKDTQGNAEVPCSKDAPAGHAGLCLTHYKEYLVWLI 669          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018785.2 (E3 ubiquitin-protein ligase RNF31-like [Source:NCBI gene;Acc:103042649])

HSP 1 Score: 127.487 bits (319), Expect = 7.119e-31
Identity = 119/454 (26.21%), Postives = 193/454 (42.51%), Query Frame = 1
Query:   37 NNLQKLVKQISRMGNTSNKVDRIKATKIMEFFSKMNANKTKKDVDISDKAKRQKLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKK----NEPRIGYRDGPFLDKQEVYSEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTSLYF-LSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC-DFTK-------QNGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ------DFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCY-----KDTGLCTDHFKEYIAALI 1311
             N QK V  I R     N+ ++++  + + F  ++   K               L + L      N   +   IY N   +  + +  +     N P  G         QE  +E     DVIQA+ +    + I  IL+++C +C   FP  KM  + +C C  C  C+       + +     ++CP C  PE+N  +   + +F L  Q  +N +  + +++ +K M   + +D   +WC +  C+ GF I      K+ C  C +  C KCK  W   HE   C DF K       +   Q +      N I CP CK ++ L KGGC+H  C +C++EFC  C   F ++ C    C +   FHAHHP+ C Y+LRD +   L++ +Q      + + P  +   LC   +  +          C         GLC  H++EY+ +LI
Sbjct:  545 GNTQKAVANILR-----NRAEKLRLLRTLGFVDRLACEKALSMSGGDLDGALSHLQRPLLEHFHQNIWKKQPQIYFNINHQDKDRLYRRLLGLYNLPSWGRSQMALTLLQEPDAEY-SVEDVIQAVREHHDKDFINRILKKECQICYASFPQRKMQALTFCQCSMCSECFIQHFTVALRDKHIRDMVCPVCEEPEINDPEALETYFFTLDVQLRLNLEPEVYDLFGKKLMEHTLKKDPKFLWCCH--CTNGF-IYEKDELKVTCQNCRKSFCSKCKKAWEDQHEGLTCNDFQKWKRENDPEYQKQGLVGFLRENGIKCPSCKFQYALAKGGCMHFTCSQCRYEFCCGCNNPFHKKPCPGNQC-ISKGFHAHHPRDCLYYLRDWEPVRLQALLQKHKVEFNTDHPDGTGNGLCG--VMEQKEGGQALDDACGIQVEEGHAGLCDKHYREYLVSLI 986          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014446.2 (ring finger protein 31 [Source:NCBI gene;Acc:103030581])

HSP 1 Score: 121.709 bits (304), Expect = 5.434e-29
Identity = 95/342 (27.78%), Postives = 165/342 (48.25%), Query Frame = 1
Query:  379 PY---DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKKNTSLYF----LSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCD----FTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ------DFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            PY   DV+QA+ +    + I+ +L ++CP+CL  FP SKM ++  C C  C  C+K      + +     ++CP C  P++N  +   S YF    +  +E V  +  +  ++++K   + + +D   +WC++  CSYGF I +    K+ C +C    C +CK  W   H    C+    + ++N      Q +      N I CP C+ ++ L +GGC+H +C +C+++FC  C   F    C    C +    HAHHP+ C ++LRD +   L++ +Q      + +    +   +C + I  K     +    C   T     GLC  H++EY+ +LI
Sbjct:  672 PYTLEDVVQAVRESHDRDFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCSGCFKQHFTIAVRDKHIRDMVCPVCWEPDINNPEHLNS-YFSTLDIQLRECVEPE--VYELFHKKLTEQALIKDPKFLWCSH--CSYGF-IYDGDQLKVTCLQCRNSFCAQCKKPWEAQHNGLSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCSGCNNPF-HTTCAVAQCSV-TGLHAHHPRDCLFYLRDWEPARLQALLQKNGVAYNTDTAPGTQTGVCGV-IEQKDEGPRQTDSACGAQTQPGQAGLCEKHYREYLVSLI 1004          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-181m9.8 (E3 ubiquitin-protein ligase RNF31-like [Source:NCBI gene;Acc:103040600])

HSP 1 Score: 120.553 bits (301), Expect = 1.205e-28
Identity = 114/385 (29.61%), Postives = 173/385 (44.94%), Query Frame = 1
Query:  292 INLKKNE-PRIGYRDGPFLDKQEVYSEVIE-------PYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFA-KKNTSLYFLSFQEIVNS---DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIK--CPKCNELSCKKCKNKW---HENEFCDFTK--QNGNQNIFQD------FSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCK---EQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQD--------FEKPKNSTLTLCDI--EIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            I LKK E   +   +G   +K E++  ++        P DV++A+     +      L   CP+C +     KM  M +C+C FC++C+K +   VI   S    +CP C  P++  A ++  S+ + S  +       D     ++  K   + +    N  WC +  CS+G     H  D+++  CP C + +C  CK+ W   HE   C+  K  Q  N   +Q+       S N IDCPKC+ +F+L KGGCLH  C +C+HEFC  C + F R G        C      HAHHP+ C Y LRD DV  L S +Q         + +   S L    +   ++      S   +PC +       G CT H+KE +  LI
Sbjct:  396 IQLKKFEGSEVLIPEGVRGEKAEMFRSILSLGDCNFNPADVLEAVQACRDLPSALKYLSHDCPICQEQMSFGKMITMTHCSCTFCESCFKAYFSSVIKEKSIVHAVCPMCNQPDVRGAGRREESMEYFSLLDTQIRHYLDPQTHELFQRKLRDQALQEMPNFRWCAH--CSFGL---LHEADRLRMDCPNCGKSTCFNCKSPWASQHEGLSCEKFKEWQQLNSPEYQNSRLELLLSRNKIDCPKCRFRFFLSKGGCLHFKCTQCQHEFCGGCSRPF-RNGSACNFSAECGT-KGLHAHHPRDCLYHLRDWDVARLCSLLQHHGVAHPLIYSQRDGSVLGSQRVVCAVFEHKELGSPREEPCGRVALPEYNGYCTLHYKECLVELI 773          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf144ab (probable E3 ubiquitin-protein ligase RNF144A-B [Source:NCBI gene;Acc:103030723])

HSP 1 Score: 62.003 bits (149), Expect = 3.045e-10
Identity = 48/187 (25.67%), Postives = 73/187 (39.04%), Query Frame = 1
Query:  451 CPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCP--SCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISN---HVNDKIKCPKCNELSCKKCKNKWHENEFCD--------FTKQNGNQNIFQDFSHNLIDCPKCKAKFYLDKG 972
            C LCL  FPL KM ++  C C FC  C K +V  +I       + CP  +CP          L  +  + +V +D   R  Y   +    +  D    WC +  C     +      V   ++CP C+   C  C+  WH  + C            +NG+    ++    +  CPKCK     D+G
Sbjct:   42 CKLCLGEFPLEKMTSISQCQCVFCSLCLKQYVELLIREGLETGISCPDSACPNQG------QLQEIEIEAMVTADVMQR--YKRLQFEREVLLDPCRTWCPSSSCQAVCQLKEAEVRVPQLVQCPLCSLRFCSSCRGDWHIGQACRSSLPIITFLPGENGSICKSEEDEAPIKRCPKCKVYIERDEG 220          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf19b (ring finger protein 19B [Source:NCBI gene;Acc:103021791])

HSP 1 Score: 60.077 bits (144), Expect = 3.562e-9
Identity = 50/210 (23.81%), Postives = 81/210 (38.57%), Query Frame = 1
Query:  430 KDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTKQNGNQNIFQDFSHN------------LIDCPKCKAKFY-LDKGGCLHLN 990
            +D+L+  CPLCL   P  ++  +  C+ + C  C + ++R  I  S   +L CP C E   A +  +L           D  L   Y E  +   +  D +  WC    C +    S        C  C  L C++          CK  WH N+ CD  +Q    ++    +H+            +  CP+C A    ++ G C H+ 
Sbjct:  108 QDLLE--CPLCLVRQPRDQLAELQGCSHRSCLCCLRQYLRIEITESRV-QLSCPECAE-RLAPRQVALIL--------DDPALLEKYEEFLLRRCLASDPDCRWCPAPDCGFAVIASG-------CASCPRLVCRREGCGAEFCYHCKQAWHPNQTCDSARQQRALSLRTHSTHSPSYTAEQGPTDDIKPCPRCGAYIIKMNDGSCNHMT 298          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006434.1 (pep scaffold:Pmarinus_7.0:GL492086:439:5313:1 gene:ENSPMAG00000005812.1 transcript:ENSPMAT00000006434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.159e-11
Identity = 54/166 (32.53%), Postives = 76/166 (45.78%), Query Frame = 1
Query:  730 NTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFC----------DFTKQNGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXX-----XXXXXXXQFVREGCKEQNCPMP---NSFHAHHPKYCAYFLRDLDVNELESQIQD 1164
            N  WC +  C  G  I + +  ++ C  CN+ +C KCK  W   HE   C          D   Q      F     N I CPKCK ++ L KGGC+H  C +CKHE     +    ++   R+   E  C M       HAHHP+ C ++LRD D+  L++ + D
Sbjct:   28 NFRWCAH--CPNG-SIHDALRLRMDCTYCNKSTCSKCKKPWEVQHEGLTCEAFHTWKLDNDPEMQAAGLAAF--LKENGIACPKCKFRYALAKGGCMHFTCGQCKHEFCSGCYNPAAERSVHRDVNPESECGMGCTHMGLHAHHPRDCLHYLRDWDIARLQALLTD 188          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030131-9414])

HSP 1 Score: 60.077 bits (144), Expect = 5.661e-10
Identity = 51/206 (24.76%), Postives = 82/206 (39.81%), Query Frame = 1
Query:  448 KCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKK----------CKNKWHENEFCDFTK------------QNGNQNIFQDFSH--NLIDCPKCKAKFY-LDKGGCLHLN 990
            +CPLCL          +L C  + C  C + ++R  I  S  + + CP C E         L     Q I+ +D TL   Y E  +  F+  D +  WC    C +    +        C  C +L+C++          CK  WH N+ CD  +            Q+ + +  QD +H  ++  CP+C A    ++ G C H+ 
Sbjct:  109 ECPLCLVRRSAEHFPELLSCPHRSCLDCLRQYLRIEISESRVN-ICCPECAER--------LNPHDIQRIL-ADATLMGKYEEFMLRRFLVADPDCRWCPAPDCGFAVIATG-------CASCPKLTCEREGCGTEFCYHCKAMWHPNQTCDAARQQRSATLRLRSIQSASASYSQDGAHADDIKPCPRCAAYIMKMNDGSCNHMT 297          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007741.1 (pep scaffold:Pmarinus_7.0:GL477427:676:25209:1 gene:ENSPMAG00000006996.1 transcript:ENSPMAT00000007741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 4.194e-6
Identity = 43/195 (22.05%), Postives = 78/195 (40.00%), Query Frame = 1
Query:  442 QRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDR-CSYGFDISNHVNDKIKCPKCNELSCKKCKN-KWHENEFCD----FTKQNG-----NQNIFQDFSHNLID--CPKCKAKFYLDKGGCLHL 987
            Q  CP+CL      ++   LYC  + CK+C++ +++  I  +   K    +CP M+   + T  +  +  E    D     +Y    +  +++  +N  WC N + C               C KC+  +C  C   + H    C+    +  + G     + +        LI   CP C A+   ++ GCLH+
Sbjct: 1390 QPTCPICLGVTGEVELLAPLYCTHRCCKSCWRAYLKTSIDQNMLAKC---TCPIMDCPAQPTGAFIRTMME---DDSDRLELYKRALLRGYVESCSNLAWCANPQGCDRVLCKDGTGGHAATCAKCHWSTCFSCSFLEAHCPASCNQIAWWVDEGGYYEGMSSDALSKHLAKLISKPCPSCHAQIEKNE-GCLHM 1577          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO46475 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ03])

HSP 1 Score: 118.242 bits (295), Expect = 2.513e-28
Identity = 94/338 (27.81%), Postives = 159/338 (47.04%), Query Frame = 1
Query:  385 DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPE-MNFAKKNTSLYFLSFQEIVNS---DETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HEN----EFCDFTKQNGNQ----NIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMP-----NSFHAHHPKYCAYFLRDLDVNELESQIQD----FEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            D I A  D   +   K  LQR+C +C+D  P ++M  ML C C+FC  C   +V+++I   +   L+CP+C E  N      +  + +  +I+     D    +++  K     + ++ N  WC++  CS GF        K+ CP C++ +C +CK +W   HE     +F  + + N  +     +      N I+CP CK ++ L KGGC+H  C +C HE+C  C   F R G    +CP+         HAHHP+ C ++LRD D  EL+  + +    F+  + +        +  ++   ++  + C + T     GLC  H+ EY+   +
Sbjct:  624 DSIIAAQDNGDLERSKKFLQRECIVCMDLKPENRMITMLNCQCRFCSDCVSQYVKQIIQEQNIMHLVCPACSEPKNLEDDTVATNYFNLLDILIRPLVDNPTHDLFQRKLRDRTLMKEPNFRWCSH--CSSGFINERPGILKMPCPHCHKYTCFQCKKQWEDQHEGISCEQFAAWKEANDPEAQATGLAAHLKQNGIECPNCKFRYDLAKGGCMHFKCGQCSHEYCSGCYGPF-RHGA---HCPVSPHCAMRGLHAHHPRDCLFYLRDRDPEELQQLLAENNVAFDTEEGAAAAPGHCRVMEQAEAGTEDKE-CGRPTPDGYAGLCRMHYIEYLVERV 954          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016758.2 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101174057])

HSP 1 Score: 125.176 bits (313), Expect = 3.820e-30
Identity = 98/349 (28.08%), Postives = 163/349 (46.70%), Query Frame = 1
Query:  358 VYSEVIEP------YDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVY--YEKRMSEF-IDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCDFTKQ--------NGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ------DFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            V S ++EP       DV+ A+ +    + I+ +L  +CP+CL  FP SKM ++  C C  C  C+       I +     ++CP C E +         + S  +I   D  L +VY  + K+++E  + +D   +WC +  C+ GF I++    K+ C  C++  C KCK  W   H++  C+  +Q           Q +      N I C +C  ++ L KGGC+H  C +C+++FC  C   + +  CK   C  P   HAHHP+ C ++LRD D   L++ +Q      + +    +    C + +  K     +   PC   T     GLC  H++EY+ +LI
Sbjct:  710 VLSLLLEPDVSYSLEDVVHAVKESHDKDFIRRLLNNECPICLSIFPRSKMQSLTSCQCSVCHECFSQHFTVAIRDKHIRDMVCPVCGEPDINDPQQLDSYFSTLDIQLRDCLLHDVYELFHKKLTEHTLMKDPKFLWCCH--CTSGF-INDGDQLKVTCLSCHKSFCAKCKKAWEPQHQDVSCEQFQQWKRDNDPEYQKQGLAGYLRDNGITCLQCGFQYALTKGGCMHFTCSQCRYQFCSGCNNPYHKTACKAPQCSYPG-LHAHHPRDCLFYLRDWDAARLQALLQRNRVGYNTDPSSGAQTDACGV-MEQKDEGGQQVDSPCGVQTQPGQAGLCDKHYREYLVSLI 1053          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028853.1 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101155382])

HSP 1 Score: 122.094 bits (305), Expect = 4.613e-29
Identity = 98/339 (28.91%), Postives = 162/339 (47.79%), Query Frame = 1
Query:  379 PY---DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKK-NTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCD----FTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ----DF--EKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            PY   DV+QA+ +      I+ +L ++CP+CL  FP SKM ++  C C  C  C++      + +     ++CP C  P++N  +  N+    L  Q     +  +  ++++K   + + +D   +WC +  CSYGF I +    K+ C +C    C +CK  W   HE   C+    + ++N      Q +      N I CP C+ ++ L KGGC+H  C +C+++FC  C   F    C    C + +  HAHHP+ C ++LRD +   L++ +Q    DF  E P  +   LC + I  K     +    C   T      LC  H++EY+ +LI
Sbjct:  688 PYSLEDVVQAVRESHDREFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCCDCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLEPEVYELFHKKLTEQALIKDPKFLWCCH--CSYGF-IYDGDQLKVTCFQCRNSFCAQCKKPWEPQHEGLSCEQYQTWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPF-HTTCAVDGCSV-SGLHAHHPRDCLFYLRDWEPARLQALLQNNGVDFNTEPPPGTQTGLCGV-IEQKDEGGQQSDAACGAQTQSGHAALCEKHYREYLVSLI 1020          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000005329.2 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101155382])

HSP 1 Score: 121.709 bits (304), Expect = 5.021e-29
Identity = 98/339 (28.91%), Postives = 162/339 (47.79%), Query Frame = 1
Query:  379 PY---DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKK-NTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCD----FTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ----DF--EKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            PY   DV+QA+ +      I+ +L ++CP+CL  FP SKM ++  C C  C  C++      + +     ++CP C  P++N  +  N+    L  Q     +  +  ++++K   + + +D   +WC +  CSYGF I +    K+ C +C    C +CK  W   HE   C+    + ++N      Q +      N I CP C+ ++ L KGGC+H  C +C+++FC  C   F    C    C + +  HAHHP+ C ++LRD +   L++ +Q    DF  E P  +   LC + I  K     +    C   T      LC  H++EY+ +LI
Sbjct:  688 PYSLEDVVQAVRESHDREFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCCDCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLEPEVYELFHKKLTEQALIKDPKFLWCCH--CSYGF-IYDGDQLKVTCFQCRNSFCAQCKKPWEPQHEGLSCEQYQTWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPF-HTTCAVDGCSV-SGLHAHHPRDCLFYLRDWEPARLQALLQNNGVDFNTEPPPGTQTGLCGV-IEQKDEGGQQSDAACGAQTQSGHAALCEKHYREYLVSLI 1020          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044452.1 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101155382])

HSP 1 Score: 121.709 bits (304), Expect = 5.021e-29
Identity = 98/339 (28.91%), Postives = 162/339 (47.79%), Query Frame = 1
Query:  379 PY---DVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNFAKK-NTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCD----FTKQN----GNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQ----DF--EKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            PY   DV+QA+ +      I+ +L ++CP+CL  FP SKM ++  C C  C  C++      + +     ++CP C  P++N  +  N+    L  Q     +  +  ++++K   + + +D   +WC +  CSYGF I +    K+ C +C    C +CK  W   HE   C+    + ++N      Q +      N I CP C+ ++ L KGGC+H  C +C+++FC  C   F    C    C + +  HAHHP+ C ++LRD +   L++ +Q    DF  E P  +   LC + I  K     +    C   T      LC  H++EY+ +LI
Sbjct:  688 PYSLEDVVQAVRESHDREFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCCDCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLEPEVYELFHKKLTEQALIKDPKFLWCCH--CSYGF-IYDGDQLKVTCFQCRNSFCAQCKKPWEPQHEGLSCEQYQTWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPF-HTTCAVDGCSV-SGLHAHHPRDCLFYLRDWEPARLQALLQNNGVDFNTEPPPGTQTGLCGV-IEQKDEGGQQSDAACGAQTQSGHAALCEKHYREYLVSLI 1020          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: si:dkey-181m9.8 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101162956])

HSP 1 Score: 102.064 bits (253), Expect = 1.452e-22
Identity = 97/362 (26.80%), Postives = 153/362 (42.27%), Query Frame = 1
Query:  340 FLDKQEVYSEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSC--PEMNF--AKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFI-----DRDANTM----WCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKW---HENEFCDFTKQNGNQNIFQDFS----HNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVR-EGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFE------KPKNST------LTLCDIEIYNXXXXXXXXXXPCYKDT-----GLCTDHFKEYIAALI 1311
            FL    +  +   P D ++A+      +     L   CP+C +    SK+  M +C+C  C+ C+  +    I   S D+L+CP C  PE+      ++ + YF       N  +T    Y  + + E       DR    M    WC +  CS+G  +      ++ CP C + +C +C++ W   H+   C+  K    QN           N I+CP C++ F L +GGCLH  C +C+H+FC  C + F     C           HAHHP+ C + LRD  V+ L   +Q +       KP + +        +C   +       SK  +PC + T     G C  H+KE +  LI
Sbjct:  366 FLALMTLQGQSFSPADALEAVQLNKDFSSALKFLTHTCPICHEQVSFSKIVTMTHCSCFLCQVCFTAFFSVAIKERSVDQLVCPQCGKPEVRAQGGLEDATEYF-------NLLDTQIRHYLPRDIHELFQRKLRDRTLREMPDFCWCAH--CSFGI-LHEAERLRMDCPSCKKSTCSRCRSPWAPQHQRLSCEQFKAWQEQNQLDHHGSTPISNSIECPGCRSVFSLARGGCLHFTCTQCQHQFCGGCARTFTAGSACGFSAECGTKGLHAHHPRDCLFHLRDWSVSRLLLLLQHYRISPAWIKPASGSSSDGTQTAVCS--VLELRDDGSKREEPCGRPTPQGFQGYCQLHYKERLVELI 715          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 375/402 (93.28%), Postives = 385/402 (95.77%), Query Frame = 1
Query:   73 MGNTSNKVDRIKATKIMEFFSKMNANKTKKDVDISDKAKRQKLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHENEFCDFTKQNGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDTGLCT 1278
            MGNTSNKVDRIKATKI  FFS MNANKTKKDVD SDK KRQKLSKSL NIAEINDTDQYD+IYSNKRTERTNDIN KKNEPRIGYRDG FLD QEVYSE IEPYDVIQALNDLTKIND+KDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWV+EVIMNSSCDKLLC SCPEMNFAKKNTSL+FLSFQEIVNSDETLRNVYY+KRMSEFIDRDANTMWCTNDRC YGFDISNHVNDKIK PKCNELSCKKCKNKWHE+EF DFTKQNGNQNIFQDFSH LIDCPKCKAKFYL KGGCLHLNCIKCKHEFC+CC KQFVREGCKEQNCPMP++FHAHHPKYCAYFLRDLDVNELESQI+DFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGLCT
Sbjct:    1 MGNTSNKVDRIKATKIRAFFSIMNANKTKKDVDKSDKTKRQKLSKSLPNIAEINDTDQYDEIYSNKRTERTNDINFKKNEPRIGYRDGSFLDNQEVYSEAIEPYDVIQALNDLTKINDLKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVKEVIMNSSCDKLLCSSCPEMNFAKKNTSLHFLSFQEIVNSDETLRNVYYKKRMSEFIDRDANTMWCTNDRCLYGFDISNHVNDKIKSPKCNELSCKKCKNKWHESEFFDFTKQNGNQNIFQDFSHKLIDCPKCKAKFYLTKGGCLHLNCIKCKHEFCDCCNKQFVREGCKEQNCPMPDNFHAHHPKYCAYFLRDLDVNELESQIEDFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGLCT 402          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 356/380 (93.68%), Postives = 366/380 (96.32%), Query Frame = 1
Query:  139 MNANKTKKDVDISDKAKRQKLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCKKCKNKWHENEFCDFTKQNGNQNIFQDFSHNLIDCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDTGLCT 1278
            MNANKTKKDVD SDK KRQKLSKSL NIAEINDTDQYD+IYSNKRTERTNDIN KKNEPRIGYRDG FLD QEVYSE IEPYDVIQALNDLTKIND+KDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWV+EVIMNSSCDKLLC SCPEMNFAKKNTSL+FLSFQEIVNSDETLRNVYY+KRMSEFIDRDANTMWCTNDRC YGFDISNHVNDKIK PKCNELSCKKCKNKWHE+EF DFTKQNGNQNIFQDFSH LIDCPKCKAKFYL KGGCLHLNCIKCKHEFC+CC KQFVREGCKEQNCPMP++FHAHHPKYCAYFLRDLDVNELESQI+DFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGLCT
Sbjct:    1 MNANKTKKDVDKSDKTKRQKLSKSLPNIAEINDTDQYDEIYSNKRTERTNDINFKKNEPRIGYRDGSFLDNQEVYSEAIEPYDVIQALNDLTKINDLKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVKEVIMNSSCDKLLCSSCPEMNFAKKNTSLHFLSFQEIVNSDETLRNVYYKKRMSEFIDRDANTMWCTNDRCLYGFDISNHVNDKIKSPKCNELSCKKCKNKWHESEFFDFTKQNGNQNIFQDFSHKLIDCPKCKAKFYLTKGGCLHLNCIKCKHEFCDCCNKQFVREGCKEQNCPMPDNFHAHHPKYCAYFLRDLDVNELESQIEDFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGLCT 380          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000000587.1 (SMESG000000587.1)

HSP 1 Score: 276.944 bits (707), Expect = 8.722e-87
Identity = 134/158 (84.81%), Postives = 139/158 (87.97%), Query Frame = 1
Query:  361 YSEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCK 834
            Y  VIEPYDVIQALNDLTKINDIK ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDR   G+       +  K P+  +L+ K
Sbjct:  357 YENVIEPYDVIQALNDLTKINDIKYILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDR---GY-------ESYKVPEVKQLTTK 504          

HSP 2 Score: 150.214 bits (378), Expect = 1.988e-39
Identity = 74/80 (92.50%), Postives = 77/80 (96.25%), Query Frame = 1
Query:  139 MNANKTKKDVDISDKAKRQKLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEVIE 378
            MNANKTKKDVDISDKAKRQKLSKSLSNIAEIND DQYD+IYSNKRTERTNDINLKKNEPRIGYRDGPFLD QE+YSEV +
Sbjct:    1 MNANKTKKDVDISDKAKRQKLSKSLSNIAEINDIDQYDEIYSNKRTERTNDINLKKNEPRIGYRDGPFLDNQEIYSEVTD 80          

HSP 3 Score: 89.7373 bits (221), Expect = 7.434e-19
Identity = 55/109 (50.46%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  103 IKATKIMEFFSKMNANKTKKDVDISDKAKRQ-----------------KLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEVIE 378
            I   KI  FFSK+  NKTK DVD SD  K Q                 +LSKSL  IAEINDTDQYD+IYSNK  E+ N + +K NE R  YRD PFL   E+Y+EV +
Sbjct:  140 INLDKIRTFFSKIILNKTKTDVDESDVGKTQIEAKSKKQKFKKIFLQRELSKSLPAIAEINDTDQYDEIYSNKMKEKANVLIIKMNETRNFYRDRPFLGNHEIYAEVTD 248          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000000587.1 (SMESG000000587.1)

HSP 1 Score: 277.33 bits (708), Expect = 9.080e-87
Identity = 134/158 (84.81%), Postives = 139/158 (87.97%), Query Frame = 1
Query:  361 YSEVIEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNELSCK 834
            Y  VIEPYDVIQALNDLTKINDIK ILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDR   G+       +  K P+  +L+ K
Sbjct:  379 YENVIEPYDVIQALNDLTKINDIKYILQRKCPLCLDCFPLSKMHNMLYCACQFCKTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDETLRNVYYEKRMSEFIDRDANTMWCTNDR---GY-------ESYKVPEVKQLTTK 526          

HSP 2 Score: 192.971 bits (489), Expect = 7.007e-55
Identity = 96/102 (94.12%), Postives = 99/102 (97.06%), Query Frame = 1
Query:   73 MGNTSNKVDRIKATKIMEFFSKMNANKTKKDVDISDKAKRQKLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEVIE 378
            MGNTSNKVDRIKATKIMEFFSKMNANKTKKDVDISDKAKRQKLSKSLSNIAEIND DQYD+IYSNKRTERTNDINLKKNEPRIGYRDGPFLD QE+YSEV +
Sbjct:    1 MGNTSNKVDRIKATKIMEFFSKMNANKTKKDVDISDKAKRQKLSKSLSNIAEINDIDQYDEIYSNKRTERTNDINLKKNEPRIGYRDGPFLDNQEIYSEVTD 102          

HSP 3 Score: 89.7373 bits (221), Expect = 8.024e-19
Identity = 58/121 (47.93%), Postives = 69/121 (57.02%), Query Frame = 1
Query:  103 IKATKIMEFFSKMNANKTKKDVDISDKAKRQ-----------------KLSKSLSNIAEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEVIEPYDVIQALNDLT 414
            I   KI  FFSK+  NKTK DVD SD  K Q                 +LSKSL  IAEINDTDQYD+IYSNK  E+ N + +K NE R  YRD PFL   E+Y+EV + Y    + N+ T
Sbjct:  162 INLDKIRTFFSKIILNKTKTDVDESDVGKTQIEAKSKKQKFKKIFLQRELSKSLPAIAEINDTDQYDEIYSNKMKEKANVLIIKMNETRNFYRDRPFLGNHEIYAEVTD-YKATNSGNEST 281          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000000776.1 (SMESG000000776.1)

HSP 1 Score: 229.565 bits (584), Expect = 1.131e-73
Identity = 139/142 (97.89%), Postives = 141/142 (99.30%), Query Frame = 1
Query:  931 DCPKCKAKFYLDKGGCLHLNXXXXXXXXXXXXXXQFVREGCKEQNCPMPNSFHAHHPKYCAYFLRDLDVNELESQIQDFEKPKNSTLTLCDIEIYNXXXXXXXXXXPCYKDTGLCTDHFKEYIAALIFKKNREVYYEKMVSN 1356
            DCPKCKAKFYLDKGGCLHLNCIKCKHEFCECCKKQFVREGCKEQNC MPNSFHAHHPKYCAYFLRDLDVNELESQI+DFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGLCTDHFKEYIAAL+FKKNREVYYEKMVSN
Sbjct:   18 DCPKCKAKFYLDKGGCLHLNCIKCKHEFCECCKKQFVREGCKEQNCSMPNSFHAHHPKYCAYFLRDLDVNELESQIEDFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGLCTDHFKEYIAALVFKKNREVYYEKMVSN 159          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL136295.101.002e-2927.81novel transcript[more]
RNF311.002e-2927.81ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
RNF311.002e-2927.81ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
AL136295.51.002e-2927.81novel transcript[more]
RNF311.398e-2927.81ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C17H11.63.236e-923.27RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.63.236e-923.27RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.63.682e-923.27RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.63.682e-923.27RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.63.818e-923.27RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LUBEL5.959e-2628.19gene:FBgn0031857 transcript:FBtr0331216[more]
LUBEL6.056e-2628.19gene:FBgn0031857 transcript:FBtr0331218[more]
LUBEL6.164e-2628.19gene:FBgn0031857 transcript:FBtr0331220[more]
LUBEL6.922e-2628.19gene:FBgn0031857 transcript:FBtr0331221[more]
ari-11.381e-619.72gene:FBgn0017418 transcript:FBtr0089508[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-181m9.81.000e-2627.67si:dkey-181m9.8 [Source:ZFIN;Acc:ZDB-GENE-070912-3... [more]
FO834800.13.607e-2528.57E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
FO834800.24.406e-1627.20E3 ubiquitin-protein ligase RNF31-like [Source:NCB... [more]
rnf144ab7.944e-924.37ring finger protein 144ab [Source:NCBI gene;Acc:43... [more]
si:ch211-278j3.31.257e-823.79si:ch211-278j3.3 [Source:ZFIN;Acc:ZDB-GENE-041014-... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf312.122e-3129.64ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf315.715e-3128.88ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf317.553e-3128.88ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf318.537e-3128.88ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf319.466e-2828.99ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf311.473e-2927.22ring finger protein 31 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf311.596e-2927.22ring finger protein 31 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf19b1.154e-923.53ring finger protein 19B [Source:MGI Symbol;Acc:MGI... [more]
Rnf19b1.327e-923.41ring finger protein 19B [Source:MGI Symbol;Acc:MGI... [more]
Rnf312.232e-941.25ring finger protein 31 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96EP0|RNF31_HUMAN4.812e-2927.81E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens ... [more]
sp|Q924T7|RNF31_MOUSE1.117e-2827.22E3 ubiquitin-protein ligase RNF31 OS=Mus musculus ... [more]
sp|Q8IPJ3|LUBEL_DROME5.973e-2528.19E3 ubiquitin-protein ligase lubel OS=Drosophila me... [more]
sp|A2A7Q9|RN19B_MOUSE9.285e-923.41E3 ubiquitin-protein ligase RNF19B OS=Mus musculus... [more]
sp|Q6ZMZ0|RN19B_HUMAN9.868e-923.30E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NIC01.510e-3029.82Uncharacterized protein OS=Pomacea canaliculata OX... [more]
H2ZW958.232e-3029.88Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
M3ZQS21.535e-2929.73Ring finger protein 31 OS=Xiphophorus maculatus OX... [more]
V4A3V42.195e-2929.74RING-type domain-containing protein (Fragment) OS=... [more]
V9KFD63.838e-2930.27RING finger protein 31 OS=Callorhinchus milii OX=7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000018785.27.119e-3126.21E3 ubiquitin-protein ligase RNF31-like [Source:NCB... [more]
ENSAMXT00000014446.25.434e-2927.78ring finger protein 31 [Source:NCBI gene;Acc:10303... [more]
si:dkey-181m9.81.205e-2829.61E3 ubiquitin-protein ligase RNF31-like [Source:NCB... [more]
rnf144ab3.045e-1025.67probable E3 ubiquitin-protein ligase RNF144A-B [So... [more]
rnf19b3.562e-923.81ring finger protein 19B [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006434.12.159e-1132.53pep scaffold:Pmarinus_7.0:GL492086:439:5313:1 gene... [more]
rnf19a5.661e-1024.76ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
ENSPMAT00000007741.14.194e-622.05pep scaffold:Pmarinus_7.0:GL477427:676:25209:1 gen... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464752.513e-2827.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016758.23.820e-3028.08E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
ENSORLT00000028853.14.613e-2928.91E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
ENSORLT00000005329.25.021e-2928.91E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
ENSORLT00000044452.15.021e-2928.91E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
si:dkey-181m9.81.452e-2226.80E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036117.10.000e+093.28SMESG000036117.1[more]
SMESG000036117.10.000e+093.68SMESG000036117.1[more]
SMESG000000587.18.722e-8784.81SMESG000000587.1[more]
SMESG000000587.19.080e-8784.81SMESG000000587.1[more]
SMESG000000776.11.131e-7397.89SMESG000000776.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024800 ID=SMED30024800|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1409bp
ATCTATATAAATCTTATATGAGTGCCTTGTAAGTAAAATAATTTACAAAA
GTTAGTGAAGCAAATTTCAAGAATGGGTAATACCAGTAATAAAGTCGATC
GAATAAAGGCTACAAAAATTATGGAATTTTTTTCTAAAATGAATGCTAAT
AAAACGAAAAAAGATGTTGATATCAGTGATAAGGCTAAGAGACAAAAACT
TAGTAAATCTCTATCAAATATAGCAGAAATAAATGACACAGATCAATATG
ATGATATCTATTCGAATAAAAGGACAGAAAGAACAAATGATATTAATTTA
AAAAAGAATGAACCAAGAATTGGTTATCGGGACGGGCCATTTTTGGATAA
ACAAGAAGTTTACTCCGAGGTCATTGAACCTTATGATGTTATTCAAGCCT
TAAATGATTTAACTAAAATAAACGACATAAAAGATATTTTGCAAAGAAAG
TGTCCATTATGTCTTGACTGCTTTCCGTTGTCAAAGATGCATAATATGCT
TTATTGTGCTTGTCAGTTTTGCAAAACTTGTTACAAAGACTGGGTTAGGG
AGGTAATAATGAACAGCAGTTGCGATAAGTTGTTGTGTCCCTCTTGTCCG
GAAATGAATTTTGCAAAAAAAAATACGAGTTTGTATTTCCTTTCTTTCCA
AGAAATAGTTAATTCTGATGAAACTCTGAGAAATGTTTACTATGAGAAAC
GGATGTCTGAATTTATTGATAGAGATGCAAATACTATGTGGTGCACTAAT
GATAGATGCTCATATGGATTTGATATATCTAATCATGTCAATGACAAAAT
TAAATGCCCAAAATGTAATGAATTATCGTGCAAGAAGTGCAAAAATAAAT
GGCATGAAAATGAATTTTGTGATTTTACCAAGCAAAATGGAAATCAAAAT
ATTTTCCAAGACTTCAGTCATAACTTAATTGATTGTCCAAAATGCAAAGC
CAAATTTTATTTAGACAAAGGCGGCTGTTTGCATTTAAATTGTATTAAAT
GCAAACATGAATTCTGTGAATGTTGTAAGAAGCAATTTGTCAGAGAAGGT
TGCAAGGAGCAGAATTGTCCCATGCCCAACAGCTTTCATGCTCACCATCC
GAAATATTGCGCATATTTTCTGAGAGATCTAGATGTAAATGAATTGGAAT
CACAAATCCAGGATTTTGAAAAACCCAAAAATTCAACCTTGACTCTCTGT
GATATTGAAATTTATAACAAATCATCTAAAGCCAGCAAATGCTCCAAACC
CTGTTACAAGGATACAGGGTTATGCACAGATCATTTTAAAGAATACATAG
CCGCATTGATATTCAAAAAAAATCGAGAGGTCTACTATGAAAAAATGGTT
TCTAATTAATCCCTGTTTTGAATTTTTAACACATTAAATTTTTTTGTCTT
CAAAAAAAA
back to top

protein sequence of SMED30024800-orf-1

>SMED30024800-orf-1 ID=SMED30024800-orf-1|Name=SMED30024800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=429bp
MGNTSNKVDRIKATKIMEFFSKMNANKTKKDVDISDKAKRQKLSKSLSNI
AEINDTDQYDDIYSNKRTERTNDINLKKNEPRIGYRDGPFLDKQEVYSEV
IEPYDVIQALNDLTKINDIKDILQRKCPLCLDCFPLSKMHNMLYCACQFC
KTCYKDWVREVIMNSSCDKLLCPSCPEMNFAKKNTSLYFLSFQEIVNSDE
TLRNVYYEKRMSEFIDRDANTMWCTNDRCSYGFDISNHVNDKIKCPKCNE
LSCKKCKNKWHENEFCDFTKQNGNQNIFQDFSHNLIDCPKCKAKFYLDKG
GCLHLNCIKCKHEFCECCKKQFVREGCKEQNCPMPNSFHAHHPKYCAYFL
RDLDVNELESQIQDFEKPKNSTLTLCDIEIYNKSSKASKCSKPCYKDTGL
CTDHFKEYIAALIFKKNREVYYEKMVSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR026254RNF31-like
IPR002867IBR_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0071797LUBAC complex
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002867IBR domainSMARTSM00647ibrneu5coord: 182..244
e-value: 4.5E-7
score: 39.5
IPR002867IBR domainPFAMPF01485IBRcoord: 184..244
e-value: 1.5E-9
score: 37.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 101..195
e-value: 1.9E-8
score: 36.2
IPR026254E3 ubiquitin-protein ligase RNF31-likePANTHERPTHR16004RING FINGER PROTEIN 31-RELATEDcoord: 82..347
NoneNo IPR availablePROSITEPS51873TRIADcoord: 101..323
score: 19.135
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 184..249
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 104..168
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 105..153
score: 9.598