Forkhead box protein F1

Overview
NameForkhead box protein F1
Smed IDSMED30024792
Length (bp)685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead box protein F1 (SMED30024792) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead box protein F1 (SMED30024792) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box protein F1 (SMED30024792) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box protein F1 (SMED30024792) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024792

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024792SMESG000075929.1 SmedASXL_007393SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30024792SMESG000075929.1 dd_Smed_v6_15035_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head marginSMED30024792SMESG000075929.1 KJ934801smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box protein F1 vs. Ensembl Human
Match: FOXF1 (forkhead box F1 [Source:HGNC Symbol;Acc:HGNC:3809])

HSP 1 Score: 139.043 bits (349), Expect = 1.096e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   48 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 152          
BLAST of Forkhead box protein F1 vs. Ensembl Human
Match: FOXF2 (forkhead box F2 [Source:HGNC Symbol;Acc:HGNC:3810])

HSP 1 Score: 138.658 bits (348), Expect = 4.247e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:  100 KPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 204          
BLAST of Forkhead box protein F1 vs. Ensembl Human
Match: FOXL1 (forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817])

HSP 1 Score: 119.783 bits (299), Expect = 9.691e-32
Identity = 54/100 (54.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:  140 TEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPR 439
             E   KPP+SYI+LIAMAIQ +P Q+ TLN IY+++ + F F+    QGW+NSIRHNLSLNDCF+K+P+  GR GKG YWT++     +F     RRR R
Sbjct:   44 AETPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKR 143          
BLAST of Forkhead box protein F1 vs. Ensembl Human
Match: FOXE1 (forkhead box E1 [Source:HGNC Symbol;Acc:HGNC:3806])

HSP 1 Score: 112.079 bits (279), Expect = 1.374e-28
Identity = 47/85 (55.29%), Postives = 66/85 (77.65%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLF 409
            KPP+SYI+LIAMAI  +P ++ TL  IY++++E F F+R   + W+NSIRHNL+LNDCF+KIP+  GR GKG+YW ++ NA  +F
Sbjct:   53 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMF 137          
BLAST of Forkhead box protein F1 vs. Ensembl Human
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 112.849 bits (281), Expect = 2.917e-28
Identity = 55/129 (42.64%), Postives = 83/129 (64.34%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMN-------ENASFLFN----EKCNRRRPRGFRQKLQSIERSSNFTLLSTPH 505
            +KPP+SYI+LI MAIQ +P ++ TLN IY+++ + F F+R   QGW+NSIRHNLSLN+CF+K+P+   + GKG YWT++       EN SFL      +K +  + +  R  L+    +++    +TPH
Sbjct:   71 VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPH 199          
BLAST of Forkhead box protein F1 vs. Ensembl Celegans
Match: let-381 (pep chromosome:WBcel235:I:6320289:6324018:-1 gene:WBGene00002601.1 transcript:F26B1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-381)

HSP 1 Score: 135.961 bits (341), Expect = 4.518e-38
Identity = 61/103 (59.22%), Postives = 78/103 (75.73%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFG---RIGKGHYWTMNENASFLFNEKCNRRRPRGFRQK 454
            KPPFSYI+LIAMAI   P ++ TL EIY YL E+F+FFRGEY GW+NSIRHNLSLN+CF+K+PK  G   R  KGH WT++++  F+  E   RRRPRG++ +
Sbjct:   72 KPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFRGEYAGWRNSIRHNLSLNECFVKLPKDTGESYRGRKGHKWTISDSCEFMLEENGFRRRPRGYKAR 174          
BLAST of Forkhead box protein F1 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 105.916 bits (263), Expect = 2.048e-27
Identity = 50/101 (49.50%), Postives = 67/101 (66.34%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMN---ENASFLFNEKCN-RRRPRGF 445
            KPPFSY +LI MAI+ SP ++ TL  IYEY+  ++ F+R   QGW+NSIRHNLSLN CF+K+P+ F   GKG+YW ++   E+  F+       RRRP   
Sbjct:   93 KPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRRPSSL 193          
BLAST of Forkhead box protein F1 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 106.686 bits (265), Expect = 2.944e-27
Identity = 45/101 (44.55%), Postives = 73/101 (72.28%), Query Frame = 2
Query:  149 YLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQ 451
            + KPP+SYI+LIAM+I  SP ++ TL+EI E++   F++++ ++  W+NSIRHNLSLNDCF+K+ +G G  GKG+YW ++ N   +F+     RR + +++
Sbjct:  125 HAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYKK 225          
BLAST of Forkhead box protein F1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 105.916 bits (263), Expect = 1.393e-26
Identity = 50/112 (44.64%), Postives = 73/112 (65.18%), Query Frame = 2
Query:  137 GTEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIER 472
            GT    KPP+SYISLI MAIQ S  +Q TL+EIY ++ + F +++   Q W+NSIRH+LS NDCF+K+ +   + GKG +WT++E+   +F   C  RR + F+ K +   R
Sbjct:  135 GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSR 246          
BLAST of Forkhead box protein F1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 106.301 bits (264), Expect = 1.434e-26
Identity = 50/112 (44.64%), Postives = 73/112 (65.18%), Query Frame = 2
Query:  137 GTEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIER 472
            GT    KPP+SYISLI MAIQ S  +Q TL+EIY ++ + F +++   Q W+NSIRH+LS NDCF+K+ +   + GKG +WT++E+   +F   C  RR + F+ K +   R
Sbjct:  166 GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSR 277          
BLAST of Forkhead box protein F1 vs. Ensembl Fly
Match: bin (gene:FBgn0045759 transcript:FBtr0076900)

HSP 1 Score: 134.42 bits (337), Expect = 5.584e-36
Identity = 62/111 (55.86%), Postives = 83/111 (74.77%), Query Frame = 2
Query:  137 GTEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGF--GRIGKGHYWTMNENASFLF-NEKCNRRRPRGFRQKLQ 460
            GT    KP  SYI++I  AI+ SP  + TL+EIY YL + ++FFRG Y GWKNS+RHNLSLN+CF K+PKG   G+ GKG+YWT++EN++ LF +E   RRRPRG+R K++
Sbjct:  305 GTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIK 415          
BLAST of Forkhead box protein F1 vs. Ensembl Fly
Match: slp1 (gene:FBgn0003430 transcript:FBtr0077499)

HSP 1 Score: 114.775 bits (286), Expect = 2.875e-30
Identity = 58/136 (42.65%), Postives = 84/136 (61.76%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLF----NEKCNRRRPRGFRQKLQSIERSSNFT--LLSTPHNNGVTFYNYCDIP 544
            KPP+SY +LI MAIQ SP Q+ TLN IY+YL   F +F+   +GW+NSIRHNLSLN CF KIP+ +   GKG+YW ++ +A  +F      K  R+ P   R +L +  R + F+  + ++P+    + Y Y  +P
Sbjct:  120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAY-RQAIFSPMMAASPYGAPASSYGYPAVP 254          
BLAST of Forkhead box protein F1 vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 111.309 bits (277), Expect = 2.030e-29
Identity = 60/147 (40.82%), Postives = 85/147 (57.82%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFY---NYCDIPVHSDAQTNHIYSNS 586
            KPP+SYISL AMAI  SP +   L+EIY ++ + F F+R   Q W+NS+RHNLS NDCFIK+P+   + GKG YWT++  A  +F      RR + FR K Q  +  SN+ L +  +   VT Y       +     A+  H+ +N+
Sbjct:   13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVK-QLEKDISNWKLAAAANTEMVTHYLDDQLTQMAFADPARHGHVLANA 158          
BLAST of Forkhead box protein F1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0300259)

HSP 1 Score: 111.309 bits (277), Expect = 5.280e-28
Identity = 49/109 (44.95%), Postives = 74/109 (67.89%), Query Frame = 2
Query:  146 IYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIER 472
             + KPP+SYISLI MAIQ +P +  TL+EIY+++ + F F+R   Q W+NSIRH+LS NDCF+KIP+   + GKG +WT++ ++  +F   C  RR + F+ + +   R
Sbjct:  207 THAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIR 315          
BLAST of Forkhead box protein F1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0345227)

HSP 1 Score: 111.309 bits (277), Expect = 5.280e-28
Identity = 49/109 (44.95%), Postives = 74/109 (67.89%), Query Frame = 2
Query:  146 IYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIER 472
             + KPP+SYISLI MAIQ +P +  TL+EIY+++ + F F+R   Q W+NSIRH+LS NDCF+KIP+   + GKG +WT++ ++  +F   C  RR + F+ + +   R
Sbjct:  207 THAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIR 315          
BLAST of Forkhead box protein F1 vs. Ensembl Zebrafish
Match: foxf1 (forkhead box F1 [Source:NCBI gene;Acc:566407])

HSP 1 Score: 140.198 bits (352), Expect = 2.965e-39
Identity = 69/107 (64.49%), Postives = 88/107 (82.24%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERS 475
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++ S
Sbjct:   52 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPS 158          
BLAST of Forkhead box protein F1 vs. Ensembl Zebrafish
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 139.813 bits (351), Expect = 3.638e-39
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   58 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEFMFEEGSFRRRPRGFRRKCQALK 162          
BLAST of Forkhead box protein F1 vs. Ensembl Zebrafish
Match: foxf2b (forkhead box F2b [Source:ZFIN;Acc:ZDB-GENE-041001-130])

HSP 1 Score: 138.272 bits (347), Expect = 2.770e-38
Identity = 67/105 (63.81%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ++P ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:  111 KPPYSYIALIVMAIQSAPTKRLTLSEIYQFLQTRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPTSEFMFEEGSFRRRPRGFRRKCQAMK 215          
BLAST of Forkhead box protein F1 vs. Ensembl Zebrafish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 114.775 bits (286), Expect = 6.680e-30
Identity = 51/98 (52.04%), Postives = 70/98 (71.43%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFR 448
            KPP+SYI+LIAMAI+ +P ++ TL+ IY+++ + F ++    QGW+NSIRHNLSLNDCFIK+P+  GR GKG YWT++     +F     RRR R  R
Sbjct:   52 KPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCR 149          
BLAST of Forkhead box protein F1 vs. Ensembl Zebrafish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 114.775 bits (286), Expect = 6.680e-30
Identity = 51/98 (52.04%), Postives = 70/98 (71.43%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFR 448
            KPP+SYI+LIAMAI+ +P ++ TL+ IY+++ + F ++    QGW+NSIRHNLSLNDCFIK+P+  GR GKG YWT++     +F     RRR R  R
Sbjct:   52 KPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCR 149          
BLAST of Forkhead box protein F1 vs. Ensembl Xenopus
Match: ptgs1 (prostaglandin-endoperoxide synthase 1 [Source:Xenbase;Acc:XB-GENE-995315])

HSP 1 Score: 139.428 bits (350), Expect = 7.290e-39
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   62 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 166          
BLAST of Forkhead box protein F1 vs. Ensembl Xenopus
Match: foxf1 (forkhead box F1 [Source:NCBI gene;Acc:734087])

HSP 1 Score: 138.658 bits (348), Expect = 1.177e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   54 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 158          
BLAST of Forkhead box protein F1 vs. Ensembl Xenopus
Match: FOXL1 (forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817])

HSP 1 Score: 117.087 bits (292), Expect = 2.429e-30
Identity = 58/118 (49.15%), Postives = 75/118 (63.56%), Query Frame = 2
Query:  143 EIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPR---------GFRQKLQSIE 469
            E   KPP+SYI+LIAMAI+ SP  + TLN IY+++ + F F+    QGW+NSIRHNLSLNDCFIK+P+  GR GKG YWT++     +F     RRR R         G R K ++ E
Sbjct:   47 EPPQKPPYSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDPKCLDMFENGNFRRRKRKPKPILCQEGKRHKAEAAE 164          
BLAST of Forkhead box protein F1 vs. Ensembl Xenopus
Match: ENSXETT00000015530.1 (forkhead box E1 [Source:NCBI gene;Acc:100038190])

HSP 1 Score: 112.079 bits (279), Expect = 1.345e-28
Identity = 48/86 (55.81%), Postives = 66/86 (76.74%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFN 412
            KPP+SYI+LIAMAI  S  ++ TL  IY++++E F F+R   + W+NSIRHNL+LNDCFIKIP+  GR GKG+YW ++ NA  +F+
Sbjct:   66 KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDPNAEDMFD 151          
BLAST of Forkhead box protein F1 vs. Ensembl Xenopus
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:Xenbase;Acc:XB-GENE-5957388])

HSP 1 Score: 113.235 bits (282), Expect = 1.636e-28
Identity = 50/92 (54.35%), Postives = 68/92 (73.91%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMN-------ENASFL 406
            +KPP+SYI+LI MAIQ +P ++ TLN IY+++ E F F+R   QGW+NSIRHNLSLN+CF+K+P+   + GKG YWT++       EN SFL
Sbjct:   78 VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL 169          
BLAST of Forkhead box protein F1 vs. Ensembl Mouse
Match: Foxf1 (forkhead box F1 [Source:MGI Symbol;Acc:MGI:1347470])

HSP 1 Score: 138.658 bits (348), Expect = 9.809e-39
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   48 KPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 152          
BLAST of Forkhead box protein F1 vs. Ensembl Mouse
Match: Foxf2 (forkhead box F2 [Source:MGI Symbol;Acc:MGI:1347479])

HSP 1 Score: 139.043 bits (349), Expect = 2.247e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:  100 KPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 204          
BLAST of Forkhead box protein F1 vs. Ensembl Mouse
Match: Foxl1 (forkhead box L1 [Source:MGI Symbol;Acc:MGI:1347469])

HSP 1 Score: 118.627 bits (296), Expect = 1.579e-31
Identity = 55/110 (50.00%), Postives = 73/110 (66.36%), Query Frame = 2
Query:  140 TEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
             E   KPP+SYI+LIAMAIQ +P Q+ TLN IY+++ + F F+    QGW+NSIRHNLSLN+CF+K+P+  GR GKG YWT++     +F     RRR R  +    S E
Sbjct:   44 VEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPE 153          
BLAST of Forkhead box protein F1 vs. Ensembl Mouse
Match: Foxe1 (forkhead box E1 [Source:MGI Symbol;Acc:MGI:1353500])

HSP 1 Score: 111.694 bits (278), Expect = 1.473e-28
Identity = 47/86 (54.65%), Postives = 66/86 (76.74%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFN 412
            KPP+SYI+LIAMAI  +P ++ TL  IY++++E F F+R   + W+NSIRHNL+LNDCF+KIP+  GR GKG+YW ++ NA  +F 
Sbjct:   55 KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMFE 140          
BLAST of Forkhead box protein F1 vs. Ensembl Mouse
Match: Foxs1 (forkhead box S1 [Source:MGI Symbol;Acc:MGI:95546])

HSP 1 Score: 109.383 bits (272), Expect = 5.073e-28
Identity = 47/86 (54.65%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFN 412
            KPP+SYI+LIAMAIQ+SP Q+ TL+ IY Y+   F F+R    GW+NSIRHNLSLN+CF+K+P+   + GKG YWT++ +   +F 
Sbjct:   18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQ 103          
BLAST of Forkhead box protein F1 vs. UniProt/SwissProt
Match: sp|A1L1S5|FOXF1_DANRE (Forkhead box protein F1 OS=Danio rerio OX=7955 GN=foxf1 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 2.239e-38
Identity = 69/107 (64.49%), Postives = 88/107 (82.24%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERS 475
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++ S
Sbjct:   52 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPS 158          
BLAST of Forkhead box protein F1 vs. UniProt/SwissProt
Match: sp|Q9W707|FXF1B_XENLA (Forkhead box protein F1-B OS=Xenopus laevis OX=8355 GN=foxf1-b PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.365e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   54 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 158          
BLAST of Forkhead box protein F1 vs. UniProt/SwissProt
Match: sp|Q12946|FOXF1_HUMAN (Forkhead box protein F1 OS=Homo sapiens OX=9606 GN=FOXF1 PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 5.263e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   48 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 152          
BLAST of Forkhead box protein F1 vs. UniProt/SwissProt
Match: sp|Q9W706|FXF1A_XENLA (Forkhead box protein F1-A OS=Xenopus laevis OX=8355 GN=foxf1-a PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 5.494e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   54 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 158          
BLAST of Forkhead box protein F1 vs. UniProt/SwissProt
Match: sp|Q28BS5|FOXF1_XENTR (Forkhead box protein F1 OS=Xenopus tropicalis OX=8364 GN=foxf1 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 6.435e-38
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   54 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 158          
BLAST of Forkhead box protein F1 vs. TrEMBL
Match: S4RI64 (Fork-head domain-containing protein OS=Petromyzon marinus OX=7757 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.646e-44
Identity = 67/100 (67.00%), Postives = 82/100 (82.00%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQK 454
            KPPFSYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CF+K+PKG GR GKGHYWT++  + F+F E   RRRPRGFR K
Sbjct:    6 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRLK 105          
BLAST of Forkhead box protein F1 vs. TrEMBL
Match: S4RI68 (Fork-head domain-containing protein OS=Petromyzon marinus OX=7757 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.737e-44
Identity = 67/100 (67.00%), Postives = 82/100 (82.00%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQK 454
            KPPFSYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CF+K+PKG GR GKGHYWT++  + F+F E   RRRPRGFR K
Sbjct:    5 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRLK 104          
BLAST of Forkhead box protein F1 vs. TrEMBL
Match: A0A2L2YVA8 (Forkhead box protein F1-A (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.208e-44
Identity = 68/102 (66.67%), Postives = 85/102 (83.33%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQ 460
            KPPFSYI+LI MAIQ+SP  + TLNEIYEYL   F+FFRGEY+GWKNS+RHNLSLNDCFIK+PKG GR GKGHYWT++  +  +F +  ++RRPRGF+++ Q
Sbjct:  136 KPPFSYIALIVMAIQSSPTMRLTLNEIYEYLQSRFEFFRGEYKGWKNSVRHNLSLNDCFIKLPKGVGRPGKGHYWTVDPASVTVFQDGSSKRRPRGFKRRCQ 237          
BLAST of Forkhead box protein F1 vs. TrEMBL
Match: H6CSZ6 (FoxF1/2 (Fragment) OS=Lethenteron camtschaticum OX=980415 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.897e-44
Identity = 67/100 (67.00%), Postives = 82/100 (82.00%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQK 454
            KPPFSYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CF+K+PKG GR GKGHYWT++  + F+F E   RRRPRGFR K
Sbjct:   37 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRLK 136          
BLAST of Forkhead box protein F1 vs. TrEMBL
Match: A0A087TN17 (Forkhead box protein F1-A (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_13437 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 5.856e-44
Identity = 74/131 (56.49%), Postives = 98/131 (74.81%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIER-SSNFTLLSTPHNNGVTFYNYCDIP 544
            KPPFSYI+LI MAIQ+SP ++ TL+EIY++L + F FFRGEY GWKNS+RHNLSLNDCFIK+PKG GR GKGHYWT++  +  +F +  ++RRPRGFR+K Q ++R S  +  + TP   G    N  ++P
Sbjct:  223 KPPFSYIALIVMAIQSSPTKKLTLSEIYQFLQQRFSFFRGEYMGWKNSVRHNLSLNDCFIKLPKGLGRPGKGHYWTVDPASVTVFQDGSSKRRPRGFRRKCQDMQRYSMYYQGIPTPPMMGFDMMNQTNMP 353          
BLAST of Forkhead box protein F1 vs. Ensembl Cavefish
Match: foxf1 (forkhead box F1 [Source:NCBI gene;Acc:103037372])

HSP 1 Score: 140.969 bits (354), Expect = 1.041e-39
Identity = 73/128 (57.03%), Postives = 98/128 (76.56%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCD 538
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q++ + S ++++     NG+ F +  D
Sbjct:   49 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQAL-KPSMYSMM-----NGLGFNHLPD 170          
BLAST of Forkhead box protein F1 vs. Ensembl Cavefish
Match: foxf2a (forkhead box protein F2-like [Source:NCBI gene;Acc:103045769])

HSP 1 Score: 139.813 bits (351), Expect = 3.044e-39
Identity = 62/110 (56.36%), Postives = 79/110 (71.82%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNE------------KCNRRRPRGFR 448
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E            KC   +P  +R
Sbjct:   58 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEFMFEEGSFRRRPRGFRRKCQALKPAMYR 167          
BLAST of Forkhead box protein F1 vs. Ensembl Cavefish
Match: foxf2b (forkhead box protein F2 [Source:NCBI gene;Acc:103033774])

HSP 1 Score: 139.428 bits (350), Expect = 3.332e-39
Identity = 57/87 (65.52%), Postives = 74/87 (85.06%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNE 415
            KPP+SYI+LI MAIQ++P ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++ ++ F+F E
Sbjct:   48 KPPYSYIALIVMAIQSAPAKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPSSEFMFEE 134          
BLAST of Forkhead box protein F1 vs. Ensembl Cavefish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 115.931 bits (289), Expect = 7.760e-32
Identity = 51/98 (52.04%), Postives = 72/98 (73.47%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFR 448
            KPP+SYI+LIAMAI+++P ++ TL+ IY+++ ++F F+    QGW+NSIRHNLSLNDCF+K+P+  GR GKG YWT++     +F     RRR R  R
Sbjct:   69 KPPYSYIALIAMAIKSAPEERATLSGIYQFIMDNFPFYHDNKQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPKCLDMFENGNYRRRKRKAR 166          
BLAST of Forkhead box protein F1 vs. Ensembl Cavefish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 111.309 bits (277), Expect = 6.536e-30
Identity = 50/92 (54.35%), Postives = 68/92 (73.91%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMN-------ENASFL 406
            +KPP+SYI+LI MAIQ+S  ++ TLN IY+++ E F F+R   QGW+NSIRHNLSLN+CF+K+P+   + GKG YWT++       EN SFL
Sbjct:   71 VKPPYSYIALITMAIQSSAEKRVTLNGIYQFIMERFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL 162          
BLAST of Forkhead box protein F1 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 155.221 bits (391), Expect = 1.264e-48
Identity = 67/100 (67.00%), Postives = 82/100 (82.00%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQK 454
            KPPFSYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CF+K+PKG GR GKGHYWT++  + F+F E   RRRPRGFR K
Sbjct:    6 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRLK 105          
BLAST of Forkhead box protein F1 vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 154.066 bits (388), Expect = 1.334e-48
Identity = 67/100 (67.00%), Postives = 82/100 (82.00%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQK 454
            KPPFSYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CF+K+PKG GR GKGHYWT++  + F+F E   RRRPRGFR K
Sbjct:    5 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRLK 104          
BLAST of Forkhead box protein F1 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 109.768 bits (273), Expect = 1.691e-30
Identity = 48/92 (52.17%), Postives = 69/92 (75.00%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMN-------ENASFL 406
            +KPP+SYI+LI MAIQ++P ++ TLN IY+++ + F F+R   QGW+NSIRHNLSLN+CF+K+P+   + GKG YW+++       EN SFL
Sbjct:   76 VKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENGSFL 167          
BLAST of Forkhead box protein F1 vs. Ensembl Sea Lamprey
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 109.768 bits (273), Expect = 2.430e-28
Identity = 50/120 (41.67%), Postives = 78/120 (65.00%), Query Frame = 2
Query:  146 IYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFR-QKLQSIERSSNFTLLSTP 502
             + KPP+SYISLI MAIQ S ++  TLNEIY ++ + F F+R   Q W+NSIRH+LS NDCF+K+P+   + GKG +W ++ ++  +F   C  RR + F+  + Q + +  + +  S+P
Sbjct:  158 THAKPPYSYISLITMAIQQSTHKMMTLNEIYSWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKCDRKQKMPQDGSRSPTSSP 277          
BLAST of Forkhead box protein F1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005206.1 (pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 gene:ENSPMAG00000004735.1 transcript:ENSPMAT00000005206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 3.871e-28
Identity = 47/101 (46.53%), Postives = 69/101 (68.32%), Query Frame = 2
Query:  146 IYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFR 448
             + KPP+SYISLI MAIQ S  +  TLNEIY ++++ F F+R   Q W+NSIRH+LS NDCF+K+P+   + GKG +W ++ ++  +F   C  RR + F+
Sbjct:  152 THAKPPYSYISLITMAIQQSSGKMLTLNEIYSWITDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFK 252          
BLAST of Forkhead box protein F1 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 87.8113 bits (216), Expect = 1.114e-20
Identity = 44/113 (38.94%), Postives = 66/113 (58.41%), Query Frame = 2
Query:  149 YLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFT 487
            Y+KPP SY S+I  AI ++P    +L +IY+++S+++ F+R     W+NS+RHNLSLN  F K+PK  G+ GKG  W +++     F  K N         KL  I R ++ T
Sbjct:  301 YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWN-------AGKLSKIRRGASVT 406          
BLAST of Forkhead box protein F1 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 83.9593 bits (206), Expect = 3.387e-19
Identity = 42/95 (44.21%), Postives = 59/95 (62.11%), Query Frame = 2
Query:  143 EIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNR 427
            E+  KPP+SY +LI +AI  S   + TL++IY ++  HF +++ +   W+NSIRHNLSLND FIK  K     GKGH+W +   A   F +  NR
Sbjct:  105 ELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFFKGENR 197          
BLAST of Forkhead box protein F1 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 82.0333 bits (201), Expect = 1.712e-18
Identity = 36/80 (45.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNE 391
            +KPP SY ++I  AI +SP    +L +IY+Y+S ++ ++R    GW+NSIRHNLSLN  F K+P+     GKG  W ++E
Sbjct:  339 VKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISE 418          
BLAST of Forkhead box protein F1 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 54.299 bits (129), Expect = 4.072e-9
Identity = 31/84 (36.90%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  143 EIYLKPPFSYISLIAMAIQA-SPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNE 391
            E   KP  SY +++   I+  S  +  +L+EIY  + E F +++    GW++S+RHNLSLN  F K+ K     GKG  W ++E
Sbjct:  457 EYRTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLDE 536          
BLAST of Forkhead box protein F1 vs. Ensembl Nematostella
Match: EDO39529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S2])

HSP 1 Score: 120.553 bits (301), Expect = 4.034e-35
Identity = 55/100 (55.00%), Postives = 75/100 (75.00%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKG-FGRIGKGHYWTMNENASFLFNEKCNRRRPRGFR 448
            +KPPFSYI+LI M+I+ASPY+  TLNEIYE++   F +FR   Q W+NSIRHNLSLNDCF+K+P+  FG+ GKG+YWT++ +   +F      RRP+ F+
Sbjct:   15 VKPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFVKVPRSIFGKPGKGNYWTLHPSCGDMFGSGSFLRRPKRFK 114          
BLAST of Forkhead box protein F1 vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 113.235 bits (282), Expect = 2.414e-30
Identity = 55/125 (44.00%), Postives = 81/125 (64.80%), Query Frame = 2
Query:  149 YLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTF 523
            + KPP+SYISLI MAIQ SP +  TL+EIY+++ + F ++R   Q W+NSIRH+LS NDCF+K+P+   R GKG YWT++ +   +F   C  RR + F  K +     S+ + +S+  +N VT 
Sbjct:   38 HAKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPDCGNMFENGCYLRRQKRF--KAEKKPDLSHLSKVSSMTHNPVTV 160          
BLAST of Forkhead box protein F1 vs. Ensembl Nematostella
Match: EDO39562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S5])

HSP 1 Score: 108.997 bits (271), Expect = 5.810e-29
Identity = 51/113 (45.13%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLL 493
            KPP+SYISL AMAIQ+SP +  +L+EIY+++ +HF F+R   Q W+NS+RHNLS NDCF+KIP+   + GKG  W ++ +   +F      RR + F+ +    ER+S    L
Sbjct:   13 KPPYSYISLTAMAIQSSPQKMLSLSEIYQFIMDHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPDCGTMFENGSFLRRRKRFKSER---ERTSKLAKL 122          
BLAST of Forkhead box protein F1 vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 102.834 bits (255), Expect = 1.795e-28
Identity = 43/86 (50.00%), Postives = 65/86 (75.58%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFN 412
            KPP+SYI+LI MAI  SP ++ TL++I E++   F ++R ++  W+NSIRHNLSLNDCF+K+P+  G  GKG+YWT++  +  +F+
Sbjct:    3 KPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPASEGMFD 88          
BLAST of Forkhead box protein F1 vs. Ensembl Nematostella
Match: EDO45102 (Forkhead domain protein E; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q3LUS8])

HSP 1 Score: 108.612 bits (270), Expect = 6.665e-28
Identity = 47/86 (54.65%), Postives = 67/86 (77.91%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFN 412
            KPP+SYI+LI MAI +SP +Q TL+EIY+++S+ F F++     WKNSIRHNL+LNDCFIK+P+   R GKG+YWT++  +  +F+
Sbjct:   43 KPPYSYIALICMAITSSPQRQLTLSEIYDFISQRFPFYQTCSIKWKNSIRHNLTLNDCFIKLPREPNRPGKGNYWTIDPTSVDMFD 128          
BLAST of Forkhead box protein F1 vs. Ensembl Medaka
Match: foxf2a (forkhead box protein F2 [Source:NCBI gene;Acc:101168243])

HSP 1 Score: 140.969 bits (354), Expect = 1.006e-39
Identity = 70/105 (66.67%), Postives = 86/105 (81.90%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY+YL   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K QS +
Sbjct:   54 KPPYSYIALIVMAIQSSPSKRLTLSEIYQYLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEFMFEEGSFRRRPRGFRRKCQSFK 158          
BLAST of Forkhead box protein F1 vs. Ensembl Medaka
Match: foxf2 (forkhead box F2 [Source:NCBI gene;Acc:100301612])

HSP 1 Score: 139.813 bits (351), Expect = 2.938e-39
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   57 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEFMFEEGSFRRRPRGFRRKCQALK 161          
BLAST of Forkhead box protein F1 vs. Ensembl Medaka
Match: foxf1 (forkhead box F1 [Source:NCBI gene;Acc:101171563])

HSP 1 Score: 139.428 bits (350), Expect = 4.364e-39
Identity = 68/105 (64.76%), Postives = 87/105 (82.86%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIE 469
            KPP+SYI+LI MAIQ+SP ++ TL+EIY++L   F FFRG YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  + F+F E   RRRPRGFR+K Q+++
Sbjct:   53 KPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALK 157          
BLAST of Forkhead box protein F1 vs. Ensembl Medaka
Match: foxl1 (forkhead box L1 [Source:NCBI gene;Acc:100144369])

HSP 1 Score: 117.472 bits (293), Expect = 2.987e-31
Identity = 53/99 (53.54%), Postives = 71/99 (71.72%), Query Frame = 2
Query:  143 EIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPR 439
            E   KPP+SYI+LIAMAI+++P Q+ TL+ IY+++ + F F+    QGW+NSIRHNLSLNDCFIK+P+  GR GKG YWT++     +F     RRR R
Sbjct:   46 EPPQKPPYSYIALIAMAIKSAPGQRATLSGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPRERGRPGKGSYWTLDTKCLDMFENGNYRRRKR 144          
BLAST of Forkhead box protein F1 vs. Ensembl Medaka
Match: foxc1a (forkhead box C1-A [Source:NCBI gene;Acc:111949083])

HSP 1 Score: 114.39 bits (285), Expect = 3.179e-29
Identity = 51/92 (55.43%), Postives = 68/92 (73.91%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMN-------ENASFL 406
            +KPP+SYI+LI MAIQ SP ++ TLN IY+++ E F F+R   QGW+NSIRHNLSLN+CF+K+P+   + GKG YWT++       EN SFL
Sbjct:   73 VKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL 164          
BLAST of Forkhead box protein F1 vs. Planmine SMEST
Match: SMESG000075929.1 (SMESG000075929.1)

HSP 1 Score: 369.392 bits (947), Expect = 1.146e-131
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = 2
Query:  137 GTEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFCTNSCCNQF 661
            GTEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFCTNSCCNQF
Sbjct:   30 GTEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFCTNSCCNQF 204          

HSP 2 Score: 63.929 bits (154), Expect = 2.379e-12
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3
Query:    9 MKISNSHENLADSQAGDTVDQNIKIALTKG 98
            MKISNSHENLADSQAGDTVDQNIKIALTKG
Sbjct:    1 MKISNSHENLADSQAGDTVDQNIKIALTKG 30          
BLAST of Forkhead box protein F1 vs. Planmine SMEST
Match: SMESG000075929.1 (SMESG000075929.1)

HSP 1 Score: 365.155 bits (936), Expect = 5.178e-130
Identity = 173/173 (100.00%), Postives = 173/173 (100.00%), Query Frame = 2
Query:  143 EIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFCTNSCCNQF 661
            EIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFCTNSCCNQF
Sbjct:   30 EIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFTLLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFCTNSCCNQF 202          

HSP 2 Score: 61.2326 bits (147), Expect = 2.539e-11
Identity = 29/29 (100.00%), Postives = 29/29 (100.00%), Query Frame = 3
Query:    9 MKISNSHENLADSQAGDTVDQNIKIALTK 95
            MKISNSHENLADSQAGDTVDQNIKIALTK
Sbjct:    1 MKISNSHENLADSQAGDTVDQNIKIALTK 29          
BLAST of Forkhead box protein F1 vs. Planmine SMEST
Match: SMESG000066497.1 (SMESG000066497.1)

HSP 1 Score: 139.043 bits (349), Expect = 1.314e-37
Identity = 59/87 (67.82%), Postives = 73/87 (83.91%), Query Frame = 2
Query:  155 KPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNE 415
            KP  SYI+LI MAIQASP ++CTL+EIY YL ++F FF+G YQGWKNS+RHNLSLN+CFIK+PKG GR GKGHYWT++  A F+F +
Sbjct:  290 KPEQSYIALIVMAIQASPIRKCTLSEIYNYLQQNFPFFQGPYQGWKNSVRHNLSLNECFIKLPKGMGRPGKGHYWTIDPTAEFMFED 376          
BLAST of Forkhead box protein F1 vs. Planmine SMEST
Match: SMESG000004239.1 (SMESG000004239.1)

HSP 1 Score: 118.242 bits (295), Expect = 4.323e-31
Identity = 56/112 (50.00%), Postives = 76/112 (67.86%), Query Frame = 2
Query:  152 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFT 487
            +KPP+SYI+LI MAI + P  + TLN IY+++SE F ++R   QGW+NSIRHNLSLN+CFIK+ +G  R GKG YWT++ NA  +F      RR R F+ K  +I   +  T
Sbjct:  145 VKPPYSYIALITMAITSQPDHRITLNGIYQFISERFPYYRENKQGWQNSIRHNLSLNECFIKVSRGDQRSGKGSYWTLHPNAYNMFENGSFLRRRRRFKYKDDTISAEATAT 256          
BLAST of Forkhead box protein F1 vs. Planmine SMEST
Match: SMESG000065670.1 (SMESG000065670.1)

HSP 1 Score: 118.627 bits (296), Expect = 7.826e-31
Identity = 52/111 (46.85%), Postives = 74/111 (66.67%), Query Frame = 2
Query:  146 IYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSS 478
             + KPP+SYISLI MAIQ SP   CTL+EIY+++ +HF ++R   Q W+NSIRH+LS NDCF+K+ +   + GKG YWT++  +  +F   C  RR + F+   + I R S
Sbjct:  105 THAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQS 215          
The following BLAST results are available for this feature:
BLAST of Forkhead box protein F1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXF11.096e-3864.76forkhead box F1 [Source:HGNC Symbol;Acc:HGNC:3809][more]
FOXF24.247e-3864.76forkhead box F2 [Source:HGNC Symbol;Acc:HGNC:3810][more]
FOXL19.691e-3254.00forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817][more]
FOXE11.374e-2855.29forkhead box E1 [Source:HGNC Symbol;Acc:HGNC:3806][more]
FOXC22.917e-2842.64forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-3814.518e-3859.22pep chromosome:WBcel235:I:6320289:6324018:-1 gene:... [more]
fkh-22.048e-2749.50ForKHead transcription factor family [Source:UniP... [more]
unc-1302.944e-2744.55pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
pha-41.393e-2644.64Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.434e-2644.64Defective pharyngeal development protein 4 [Sourc... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bin5.584e-3655.86gene:FBgn0045759 transcript:FBtr0076900[more]
slp12.875e-3042.65gene:FBgn0003430 transcript:FBtr0077499[more]
fd96Cb2.030e-2940.82gene:FBgn0004898 transcript:FBtr0084771[more]
fkh5.280e-2844.95gene:FBgn0000659 transcript:FBtr0300259[more]
fkh5.280e-2844.95gene:FBgn0000659 transcript:FBtr0345227[more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxf12.965e-3964.49forkhead box F1 [Source:NCBI gene;Acc:566407][more]
foxf2a3.638e-3964.76forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2b2.770e-3863.81forkhead box F2b [Source:ZFIN;Acc:ZDB-GENE-041001-... [more]
foxl16.680e-3052.04forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
foxl16.680e-3052.04forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptgs17.290e-3964.76prostaglandin-endoperoxide synthase 1 [Source:Xenb... [more]
foxf11.177e-3864.76forkhead box F1 [Source:NCBI gene;Acc:734087][more]
FOXL12.429e-3049.15forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817][more]
ENSXETT00000015530.11.345e-2855.81forkhead box E1 [Source:NCBI gene;Acc:100038190][more]
myh101.636e-2854.35myosin, heavy chain 10, non-muscle [Source:Xenbase... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxf19.809e-3964.76forkhead box F1 [Source:MGI Symbol;Acc:MGI:1347470... [more]
Foxf22.247e-3864.76forkhead box F2 [Source:MGI Symbol;Acc:MGI:1347479... [more]
Foxl11.579e-3150.00forkhead box L1 [Source:MGI Symbol;Acc:MGI:1347469... [more]
Foxe11.473e-2854.65forkhead box E1 [Source:MGI Symbol;Acc:MGI:1353500... [more]
Foxs15.073e-2854.65forkhead box S1 [Source:MGI Symbol;Acc:MGI:95546][more]
back to top
BLAST of Forkhead box protein F1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1L1S5|FOXF1_DANRE2.239e-3864.49Forkhead box protein F1 OS=Danio rerio OX=7955 GN=... [more]
sp|Q9W707|FXF1B_XENLA4.365e-3864.76Forkhead box protein F1-B OS=Xenopus laevis OX=835... [more]
sp|Q12946|FOXF1_HUMAN5.263e-3864.76Forkhead box protein F1 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9W706|FXF1A_XENLA5.494e-3864.76Forkhead box protein F1-A OS=Xenopus laevis OX=835... [more]
sp|Q28BS5|FOXF1_XENTR6.435e-3864.76Forkhead box protein F1 OS=Xenopus tropicalis OX=8... [more]
back to top
BLAST of Forkhead box protein F1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S4RI641.646e-4467.00Fork-head domain-containing protein OS=Petromyzon ... [more]
S4RI681.737e-4467.00Fork-head domain-containing protein OS=Petromyzon ... [more]
A0A2L2YVA83.208e-4466.67Forkhead box protein F1-A (Fragment) OS=Parasteato... [more]
H6CSZ63.897e-4467.00FoxF1/2 (Fragment) OS=Lethenteron camtschaticum OX... [more]
A0A087TN175.856e-4456.49Forkhead box protein F1-A (Fragment) OS=Stegodyphu... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxf11.041e-3957.03forkhead box F1 [Source:NCBI gene;Acc:103037372][more]
foxf2a3.044e-3956.36forkhead box protein F2-like [Source:NCBI gene;Acc... [more]
foxf2b3.332e-3965.52forkhead box protein F2 [Source:NCBI gene;Acc:1030... [more]
foxl17.760e-3252.04forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
foxc1b6.536e-3054.35forkhead box C1b [Source:NCBI gene;Acc:79375][more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxf2a1.264e-4867.00forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2a1.334e-4867.00forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
FOXC21.691e-3052.17forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
foxa22.430e-2841.67forkhead box A2 [Source:NCBI gene;Acc:30126][more]
ENSPMAT00000005206.13.871e-2846.53pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 ge... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH11.114e-2038.94Forkhead family transcription factor; rate-limitin... [more]
HCM13.387e-1944.21Forkhead transcription factor; drives S-phase acti... [more]
FKH21.712e-1845.00Forkhead family transcription factor; rate-limitin... [more]
FHL14.072e-936.90Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395294.034e-3555.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424922.414e-3044.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395625.810e-2945.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451051.795e-2850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451026.665e-2854.65Forkhead domain protein E; Predicted protein [Sou... [more]
back to top
BLAST of Forkhead box protein F1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxf2a1.006e-3966.67forkhead box protein F2 [Source:NCBI gene;Acc:1011... [more]
foxf22.938e-3964.76forkhead box F2 [Source:NCBI gene;Acc:100301612][more]
foxf14.364e-3964.76forkhead box F1 [Source:NCBI gene;Acc:101171563][more]
foxl12.987e-3153.54forkhead box L1 [Source:NCBI gene;Acc:100144369][more]
foxc1a3.179e-2955.43forkhead box C1-A [Source:NCBI gene;Acc:111949083][more]
back to top
BLAST of Forkhead box protein F1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075929.11.146e-131100.00SMESG000075929.1[more]
SMESG000075929.15.178e-130100.00SMESG000075929.1[more]
SMESG000066497.11.314e-3767.82SMESG000066497.1[more]
SMESG000004239.14.323e-3150.00SMESG000004239.1[more]
SMESG000065670.17.826e-3146.85SMESG000065670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024792 ID=SMED30024792|Name=Forkhead box protein F1|organism=Schmidtea mediterranea sexual|type=transcript|length=685bp
CTTTATCAATGAAAATTTCTAACAGCCACGAAAACCTCGCTGATTCCCAA
GCGGGTGACACTGTGGATCAAAATATTAAAATTGCACTCACTAAAGGTAT
GATTTCTAAATATTATTATTGTTTAATTTACTTTAAGGTACAGAAATATA
TTTAAAACCTCCCTTTTCATACATCTCGTTGATTGCAATGGCAATCCAAG
CTTCTCCCTATCAACAGTGCACATTAAACGAGATATACGAATATTTAAGC
GAACATTTTAAATTCTTCAGAGGCGAGTATCAAGGATGGAAAAATTCAAT
TAGACATAATTTATCTCTCAACGATTGTTTCATCAAAATTCCAAAAGGAT
TTGGAAGAATAGGGAAAGGACATTATTGGACAATGAATGAAAATGCAAGT
TTTTTATTTAATGAAAAGTGCAATCGCAGAAGACCAAGAGGATTTCGACA
AAAATTGCAGTCCATCGAAAGAAGCTCAAATTTTACATTATTATCCACAC
CACATAATAATGGTGTAACGTTTTATAATTATTGTGATATTCCGGTCCAT
AGTGATGCACAAACTAACCACATTTATTCGAATAGTTTTTATTTATCAAA
AAATGAGTGGGAAAATTATTCGAATTGCATGTTTTGCACAAATTCGTGTT
GTAATCAATTTTAATCCAAAAATTTACAAATTTGC
back to top

protein sequence of SMED30024792-orf-1

>SMED30024792-orf-1 ID=SMED30024792-orf-1|Name=SMED30024792-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIK
IPKGFGRIGKGHYWTMNENASFLFNEKCNRRRPRGFRQKLQSIERSSNFT
LLSTPHNNGVTFYNYCDIPVHSDAQTNHIYSNSFYLSKNEWENYSNCMFC
TNSCCNQF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0030154cell differentiation
GO:0030509BMP signaling pathway
GO:0045893positive regulation of transcription, DNA-templated
GO:0048566embryonic digestive tract development
GO:0048745smooth muscle tissue development
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
IPR018122TF_fork_head_CS_1
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
GO:0003705transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 34..51
score: 76.85
coord: 11..28
score: 40.17
IPR001766Fork head domainSMARTSM00339forkneu4coord: 1..78
e-value: 8.8E-34
score: 128.2
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 1..70
e-value: 4.7E-26
score: 90.9
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 1..84
score: 27.156
IPR001766Fork head domainCDDcd00059FHcoord: 1..67
e-value: 3.69295E-36
score: 118.04
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 1..84
e-value: 4.7E-30
score: 105.6
NoneNo IPR availablePANTHERPTHR46262:SF2FORKHEAD BOX PROTEIN BINIOUcoord: 1..93
NoneNo IPR availablePANTHERPTHR46262FAMILY NOT NAMEDcoord: 1..93
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 34..40
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 1..82