Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30024790
Length (bp)1538
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30024790) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30024790) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30024790) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30024790) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043280.1 (uncharacterized LOC100492546 [Source:NCBI gene;Acc:100492546])

HSP 1 Score: 223.787 bits (569), Expect = 4.408e-65
Identity = 127/413 (30.75%), Postives = 226/413 (54.72%), Query Frame = 3
Query:  201 KNHKSSVAAGSSSQ----KVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLR-CFDPTQGIINWKITITS-------IPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESK------KEYDKFSFKHQNRVKEKVSEFYATILDYLKLW 1385
            K H +S     +SQ    K + F K       +  +A +E   A+H  +H+ SF S DCS+ +I+ F++RKFS  +TK   IIT V+A + ++ +L+ +D +S+ ++ TDASN   +K  PV+LR     T+ + + K+ I +          + + T+   ++ VI+K  + D IV  SADN N +FGG++R G NNV  +++  L RN++  GC  HI  N +    +++ +D++ ++ K++  F ++SVR E  K  CE   Q +  + ++S+ R LSL P + ++++ +  L  +F   + CPV ++ +F+DP++  W+ F  ++L LF E++  +E+   T  E +  M  L +K   R+N  F+P + K      +E+  ++     +V    ++FY T L YL  W
Sbjct:   52 KEHSASKRHLKASQTFIVKENSFFKMFLPDASEFSLAFQEGTFAFHTIRHHQSFLSMDCSAGLIKRFYERKFSCSKTKCETIITDVLAKWAEDTVLQDIDKVSYVTLLTDASNSGQVKRYPVLLRYVIIDTKPMGDCKVQIKTKLVDCFETDGETTETLSEDVLQVIRKVLVEDKIVGMSADNMNSDFGGLKRKGTNNVVNRIRESLKRNVIAIGCITHIVHNCAQCSVDMIPLDIQGMVTKIFGFFHVFSVRAECLKEFCEFTSQQWKEIQSYSNVRCLSLLPFLGKVLQHYAALKSFFLAEEKCPVVLKKWFSDPSTLLWLEFANSSLCLFQETVNKVENQEGTAIESSVIMNDLIQKITVRRNENFIPPKVKTILSSMEEHGSYTIACFFKVS---NDFYTTALQYLNAW 461          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A2S2Q4N2 (Uncharacterized protein OS=Sipha flava OX=143950 GN=g.163685 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.167e-92
Identity = 159/417 (38.13%), Postives = 250/417 (59.95%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKK---EYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMY 1421
            I +H++ K H  +V++ SSS KV++F   ++ +NE   IAA+E   AYH   HN SFRS DC+++II+  +++KFS  RTK   II  VIAPF   ++L  +  + F +I  D SNHKN+K++P+++R F+P +G+    +   ++  + S+ + + I++V++K +L + +VA+S DN N NFGGV R G NNV+  L   L RNI G GC AHI  NA  +  +IL  D+E II K++++F IY+VR E  K  C+ +   Y  +L    TR+LSL+PAV R+I+L+  L  YF + + CP  ++ FFNDP S  W+ F+ + LK+  ++I+ +E  +I+  EV   +++L  K  NRKN  F   E  +   + +K     + +  E   EFY T L Y++ W    +   VF +
Sbjct:   25 ITQHVKQKKHLLAVSS-SSSNKVTNFFTNVQSTNESKRIAAEEGLFAYHTIIHNHSFRSMDCTTSIIKKIYEKKFSCARTKCESIIVNVIAPFAIQQMLDELKSVKFLTIMVDTSNHKNLKLVPILIRYFNPQEGVKIKVLEFMNLKGETSNILSDYILNVLKKYSLLNNVVAFSGDNCNTNFGGVSRKGTNNVFAILNEKLKRNISGIGCAAHILHNAMHSSADILPTDIELIINKIFQYFHIYTVRIEKLKDFCDFVSIEYKNILGSVKTRWLSLQPAVSRIIDLYPALKSYFMSQEKCPTVLRTFFNDPISMAWLYFVQSQLKVVCDTIKRIEGDHISAGEVYEEIEVLCGKIKNRKNQHFFTSELAQLISDLEKNKLYSEKKFIEITDEFYDTFLSYVEKWGYHFEPLKVFRW 440          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A2D4KG82 (Dimer_Tnp_hAT domain-containing protein (Fragment) OS=Micrurus paraensis OX=1970185 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.421e-90
Identity = 146/405 (36.05%), Postives = 243/405 (60.00%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLP---HESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLW 1385
            I KH+ET+ HK  +   +S+ K+ +F ++     E+  +A  E  +++HA  HN SFRS DC+S +++  F+  F+ GRTK+  I+  V++P+  +++ K ++ I+F SI +DA NHK+I + P ++R FD   GI    +   S+P + S  + ++I+++++KNNL   ++AY ADNTN NFGG  R G NN+  KL ++L +NI+G GC AHI  N      ++L +D+E I+ K+Y +F IY+VR E  K  CE  E  Y  +L +S TR+L+L PAV R++++++ L  YF +   CP  ++ FF   +SK W+ F+ N   LF  +I+ +E   I+  EVAN +  LK ++  +    FLP     S  + ++    ++  + + V +FY+  +DYL+ W
Sbjct:   68 ISKHLETQKHKRCLNTAASTSKIQEFFRKTTYGEEEKKLALAEGLMSFHAINHNHSFRSMDCTSQVVKKLFNENFACGRTKSEAIVCNVLSPYAFSELKKKLEKINFISIYSDAFNHKDINLFPTIIRFFDSETGIKIRILDFVSLPGETSEIIFSSIINILEKNNLKHKLIAYCADNTNANFGGKARRGTNNILYKLNKNLSQNIIGVGCAAHIIHNTIQTAADLLPIDVENIVTKIYSYFYIYTVRVEMLKEFCETAEVEYQKILGYSKTRWLALLPAVERILKIYDSLKSYFLSQDKCPRILEEFFEKESSKIWLEFVHNQAALFQNAIKLIEGDKISVIEVANEVNNLKFQYQEQLENNFLPLIIRNSISQLEEQGAINRADIMKHVKKFYSNCIDYLEEW 472          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A2D4KG64 (KRAB domain-containing protein (Fragment) OS=Micrurus paraensis OX=1970185 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.027e-88
Identity = 146/405 (36.05%), Postives = 242/405 (59.75%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLP---HESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLW 1385
            I KH++T+ HK  +   +SS K+ +F       +E+  +A  E  +++HA  HN SFRS DC+S +++  F+  F+ GRTK+  I+  V++P+  +++ K ++ I+F SI +DA NHK+I + P ++R FD   GI    +   S+P + S  + ++I+++++KNNL   ++AY ADNTN NFGG  R G NN+  KL ++L +NI+G GC AHI  N      ++L +D+E I+ K+Y +F IY+VR E  K  CE  E  Y  +L +S TR+L+L PAV R++++++ L  YF +   CP  ++ FF   +SK W+ F+ N   LF  +I+ +E   I+  EVAN +  LK ++  +    FLP     S  + ++    ++  + + V +FY+  +DYL+ W
Sbjct:  128 ISKHLKTQKHKRYLNTAASSSKIQEFFPETTYGDEENKLALAEGLMSFHAINHNHSFRSMDCTSQVVKKLFNENFACGRTKSEAIVCNVLSPYAFSELKKKLEKINFISIYSDAFNHKDINLFPTIIRFFDSETGIKIRILDFVSLPGETSEIIFSSIINILEKNNLKHKLIAYCADNTNANFGGKARRGTNNILYKLNKNLSQNIIGVGCAAHIIHNTIQTAADLLPIDVENIVTKIYSYFYIYTVRVEMLKEFCETAEVEYQKILGYSKTRWLALLPAVERILKIYDSLKSYFLSQDKCPRILEEFFEKESSKIWLEFVHNQAALFQNAIKLIEGDKISVIEVANEVNNLKFQYQEQLENNFLPLIIRNSISQLEEQGAINRADIMKHVKKFYSNCIDYLEEW 532          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A2D4EP51 (KRAB domain-containing protein (Fragment) OS=Micrurus corallinus OX=54390 PE=4 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 2.015e-86
Identity = 130/323 (40.25%), Postives = 209/323 (64.71%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICN 1148
            I KH+ET+ HK  +   +S+ K+ +F ++    NE+  +A  E  +++HA  HN SFRS DC+S +++  F+  F+ GRTK+  I+  V++P+  +++ K ++ I+F SI +D SNHK+IK+ P ++R FD   GI    +   S+P + S  + ++I+++++KNN+ D I+AY ADNTN NFGG  R G NN++ KL ++L +NI+G GC AHI  NA     ++L VD+E I++K+Y +F IY+VR E  K  CE  E  Y  LL +S TR+++L PAV R++++++PL  YF +   CP  ++ FF   +SK W+ F+ N
Sbjct:  135 ISKHLETQKHKRCLNTAASTSKIQEFFRKTTYGNEEKKLALAEGLMSFHAINHNHSFRSMDCTSQVVKKLFNENFACGRTKSEAIVCNVLSPYAFSELKKKLEKINFISIYSDTSNHKDIKLFPTIIRFFDLETGIKIRILDFVSLPGETSEIIFSSIINILEKNNVKDKIIAYCADNTNANFGGKVRRGTNNIFYKLNKNLNQNIIGVGCAAHIIHNAIQTAADLLPVDVENIVIKIYSYFYIYTVRVEMLKEFCETAEVEYQKLLGYSKTRWIALLPAVERILKIYDPLKSYFLSQDKCPRILEEFFEKESSKIWLEFVHN 457          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A2H6NDB0 (Uncharacterized protein (Fragment) OS=Micrurus lemniscatus carvalhoi OX=129465 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 8.174e-86
Identity = 129/323 (39.94%), Postives = 209/323 (64.71%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICN 1148
            I KH++T+ HK  +   +SS K+ +F ++    +E+  +A  E  +++HA  HN SFRS DC+S +++  F+ KF+ GRTK+  I+  V++P+  +++ K ++ I+F SI +DASNHK+IK+ P ++R FD   GI    +   S+P + S  + ++I+++++KNNL   ++AY ADNTN NFGG  R+G NN+  KL ++L + I+G GC AHI  NA     ++L VD+E I++K+Y +F IY+VR E  K  CE  E  Y  LL +S TR+++L PAV R++++++PL  YF +   CP  ++ FF   +SK W+ F+ N
Sbjct:   79 ISKHLKTQKHKRYLNTAASSSKIQEFFRKTTYGDEEKKLALAEGLMSFHAVNHNHSFRSMDCTSQVVKKLFNEKFACGRTKSEAIVCNVLSPYAFSELNKNLEKINFISIYSDASNHKDIKLFPTIIRFFDLETGIKIRILDFVSLPGETSEIIFSSIINILEKNNLKHKLIAYCADNTNTNFGGKARSGTNNILYKLNKNLSQKIIGVGCAAHIIHNAIQTAADLLPVDVENIVIKIYSYFYIYTVRIEMLKEFCETAEVEYQKLLGYSKTRWIALLPAVERILKIYDPLKSYFLSQDKCPRILEEFFEKESSKIWLEFVHN 401          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051257.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001235.1:256137:262891:1 gene:ENSAMXG00000033420.1 transcript:ENSAMXT00000051257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 1.098e-55
Identity = 132/421 (31.35%), Postives = 222/421 (52.73%), Query Frame = 3
Query:  174 YRIMKHIETKNHKSSVAAGSSSQKVSDFL-KRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFD-----RKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNL-CDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTL--KSCPVSI-------QNFFNDPTS-KFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLW 1385
            Y + +H + + HK  VA    SQ +  FL K  + SN D + AA+ +++ YH  KH++S+RS DC + +    F      +K S GRTK A ++T V+AP       K      F S+ +DASNH   K+ P+ LR + P  G+ +  +      ++ ++T+   I   +++N L  DMI AY+ADN ++N+G       N+V++KL+ D    I+   C AHI  N +    ++L VD+++++ K++ HFS+ + RTE  K +   +E+ Y ++  H  TR+LSL PAV+RL + +  +  YF +L    CP ++       Q+    P   + ++ F+ N LK+F++ +  +E  + T  E+ + M  LK K   R+   F   E+     +F  +    +K   S FY T L+YL+ W
Sbjct:   54 YDVKRHRQCETHKKRVAQKEVSQSMHTFLLKPKQDSNVDKVTAAELTSV-YHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKKAHT-PFFSVASDASNHGTTKLFPLSLRYWTPKLGLKSKILDFYEDSHESAATIHCQITSKLEENGLQLDMISAYTADNASVNYGK-----NNSVFQKLKAD-NSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLSLGENQCPKALWKLLKTDQDGEGQPLELQAYLAFLNNILKIFHDVVLLLEGQDGTVCELYDIMLTLKTKLQQRQIDCFFGMETSAILQQFPDQKAATIKHDFSNFYKTALNYLEKW 466          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041838.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29525919:29530293:-1 gene:ENSAMXG00000031975.1 transcript:ENSAMXT00000041838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 1.722e-52
Identity = 128/411 (31.14%), Postives = 217/411 (52.80%), Query Frame = 3
Query:  174 YRIMKHIETKNHKSSVAAGSSSQKVSDFL-KRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFD-----RKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNL-CDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLW 1385
            Y + +H + + HK  VA    SQ +  FL K  + SN D + AA+ +++ YH  KH++S+RS DC + +    F      +K S GRTK A ++T V+AP       K      F S+ +DASNH   K+ P+ LR + P   + +  +      ++ ++T+   I   +++N L  DMI AY+ADN ++N+G       N+V++KL+ D    I+   C AHI  N +    ++L VD+++++ K++ HFS+ + RTE  K +   +E+ Y ++  H  TR+LSL PAV+RL + +  +  YF +L       +N +     + ++ F+ N LK+F++ +  +E  + T  E+ + M  LK K   R+   F   E+     +F  +    +K   S FY T L+YL+ W
Sbjct:   52 YDVKRHRQCETHKKRVAQKEVSQSMHTFLLKPKQDSNVDKVTAAELTSV-YHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKKAHT-PFFSVASDASNHGTTKLFPLSLRYWTP--KLESKILDFYEDSHESAATIHCQITSKLEENGLQLDMISAYTADNASVNYGK-----NNSVFQKLKAD-NSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLSLG------ENQWATLELQAYLAFLNNILKIFHDVVLLLEGQDGTVCELYDIMLTLKTKLQQRQIDCFFGMETSAILQQFPDQKAATIKHDFSNFYKTALNYLEKW 446          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:33864003:33865857:-1 gene:ENSAMXG00000029392.1 transcript:ENSAMXT00000029907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 3.248e-47
Identity = 113/356 (31.74%), Postives = 191/356 (53.65%), Query Frame = 3
Query:  174 YRIMKHIETKNHKSSVAAGSSSQKVSDFL-KRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFD-----RKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNL-CDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTL--KSCPVSI-------QNFFNDPTS-KFWILFICNNLKLFNESIRAMES 1190
            Y + +H + + HK  VA    SQ +  FL K  + SN D + AA+ +++ YH  KH++S+RS DC + +    F      +K S GRTK A ++T V+AP       K      F S+ +DASNH   K LP V    D   G+ +  +      ++ ++T+   I   +++N L  DMI AY+ADN ++N+G       N+V++KL+ D    I+   C AHI  N +    ++L VD+++++ K++ HFS+ + RTE  K +   +E+ Y ++  H  TR+LSL PAV+RL + +  +  YF +L    CP ++       Q+    P   + ++ F+ N LK+F++ +  +E+
Sbjct:   40 YDVKRHRQCETHKKRVAQKEVSQSMHTFLLKPKQDSNVDKVTAAELTSV-YHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKKAHT-PFFSVASDASNHGTTKTLPTVFEILDTKAGLKSKILDFYEDSHESAATIHCQITSKLEENGLQLDMISAYTADNASVNYGK-----NNSVFQKLKAD-NSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLSLGENQCPKALWKLLKTDQDGEGQPLELQAYLAFLNNILKIFHDVVLLLEA 387          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:18990267:18996294:-1 gene:ENSAMXG00000041866.1 transcript:ENSAMXT00000048878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 4.817e-47
Identity = 123/413 (29.78%), Postives = 205/413 (49.64%), Query Frame = 3
Query:  174 YRIMKHIETKNHKSSVAAGSSSQKVSDFL-KRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFD-----RKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNL-CDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTL--KSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLW 1385
            Y + +H + + HK  VA    SQ +  FL K  + SN D + AA+ +++ YH  KH++S+RS DC + +    F      +K S GRTK A ++T V+AP       K      F S+ +DASNH   K+ P+ LR + P  G+ +  +      ++ ++T+   I   +++N L  DMI AY+ADN ++N+G       N+V++KL+ D    I+   C AHI  N +    ++L VD+++++ K++ HFS+ + RTE  K +   +E+ Y ++  H  TR+LSL PAV+RL + +  +  YF +L    CP ++           W L   +     +   + +E               L+ K   R+   F   E+     +F  +    +K   S FY T L+YL+ W
Sbjct:   35 YDVKRHRQCETHKKRVAQKEVSQSMHTFLLKPKQDSNVDKVTAAELTSV-YHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKKAHT-PFFSVASDASNHGTTKLFPLSLRYWTPKLGLKSKILDFYEDSHESAATIHCQITSKLEENGLQLDMISAYTADNASVNYGK-----NNSVFQKLKAD-NSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLSLGENQCPKAL-----------WKLLKTDQ----DGEGQPLE---------------LQTKLQQRQIDCFFGMETSAILQQFPDQKAATIKHDFSNFYKTALNYLEKW 409          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030070.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001920.1:87523:93776:-1 gene:ENSAMXG00000033236.1 transcript:ENSAMXT00000030070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 1.413e-43
Identity = 116/422 (27.49%), Postives = 207/422 (49.05%), Query Frame = 3
Query:  189 HIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFD-----RKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNL-CDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNA--------SSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTL--KSCPVSIQNFFN--------DPTSKFWIL-FICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLK 1379
            H +TK H + +     ++ +S F+  I+  +E+  IA  E    YH  +H  ++ S DC + +    F       K S GRTK+  ++  V+APF   ++   +  + + ++ +DASN  + K+ P  ++ F  ++G+    +     P++ S  +   I+ + + + L  + I AY ADN ++N+G       N+V++KL R++  +I+   C  H+  NA        SS+GC     D+EA ++K+Y  FS  + + E  K  CE     Y  +L H  TR+LSL PA++R++E +  L  YF +L    CP  +  F          D T    IL F+ N ++ F+ SIR +ES + T  +V + M  L+ +   R+   F   ++K+     S + Q+  +  V  F+   + Y++
Sbjct:   48 HAKTKKHLNRMQTTRQTRGISSFM--IKKDSEEDKIAVAELTSTYHGVRHGHNYLSTDCGNKVSAKIFSDSNIATKMSCGRTKSEALVENVLAPFSQERLAAELQKVHYFAVCSDASNSGHTKLFPYTVQYFCASEGVKCGLLDFYEDPDESSEAIFKQIVSITENSGLSVNQISAYGADNASVNYGR-----HNSVFQKL-REVNPHILKGNCKCHMINNAVKTANRVFSSSGC-----DVEAFVLKVYSEFSCSAKKVEVLKEFCEFTSTKYREILRHVPTRWLSLLPAIQRILECWPALKSYFLSLGKDDCPSIVWTFVGGASDTEHVDHTMAECILAFMHNVMQEFDSSIRKLESDSATVIDVYSVMNRLRNQLNARRTDRFYGSKAKQITRSLSPQQQDHFRSLVDRFFEKAVLYIE 456          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO43282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ18])

HSP 1 Score: 105.145 bits (261), Expect = 6.069e-24
Identity = 86/363 (23.69%), Postives = 164/363 (45.18%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFD-----RKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIIN---WKITITSIPNDQSSTVCNTIMDVIQKNNL-CDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAG----CEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGT---LKSCP--VSIQNFFNDPTSKFWILFICNNLKLFNESIRAM--ESSNITCF 1208
            + +H+    HK +    S  + V  F   +    +D +  A+     Y   +HN+ F S   +  + R  F      +K+    TKTA I+   +AP + + +++ +    F+     +S+     M P+V+R +D  +G +    W + + S    Q   + N++ DV +   +  + ++  S DN ++N G       N +++  +R    ++   GC  HI  N +S G     E    DL   +V +Y +F   + R  S K  C+  +Q Y  +L + +TR+LS E  V R+++ +  L  YF +   L+S      ++ +F DP ++  ++F  + L +F+E  + +  E   I C 
Sbjct:   18 VDRHLAGTEHKRASKTTSEHKSVKSFF--VADKQKDAVTNAEVLYTGY-ILEHNLPFESTAHAGELFRKMFPDSEIAKKYGCAPTKTAAIVNYALAPEMLDPVVQYIKTQPFSLAIDGSSDTGTASMYPLVVRIYDVNRGEVASQFWHMCLISDCTAQG--IFNSVSDVFRDYEVPWENVIGLSLDNASVNMG-----KHNGLYRHFERK-NASVYTFGCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSLQSYFASQPELRSDKRLCRLREYFADPXTEIHLMFFQSILPVFSELNKQLQGEEPQIHCL 369          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO46688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPH8])

HSP 1 Score: 62.3882 bits (150), Expect = 1.819e-10
Identity = 44/164 (26.83%), Postives = 79/164 (48.17%), Query Frame = 3
Query:  750 QNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGC----EILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGT---LKSCP--VSIQNFFNDPTSKFWILFICNNLKLFNESIRAM--ESSNITCF 1208
             N +++  +R    ++   GC  HI  N +S G     E    DL   +V +Y +F   + R  S K  C+  +Q Y  +L + +TR+LS E  V R+++ +  L  YF +   L+S      ++ +F DP ++  ++F  + L +F+E  + +  E   I C 
Sbjct:    4 HNGLYRHFERK-NASVYTFGCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSLQSYFASQPELRSDKRLCRLREYFADPKTEIHLMFFQSILPVFSELNKQLQGEEPQIHCL 166          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO32936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN6])

HSP 1 Score: 62.7734 bits (151), Expect = 2.150e-10
Identity = 44/163 (26.99%), Postives = 79/163 (48.47%), Query Frame = 3
Query:  750 QNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGC----EILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGT---LKSCP--VSIQNFFNDPTSKFWILFICNNLKLFNESIRAM--ESSNITC 1205
             N +++  +R    ++   GC  HI  N +S G     E    DL   +V +Y +F   + R  S K  C+  +Q Y  +L + +TR+LS E  V R+++ +  L  YF +   L+S      ++ +F DP ++  ++F  + L +F+E  + +  E   I C
Sbjct:  437 HNALYRHFERK-NASVYTFGCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSLQSYFASQPELRSDKRLCRLREYFADPKTEIHLMFFQSILPVFSELNKQLQGEEPQIHC 598          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO36298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX5])

HSP 1 Score: 54.6842 bits (130), Expect = 6.894e-8
Identity = 58/233 (24.89%), Postives = 106/233 (45.49%), Query Frame = 3
Query:  516 DASNHKNI-KMLPVVLRCFDPT-----QGIINWKITITSIPNDQSSTV--CNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRN--IVGNGCCAHI----APNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYF-GTLKSCPV--SIQNFFNDPTSKFWILFICNNLKLF 1163
            D SN     KM P+ +R +D          ++  +T      D  +++  C T +D+  +N      VA+  DN ++N G  +RN        + R   +N  +  +GC  H+    A  AS+A  E    D++ ++V ++  F   + R        +  +Q Y  +L + STR+LS+E  V  L++ +  L  YF    +S P    ++  F +P ++ ++LF    L++F
Sbjct:  160 DGSNDNGTQKMNPLTVRIYDSQLQRVKTSFLDICMTSGGTAEDIFASIDGCLTSLDIPWQN-----CVAFGVDNASVNVG--KRN------SIMTRGQSKNDVVYFSGCQCHVVHSTAMEASTALTEATGFDVQDLMVDVFYWFDQSTKRKAKLVEYAQFCDQEYRKILKYGSTRWLSMEKVVTLLLKQYHTLRSYFLSEGESAPRFKRLEVAFRNPMTEVYLLFYQAALQIF 379          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000015033.1 (SMESG000015033.1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 388/417 (93.05%), Postives = 392/417 (94.00%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMYFLM 1430
            IMKHIETKNHKSSVAAGSSSQKVSDF KRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTA IITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPN+QSSTVCNT MDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVW+KLQRDLGRNIVGNGCCAHIA NAS                KLYKHFSIYSVRTESFKSLCEEMEQIYM LLNHSSTRFLSLEPAV+RLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNIT FEVANHMKI KEK VNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFM+ LM
Sbjct:   50 IMKHIETKNHKSSVAAGSSSQKVSDFFKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAAIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNNQSSTVCNTKMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWRKLQRDLGRNIVGNGCCAHIAHNASK---------------KLYKHFSIYSVRTESFKSLCEEMEQIYMPLLNHSSTRFLSLEPAVQRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITSFEVANHMKIPKEKLVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMWMLM 451          

HSP 2 Score: 87.0409 bits (214), Expect = 6.706e-18
Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query: 1418 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKIFTNFRE 1537
            VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKIFTNFRE
Sbjct:  483 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKIFTNFRE 522          

HSP 3 Score: 79.337 bits (194), Expect = 2.020e-15
Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = 1
Query:   64 MSAKKRKTSWNEKYPTEFGFLKKVDKDKSKAFCTICSTEL 183
            MSAKKRKTSWNEKY TEFGFLKKVDKD+SKAFCTICSTE 
Sbjct:    1 MSAKKRKTSWNEKYSTEFGFLKKVDKDESKAFCTICSTEF 40          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000008645.1 (SMESG000008645.1)

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 391/417 (93.76%), Postives = 393/417 (94.24%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMYFLM 1430
            IMKHIETKNHKSSVAAGSSSQKVSDF KRIE SNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTA IITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADN NMNFGG              RDL RNIVGNGCCAHIA NASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCE+MEQIYM LLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNIT FEVANHMKILKEK VNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFM+ LM
Sbjct:   50 IMKHIETKNHKSSVAAGSSSQKVSDFYKRIERSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAAIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNINMNFGG--------------RDLVRNIVGNGCCAHIAHNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEDMEQIYMPLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITSFEVANHMKILKEKLVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMWMLM 452          

HSP 2 Score: 85.5001 bits (210), Expect = 2.144e-17
Identity = 39/40 (97.50%), Postives = 40/40 (100.00%), Query Frame = 2
Query: 1418 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKIFTNFRE 1537
            VLFDEYGL+RNFIEDNISSWMDAKLTPENIWIKIFTNFRE
Sbjct:  484 VLFDEYGLIRNFIEDNISSWMDAKLTPENIWIKIFTNFRE 523          

HSP 3 Score: 77.411 bits (189), Expect = 9.190e-15
Identity = 36/40 (90.00%), Postives = 38/40 (95.00%), Query Frame = 1
Query:   64 MSAKKRKTSWNEKYPTEFGFLKKVDKDKSKAFCTICSTEL 183
            MSAKKRKTSWNEKY T+FGFLKKVDKD+SKAFCTICSTE 
Sbjct:    1 MSAKKRKTSWNEKYSTKFGFLKKVDKDESKAFCTICSTEF 40          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000003942.1 (SMESG000003942.1)

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 372/386 (96.37%), Postives = 376/386 (97.41%), Query Frame = 3
Query:  273 GSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMYFLM 1430
            GSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTA IITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVW+KLQRDLGRNIVGNGCCAHI+ NASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIY+LLLNHSSTRFLSLEPAV RLIE FE LMEYFGTLKSCPVSIQN FNDPTSKFWILFICNNLKLFNESIRAMESSNIT FEVANHMKILKEK VNRKNFGFLPHESKKEY KFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFM+ LM
Sbjct:   31 GSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAAIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWRKLQRDLGRNIVGNGCCAHISHNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYILLLNHSSTRFLSLEPAVWRLIEWFESLMEYFGTLKSCPVSIQNSFNDPTSKFWILFICNNLKLFNESIRAMESSNITSFEVANHMKILKEKLVNRKNFGFLPHESKKEYYKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMWMLM 416          

HSP 2 Score: 80.1073 bits (196), Expect = 1.013e-15
Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = 2
Query: 1418 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKIFTNFRE 1537
            VLFDEYGLMR FIEDN SSW+DAKLTPENIWIKIFTNFRE
Sbjct:  447 VLFDEYGLMRYFIEDNTSSWVDAKLTPENIWIKIFTNFRE 486          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000012241.1 (SMESG000012241.1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 366/417 (87.77%), Postives = 378/417 (90.65%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMYFLM 1430
            I+KHIETKNHKSSVAAGSSSQKVSDF KRIEGSNEDLIIAAKESALAYHAAKHNISFRSN+CSSNIIRHFFDRKFSLGRTKTA IITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIK+LPVVLRCFDPTQGIINWKITITSIPNDQSSTV NTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVW+KL+RDLGRNIVGNGCCAHIA NASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEM+QIYM LLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRA+ESSNIT FEVANHMKILKEK  NRKNFGFLP   K+          + +  K+            L EGALD SDVFM+ LM
Sbjct:   50 IIKHIETKNHKSSVAAGSSSQKVSDFFKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNNCSSNIIRHFFDRKFSLGRTKTAAIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKILPVVLRCFDPTQGIINWKITITSIPNDQSSTVFNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWRKLRRDLGRNIVGNGCCAHIAHNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMKQIYMPLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAIESSNITSFEVANHMKILKEKLFNRKNFGFLPMNQKRNMT------NSHLSTKI------------LLEGALDRSDVFMWMLM 448          

HSP 2 Score: 80.1073 bits (196), Expect = 1.352e-15
Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = 1
Query:   64 MSAKKRKTSWNEKYPTEFGFLKKVDKDKSKAFCTICSTEL 183
            MSAKKRKTSWNEKY TEFGFLKKVDKD+SKAFCTICSTE 
Sbjct:    1 MSAKKRKTSWNEKYSTEFGFLKKVDKDESKAFCTICSTEF 40          

HSP 3 Score: 76.6406 bits (187), Expect = 1.508e-14
Identity = 36/40 (90.00%), Postives = 37/40 (92.50%), Query Frame = 2
Query: 1418 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKIFTNFRE 1537
            VLFDEY LMRNFIEDNIS WM+AKLT ENIWIKIFTNFRE
Sbjct:  480 VLFDEYELMRNFIEDNISRWMNAKLTSENIWIKIFTNFRE 519          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000017191.1 (SMESG000017191.1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 328/417 (78.66%), Postives = 331/417 (79.38%), Query Frame = 3
Query:  180 IMKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAAKHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKGMDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRDLGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKILKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMYFLM 1430
            IMKHIETKNHKSSVAAGSSSQKVSDF KRIE SNEDLIIAAKESALAYHAAKHNI FRSNDCSSNIIRHFFDRKFSLGRTKTA IITK                                              GIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVW+KLQRDLGRNIVGNGC AHIA NASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYM LLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPT                               +ANHMKILKEK VNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFM+ LM
Sbjct:   50 IMKHIETKNHKSSVAAGSSSQKVSDFFKRIEESNEDLIIAAKESALAYHAAKHNIPFRSNDCSSNIIRHFFDRKFSLGRTKTAAIITK----------------------------------------------GIINWKITITSIPNDQSSTVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWRKLQRDLGRNIVGNGCFAHIAHNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTESFKSLCEEMEQIYMPLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSCPVSIQNFFNDPT-------------------------------MANHMKILKEKLVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKLWEGALDGSDVFMWMLM 389          

HSP 2 Score: 79.337 bits (194), Expect = 1.357e-15
Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = 1
Query:   64 MSAKKRKTSWNEKYPTEFGFLKKVDKDKSKAFCTICSTEL 183
            MSAKKRKTSWNEKY TEFGFLKKVDKD+SKAFCTICSTE 
Sbjct:    1 MSAKKRKTSWNEKYSTEFGFLKKVDKDESKAFCTICSTEF 40          

HSP 3 Score: 74.7146 bits (182), Expect = 4.595e-14
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 2
Query: 1418 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKI 1519
            VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKI
Sbjct:  421 VLFDEYGLMRNFIEDNISSWMDAKLTPENIWIKI 454          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043280.14.408e-6530.75uncharacterized LOC100492546 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2Q4N21.167e-9238.13Uncharacterized protein OS=Sipha flava OX=143950 G... [more]
A0A2D4KG822.421e-9036.05Dimer_Tnp_hAT domain-containing protein (Fragment)... [more]
A0A2D4KG641.027e-8836.05KRAB domain-containing protein (Fragment) OS=Micru... [more]
A0A2D4EP512.015e-8640.25KRAB domain-containing protein (Fragment) OS=Micru... [more]
A0A2H6NDB08.174e-8639.94Uncharacterized protein (Fragment) OS=Micrurus lem... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051257.11.098e-5531.35pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041838.11.722e-5231.14pep primary_assembly:Astyanax_mexicanus-2.0:14:295... [more]
ENSAMXT00000029907.13.248e-4731.74pep primary_assembly:Astyanax_mexicanus-2.0:15:338... [more]
ENSAMXT00000048878.14.817e-4729.78pep primary_assembly:Astyanax_mexicanus-2.0:8:1899... [more]
ENSAMXT00000030070.11.413e-4327.49pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO432826.069e-2423.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466881.819e-1026.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329362.150e-1026.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362986.894e-824.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015033.16.706e-1893.05SMESG000015033.1[more]
SMESG000008645.12.144e-1793.76SMESG000008645.1[more]
SMESG000003942.11.013e-1596.37SMESG000003942.1[more]
SMESG000012241.11.352e-1587.77SMESG000012241.1[more]
SMESG000017191.11.357e-1578.66SMESG000017191.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024790 ID=SMED30024790|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1538bp
ATTGCTTCTTACTTAAGTTATAATCTACAAAAAGTTGTTTTAAAAAATTA
TTTTAAGACTAAAATGTCGGCAAAGAAAAGAAAAACATCATGGAATGAAA
AGTACCCCACGGAATTTGGATTTCTCAAAAAAGTCGACAAGGATAAATCA
AAAGCATTTTGTACTATTTGTTCTACAGAATTATGAAGCATATTGAAACT
AAAAACCACAAATCATCTGTTGCCGCTGGATCATCAAGTCAAAAAGTTAG
CGATTTTTTAAAGAGAATTGAAGGATCCAATGAAGACTTGATTATTGCTG
CAAAAGAGTCCGCTTTAGCATATCACGCTGCTAAACATAACATTTCATTT
CGATCAAATGACTGCTCATCAAACATCATAAGACATTTCTTTGACAGAAA
ATTCTCATTAGGACGGACGAAAACGGCAGAAATTATTACAAAGGTTATTG
CACCATTCATTGACAACAAAATTCTTAAAGGGATGGATATTATTAGTTTC
GCCTCTATACAAACCGATGCTTCTAATCACAAAAATATAAAAATGTTGCC
AGTTGTGCTCCGTTGTTTTGATCCAACTCAGGGAATCATTAATTGGAAGA
TTACAATTACATCAATTCCAAATGATCAATCATCGACAGTATGTAACACT
ATAATGGACGTGATTCAAAAAAATAATTTGTGTGACATGATCGTTGCTTA
TTCAGCAGACAATACAAATATGAACTTTGGCGGTGTACAAAGAAACGGTC
AAAATAATGTTTGGAAAAAACTTCAGAGAGACCTTGGAAGAAATATAGTT
GGAAATGGATGTTGTGCACACATCGCTCCAAATGCATCAAGTGCTGGTTG
TGAAATTTTGGAAGTTGATTTGGAAGCTATTATAGTAAAACTTTACAAAC
ACTTTAGCATATATTCCGTTCGAACTGAAAGTTTTAAGTCACTATGCGAA
GAGATGGAACAAATTTATATGCTACTTTTGAATCATTCAAGTACTCGCTT
TCTTTCTTTAGAACCTGCAGTTCGGAGACTTATTGAGTTGTTTGAGCCAT
TGATGGAATATTTTGGAACTTTAAAAAGCTGTCCTGTTTCAATTCAAAAC
TTCTTTAATGATCCAACAAGTAAATTTTGGATTTTGTTTATTTGCAACAA
TCTCAAACTTTTTAATGAATCGATACGTGCCATGGAATCATCAAATATTA
CATGTTTTGAAGTGGCAAATCATATGAAAATACTAAAGGAAAAATTTGTT
AACCGGAAAAATTTTGGATTTTTGCCTCATGAATCAAAAAAGGAATATGA
CAAATTCTCATTTAAGCACCAAAATCGTGTAAAGGAGAAAGTTTCGGAAT
TTTATGCTACCATTTTGGATTATCTTAAGCTTTGGGAAGGTGCTCTAGAT
GGATCAGATGTCTTTATGTACTTTTTGATGAATATGGATTAATGAGAAAT
TTTATTGAAGATAACATTTCAAGCTGGATGGACGCAAAATTGACACCTGA
AAATATTTGGATAAAAATTTTTACCAATTTTCGTGAAC
back to top

protein sequence of SMED30024790-orf-1

>SMED30024790-orf-1 ID=SMED30024790-orf-1|Name=SMED30024790-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MKHIETKNHKSSVAAGSSSQKVSDFLKRIEGSNEDLIIAAKESALAYHAA
KHNISFRSNDCSSNIIRHFFDRKFSLGRTKTAEIITKVIAPFIDNKILKG
MDIISFASIQTDASNHKNIKMLPVVLRCFDPTQGIINWKITITSIPNDQS
STVCNTIMDVIQKNNLCDMIVAYSADNTNMNFGGVQRNGQNNVWKKLQRD
LGRNIVGNGCCAHIAPNASSAGCEILEVDLEAIIVKLYKHFSIYSVRTES
FKSLCEEMEQIYMLLLNHSSTRFLSLEPAVRRLIELFEPLMEYFGTLKSC
PVSIQNFFNDPTSKFWILFICNNLKLFNESIRAMESSNITCFEVANHMKI
LKEKFVNRKNFGFLPHESKKEYDKFSFKHQNRVKEKVSEFYATILDYLKL
WEGALDGSDVFMYFLMNMD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0015074DNA integration