Zinc finger protein castor-like protein 1

Overview
NameZinc finger protein castor-like protein 1
Smed IDSMED30024786
Length (bp)5170
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein castor-like protein 1 (SMED30024786) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein castor-like protein 1 (SMED30024786) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein castor-like protein 1 (SMED30024786) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein castor-like protein 1 (SMED30024786) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024786

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30024786SMESG000038913.1 dd_Smed_v4_6778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024786SMESG000038913.1 dd_Smed_v4_6778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30024786SMESG000038913.1 dd_Smed_v4_6778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024786SMESG000038913.1 dd_Smed_v6_6778_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30024786SMESG000051397.1 SMESG000038913.1 SMESG000013006.1 SMED30024786smed_20140614PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024786SMESG000051397.1 dd_Smed_v4_8978_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024786SMESG000038913.1 dd_Smed_v4_6778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Human
Match: CASZ1 (castor zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:26002])

HSP 1 Score: 265.003 bits (676), Expect = 1.356e-71
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  468 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSL 709          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Human
Match: CASZ1 (castor zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:26002])

HSP 1 Score: 261.151 bits (666), Expect = 2.042e-69
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  468 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSL 709          

HSP 2 Score: 101.679 bits (252), Expect = 9.738e-21
Identity = 49/169 (28.99%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             F RF   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+A+  C  + C +    +THFHC+R  C+F   +   +  H+ HH + D ++  GF ++     C    CK+    +H HC    C + V   +Q++SH+RKHE++
Sbjct: 1433 GFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGT-STHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQ 1598          

HSP 3 Score: 100.138 bits (248), Expect = 3.393e-20
Identity = 71/269 (26.39%), Postives = 120/269 (44.61%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPN-----------DDCNEFM-CTYNGRQTHYHCLHAGC-------------NKIYISTSD--------VQMHSNFHKK----------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             K ++  E+C    C+ + +  HFHCI+  C+ + L + +M  H++ H +R   L  NF R  P+           D+C ++  C+     +    +   C             N I + T+         ++  S F K+          D  +  EGF+RF   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1277 FKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRR--MLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQ 1540          

HSP 4 Score: 99.3673 bits (246), Expect = 5.261e-20
Identity = 54/174 (31.03%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  808 MDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
            M  +  +R+  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C+   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C+V  C Y   + +HFHC  P C+ T    + MD HK  H++ +
Sbjct: 1429 MMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKY-KLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQE 1599          

HSP 5 Score: 86.6557 bits (213), Expect = 3.682e-16
Identity = 74/334 (22.16%), Postives = 134/334 (40.12%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSN------------GIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSS------PVNDINTNSEFLSLIMNAINNWENSSE---------WLNDVRKFTSNDVCTN-HCSLAFK-DHFHCLFLNCNVSYKKKEKILDHCRRH-RLDKALL 1890
             F++F  ND C    C Y   + H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+R  C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L              G++    +   DY+  +        ++ + S  +    NE+ ++      P         ++   M+       ++           L   R+F   + C +  C  + K  H+HC   NC   +  +  +  H + H R+D  +L
Sbjct: 1159 GFLQFQENDPCLATDCKY-ANKFHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMR--GHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVL 1489          

HSP 6 Score: 67.3958 bits (163), Expect = 2.663e-10
Identity = 56/257 (21.79%), Postives = 94/257 (36.58%), Query Frame = 1
Query:  850 CKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHS----------NFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFT--------FKNKADMDKHKSHHQR-----------------------NDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            C N+ C+  + R H+HC++  C        ++  H K H+K E      F  F+  ++C    C YN   +H+HC+  GC   ++    +  H+          NF +   +    G       E    + CS     ++    M  +C  T          N   M       +R                       ++ +  EGF+++  YE C  + C+FS  + H HC R NC Y       +  H + H+R
Sbjct: 1229 CPNQHCEFRM-RGHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCS-PGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR 1483          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Human
Match: CASZ1 (castor zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:26002])

HSP 1 Score: 75.8702 bits (185), Expect = 2.872e-14
Identity = 34/97 (35.05%), Postives = 49/97 (50.52%), Query Frame = 1
Query: 1234 HFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITP 1524
            H+HC+R  C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P
Sbjct:    5 HYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVP 101          

HSP 2 Score: 65.4698 bits (158), Expect = 9.188e-11
Identity = 33/87 (37.93%), Postives = 42/87 (48.28%), Query Frame = 1
Query: 1057 HYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQR 1317
            HYHCL  GC  +   T+ +  H   H+K       GF+ F   E C    C Y NQ  +HFHC+R  C+F+F  K  M  H   H R
Sbjct:    5 HYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKY-NQVNSHFHCIREGCQFSFLLKHQMTSHARKHMR 90          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Fly
Match: cas (gene:FBgn0004878 transcript:FBtr0339518)

HSP 1 Score: 268.855 bits (686), Expect = 4.611e-76
Identity = 120/230 (52.17%), Postives = 168/230 (73.04%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTIL-RREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM---CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            +++ SSY +C+N  C+++ LR+HFHC +  C+  IL +++++IRH KWHKKR+ESL   F RFS +DDC       C YN +QTHYHC++  C K+Y+STSDVQMH+NFH+KD+ I  EGF+RFRA E C +  C +  ++ +H+HC R  C  TFKNKADMDKHK++H ++  L  +GFKK +K E C F  CKFS + NHIHC+R  CDY++HSS+Q+ SH+RKH+R+
Sbjct:  252 LRKVSSYLECENSLCRQENLREHFHCHEEPCQGKILSKKDDIIRHLKWHKKRKESLKLGFARFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHANFHRKDSEIVNEGFRRFRAHETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDGFKKILKTEVCPFDACKFSTVCNHIHCVREGCDYILHSSSQMISHKRKHDRQ 481          

HSP 2 Score: 100.908 bits (250), Expect = 4.590e-21
Identity = 55/189 (29.10%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  778 KENLQLNYAEMDEDCIKRYSSYEDCK---NEQCQKDLLRDHFHCI--QCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQ-THYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDS 1326
            KE+L+L +A        R+SS +DC     E C  +  + H+HC+   C K  +   ++  H+ +H+K  E ++  F RF  ++ C    C + G++ +HYHC   GC   + + +D+  H  +H KD  +  +GF++   TE C   +C + +    H HC+R  C +   + + M  HK  H R D 
Sbjct:  304 KESLKLGFA--------RFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHANFHRKDSEIVNEGFRRFRAHETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDGFKKILKTEVCPFDACKF-STVCNHIHCVREGCDYILHSSSQMISHKRKHDRQDG 483          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Fly
Match: cas (gene:FBgn0004878 transcript:FBtr0078725)

HSP 1 Score: 270.781 bits (691), Expect = 8.471e-76
Identity = 120/230 (52.17%), Postives = 168/230 (73.04%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTIL-RREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM---CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            +++ SSY +C+N  C+++ LR+HFHC +  C+  IL +++++IRH KWHKKR+ESL   F RFS +DDC       C YN +QTHYHC++  C K+Y+STSDVQMH+NFH+KD+ I  EGF+RFRA E C +  C +  ++ +H+HC R  C  TFKNKADMDKHK++H ++  L  +GFKK +K E C F  CKFS + NHIHC+R  CDY++HSS+Q+ SH+RKH+R+
Sbjct:  354 LRKVSSYLECENSLCRQENLREHFHCHEEPCQGKILSKKDDIIRHLKWHKKRKESLKLGFARFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHANFHRKDSEIVNEGFRRFRAHETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDGFKKILKTEVCPFDACKFSTVCNHIHCVREGCDYILHSSSQMISHKRKHDRQ 583          

HSP 2 Score: 101.293 bits (251), Expect = 4.501e-21
Identity = 55/189 (29.10%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  778 KENLQLNYAEMDEDCIKRYSSYEDCK---NEQCQKDLLRDHFHCI--QCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQ-THYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDS 1326
            KE+L+L +A        R+SS +DC     E C  +  + H+HC+   C K  +   ++  H+ +H+K  E ++  F RF  ++ C    C + G++ +HYHC   GC   + + +D+  H  +H KD  +  +GF++   TE C   +C + +    H HC+R  C +   + + M  HK  H R D 
Sbjct:  406 KESLKLGFA--------RFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHANFHRKDSEIVNEGFRRFRAHETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDGFKKILKTEVCPFDACKF-STVCNHIHCVREGCDYILHSSSQMISHKRKHDRQDG 585          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Fly
Match: CG7512 (gene:FBgn0036168 transcript:FBtr0113163)

HSP 1 Score: 85.5001 bits (210), Expect = 1.759e-16
Identity = 51/198 (25.76%), Postives = 90/198 (45.45%), Query Frame = 1
Query:  961 KKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSY------------------------HNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRK 1482
            + R+  +   +++F  N+DC    C Y   Q+H+HC    C+  +   +    H+  H++   +  + F++FRA   C V+SC Y                         +++T+HFHC +  C +   +   +  H+  H R D +   GF+K    E CD  GC +++   H HC+   CD  V S AQ+ +H+ +
Sbjct:  335 RNRDHDIPSGYLKFRFNEDCGFERCGYRNHQSHFHCNRRDCHYSFCDKTRFVQHTARHERMDTLMGDDFRQFRANMQCGVASCGYATASGAATETNHLSRIDPTEAVTASSRKTSHFHCRK--CDYVCTDSNKVVAHRRLHLRQDYVRNAGFRKVGGNEQCDSPGCSYAQRHTHYHCV--TCDGGVLSRAQLAAHKHR 528          

HSP 2 Score: 62.7734 bits (151), Expect = 2.262e-9
Identity = 38/136 (27.94%), Postives = 63/136 (46.32%), Query Frame = 1
Query: 1162 GFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKF-------------------------SKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            G+ +FR  E C    C Y N ++ HFHC R +C ++F +K    +H + H+R D+L  + F+++     C  + C +                         S+  +H HC +  CDYV   S ++ +HRR H R+
Sbjct:  344 GYLKFRFNEDCGFERCGYRNHQS-HFHCNRRDCHYSFCDKTRFVQHTARHERMDTLMGDDFRQFRANMQCGVASCGYATASGAATETNHLSRIDPTEAVTASSRKTSHFHCRK--CDYVCTDSNKVVAHRRLHLRQ 476          

HSP 3 Score: 56.225 bits (134), Expect = 2.080e-7
Identity = 44/180 (24.44%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  844 EDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTY------------------------NGRQT-HYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHK 1302
            EDC  E+C     + HFHC +  C  +   +   ++H+  H++ +  +  +F +F  N  C    C Y                        + R+T H+HC    C+ +   ++ V  H   H +   +   GF++    E C    CSY  QR TH+HC+   C     ++A +  HK
Sbjct:  352 EDCGFERCGYRNHQSHFHCNRRDCHYSFCDKTRFVQHTARHERMDTLMGDDFRQFRANMQCGVASCGYATASGAATETNHLSRIDPTEAVTASSRKTSHFHCRK--CDYVCTDSNKVVAHRRLHLRQDYVRNAGFRKVGGNEQCDSPGCSY-AQRHTHYHCV--TCDGGVLSRAQLAAHK 526          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Zebrafish
Match: casz1 (castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060130-108])

HSP 1 Score: 255.758 bits (652), Expect = 4.628e-68
Identity = 119/243 (48.97%), Postives = 162/243 (66.67%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+   CNK+Y STSDV  H NFHKK+A +  +GFQRFRA E C    C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR  C +   S++Q+ SH+RKHERR + S+G++     F
Sbjct:  487 IARFSGSQHCGHVHCAYQY-REHYHCMDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVACNKVYTSTSDVMTHENFHKKNAQLINDGFQRFRAVEDCGTVGCQFYAQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRQGCGFTFTSTSQMTSHKRKHERRHIRSSGVLGLTSSF 728          

HSP 2 Score: 100.908 bits (250), Expect = 1.239e-20
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V+ C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1477 FRRYDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLCCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVADCKY-KLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQE 1642          

HSP 3 Score: 98.9821 bits (245), Expect = 4.469e-20
Identity = 47/169 (27.81%), Postives = 88/169 (52.07%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             F R+   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C + +  +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+ + CK+    +H HC    C + V   +Q++SH+RKHE++
Sbjct: 1476 GFRRYDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLCCNFPDCQF-SGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQ 1641          

HSP 4 Score: 92.0485 bits (227), Expect = 5.524e-18
Identity = 53/187 (28.34%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKS 1539
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +  S
Sbjct: 1172 GFLQFQDNDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFSYYSLQCLCPNQHCEF--RMRGHYHCLRPGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRHGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQVVS 1355          

HSP 5 Score: 82.0333 bits (201), Expect = 7.232e-15
Identity = 40/118 (33.90%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1469 DEGMMLEGFRRYDLYEDCKDTACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLCCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1583          

HSP 6 Score: 52.7582 bits (125), Expect = 5.036e-6
Identity = 31/108 (28.70%), Postives = 47/108 (43.52%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC +  C    +  S +  H   H+K
Sbjct: 1533 DDFKRFKSSLCCNFPDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEK 1640          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Zebrafish
Match: casz1 (castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060130-108])

HSP 1 Score: 254.603 bits (649), Expect = 8.176e-68
Identity = 119/243 (48.97%), Postives = 162/243 (66.67%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+   CNK+Y STSDV  H NFHKK+A +  +GFQRFRA E C    C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR  C +   S++Q+ SH+RKHERR + S+G++     F
Sbjct:  464 IARFSGSQHCGHVHCAYQY-REHYHCMDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVACNKVYTSTSDVMTHENFHKKNAQLINDGFQRFRAVEDCGTVGCQFYAQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRQGCGFTFTSTSQMTSHKRKHERRHIRSSGVLGLTSSF 705          

HSP 2 Score: 100.523 bits (249), Expect = 1.369e-20
Identity = 57/174 (32.76%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  808 MDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
            M  +  +RY  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V+ C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1347 MMLEGFRRYDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLCCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVADCKY-KLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQE 1517          

HSP 3 Score: 99.3673 bits (246), Expect = 3.379e-20
Identity = 48/181 (26.52%), Postives = 92/181 (50.83%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQE 1530
             F R+   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C + +  +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+ + CK+    +H HC    C + V   +Q++SH+RKHE++       ++P +
Sbjct: 1351 GFRRYDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLCCNFPDCQF-SGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQERGELPSVSPNQ 1528          

HSP 4 Score: 97.8265 bits (242), Expect = 1.038e-19
Identity = 83/331 (25.08%), Postives = 139/331 (41.99%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDY-------SILNLSKNVKSPNSDENSIITREFDNENHSSPVND-----INTNSEFLSLIMNAINNWE------------NSSEWLNDVRKFTSNDVCTN-HCSLAFK-DHFHCLFLNCNVSYKKKEKILDHCRRH-RLDKALL 1890
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +   DY       S L LS   +S N D +   T      N SSP  +       T ++    I+  ++ +             +    L   R++   + C +  C  + K  H+HC   NC   +  +  +  H + H R+D  +L
Sbjct: 1085 GFLQFQDNDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFSYYSLQCLCPNQHCEF--RMRGHYHCLRPGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRHGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQDNDDYMDYTAGGSPLGLSS--ESSNQDRSCTST---PVGNDSSPAGNTISIPTATGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRYDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVL 1407          

HSP 5 Score: 95.5153 bits (236), Expect = 4.824e-19
Identity = 68/259 (26.25%), Postives = 118/259 (45.56%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYN--GRQTHYHCLHAGC-------------NKIYISTSD--------VQMHSNFHKK----------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             K ++  E+C    C+ + +  HFHCI+  C+ + L + +M  H++ H +R    +F+ +    NDD  ++    +  G  +        C             N I I T+         ++  S F K+          D  +  EGF+R+   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1203 FKYFTKREECGRHGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQDNDDYMDYTAGGSPLGLSSESSNQDRSCTSTPVGNDSSPAGNTISIPTATGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRYDLYEDCKDTACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLCCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1458          

HSP 6 Score: 66.6254 bits (161), Expect = 3.331e-10
Identity = 61/264 (23.11%), Postives = 105/264 (39.77%), Query Frame = 1
Query:  850 CKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK---------------------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCM----RPNCKFTFKNKADMD----KHKSHHQR---NDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKS 1539
            C N+ C+  + R H+HC++  C        ++  H K H+K E      F  F+  ++C    C YN   +H+HC+  GC   ++    +  H+  H +                      A  +  G     + +  S +S    N  +   + +        K  F    DM     + K+   R   ++ +  EGF++Y  YE C  + C+FS  + H HC R NC Y       +  H + H+R  + N ++   + FKS
Sbjct: 1155 CPNQHCEFRM-RGHYHCLRPGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRHGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQDNDDYMDYTAGGSPLGLSSESSNQDRSCTSTPVGNDSSPAGNTISIPTATGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRYDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR--VDNLVLDDFKRFKS 1415          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Xenopus
Match: CASZ1 (castor zinc finger 1 [Source:NCBI gene;Acc:100127676])

HSP 1 Score: 265.388 bits (677), Expect = 4.682e-72
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C    C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G++  P   
Sbjct:  461 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGVLGLPSSL 702          

HSP 2 Score: 62.3882 bits (150), Expect = 7.864e-9
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 1096 ISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFT-FKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCD--FSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            +ST    +  +   +D  I Q+   RF  ++ C    C+Y  Q   H+HC+ P C +  F +K D+ +H + H++ D+  + GF ++   + C   + GC  +    H HC++  C+ V  S++ + +H   H++
Sbjct:  438 VSTVKNGLPPDKPPEDVNIYQKYIARFSGSQHCGHIHCAY--QYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKK 570          

HSP 3 Score: 58.5362 bits (140), Expect = 1.072e-7
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  781 ENLQLNYAEMDEDCIKRYSSYEDCKNEQCQ-KDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            EN      ++  D  +R+ + EDC    CQ       HFHC +  C  T   + ++ +H  +H K +      F +F   ++C    C Y+    H+HC+ AGC   + STS +  H   H++
Sbjct:  565 ENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHER 687          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Xenopus
Match: CASZ1 (castor zinc finger 1 [Source:NCBI gene;Acc:100127676])

HSP 1 Score: 265.003 bits (676), Expect = 9.085e-72
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C    C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G++  P   
Sbjct:  492 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGVLGLPSSL 733          

HSP 2 Score: 62.3882 bits (150), Expect = 8.136e-9
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 1096 ISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFT-FKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCD--FSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            +ST    +  +   +D  I Q+   RF  ++ C    C+Y  Q   H+HC+ P C +  F +K D+ +H + H++ D+  + GF ++   + C   + GC  +    H HC++  C+ V  S++ + +H   H++
Sbjct:  469 VSTVKNGLPPDKPPEDVNIYQKYIARFSGSQHCGHIHCAY--QYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKK 601          

HSP 3 Score: 58.5362 bits (140), Expect = 1.108e-7
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  781 ENLQLNYAEMDEDCIKRYSSYEDCKNEQCQ-KDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            EN      ++  D  +R+ + EDC    CQ       HFHC +  C  T   + ++ +H  +H K +      F +F   ++C    C Y+    H+HC+ AGC   + STS +  H   H++
Sbjct:  596 ENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHER 718          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Xenopus
Match: CASZ1 (castor zinc finger 1 [Source:NCBI gene;Acc:100127676])

HSP 1 Score: 262.307 bits (669), Expect = 8.288e-70
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C    C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G++  P   
Sbjct:  492 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGVLGLPSSL 733          

HSP 2 Score: 104.76 bits (260), Expect = 1.257e-21
Identity = 57/169 (33.73%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C VS C Y   + +HFHC  P+CK T    + MD HK  H++ +
Sbjct: 1567 FRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVSDCKY-KLKCSHFHCTYPSCKHTVVGMSQMDSHKRKHEKQE 1732          

HSP 3 Score: 101.293 bits (251), Expect = 1.367e-20
Identity = 53/202 (26.24%), Postives = 100/202 (49.50%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITP-----QEFKSDYSILNLSKNVKS 1578
             F R+   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C +    +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+ S CK+    +H HC   +C + V   +Q++SH+RKHE++       ++P      +  ++Y + N   N+ S
Sbjct: 1566 GFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGN-STHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVSDCKYKLKCSHFHCTYPSCKHTVVGMSQMDSHKRKHEKQERGELPSVSPGPEGLTQTGTEYDLQNPPVNLDS 1764          

HSP 4 Score: 91.6633 bits (226), Expect = 1.074e-17
Identity = 53/187 (28.34%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKS 1539
             F++F  ND C    C Y   + H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+RP+C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +  S
Sbjct: 1161 GFLQFHENDPCLATDCKY-ANKFHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMR--GHYHCLRPSCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRIGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPGQVVS 1344          

HSP 5 Score: 84.3445 bits (207), Expect = 1.672e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1559 DEGMMLEGFRRYDLYEDCKDSACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1673          

HSP 6 Score: 62.3882 bits (150), Expect = 8.840e-9
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 1096 ISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFT-FKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCD--FSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            +ST    +  +   +D  I Q+   RF  ++ C    C+Y  Q   H+HC+ P C +  F +K D+ +H + H++ D+  + GF ++   + C   + GC  +    H HC++  C+ V  S++ + +H   H++
Sbjct:  469 VSTVKNGLPPDKPPEDVNIYQKYIARFSGSQHCGHIHCAY--QYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKK 601          

HSP 7 Score: 58.5362 bits (140), Expect = 1.387e-7
Identity = 34/127 (26.77%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  769 FINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQ-KDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
             +  EN      ++  D  +R+ + EDC    CQ       HFHC +  C  T   + ++ +H  +H K +      F +F   ++C    C Y+    H+HC+ AGC   + STS +  H   H++
Sbjct:  592 VMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHER 718          

HSP 8 Score: 55.0694 bits (131), Expect = 1.393e-6
Identity = 31/108 (28.70%), Postives = 47/108 (43.52%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC +  C    +  S +  H   H+K
Sbjct: 1623 DDFKRFKSSLSCNFPDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVSDCKYKLKCSHFHCTYPSCKHTVVGMSQMDSHKRKHEK 1730          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Xenopus
Match: CASZ1 (castor zinc finger 1 [Source:NCBI gene;Acc:100127676])

HSP 1 Score: 261.922 bits (668), Expect = 1.067e-69
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C    C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G++  P   
Sbjct:  492 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGVLGLPSSL 733          

HSP 2 Score: 104.375 bits (259), Expect = 1.631e-21
Identity = 57/169 (33.73%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C VS C Y   + +HFHC  P+CK T    + MD HK  H++ +
Sbjct: 1467 FRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVSDCKY-KLKCSHFHCTYPSCKHTVVGMSQMDSHKRKHEKQE 1632          

HSP 3 Score: 101.293 bits (251), Expect = 1.486e-20
Identity = 53/202 (26.24%), Postives = 100/202 (49.50%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITP-----QEFKSDYSILNLSKNVKS 1578
             F R+   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C +    +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+ S CK+    +H HC   +C + V   +Q++SH+RKHE++       ++P      +  ++Y + N   N+ S
Sbjct: 1466 GFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGN-STHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVSDCKYKLKCSHFHCTYPSCKHTVVGMSQMDSHKRKHEKQERGELPSVSPGPEGLTQTGTEYDLQNPPVNLDS 1664          

HSP 4 Score: 91.6633 bits (226), Expect = 1.191e-17
Identity = 53/187 (28.34%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKS 1539
             F++F  ND C    C Y   + H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+RP+C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +  S
Sbjct: 1161 GFLQFHENDPCLATDCKY-ANKFHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMR--GHYHCLRPSCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRIGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPGQVVS 1344          

HSP 5 Score: 84.3445 bits (207), Expect = 1.810e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1459 DEGMMLEGFRRYDLYEDCKDSACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1573          

HSP 6 Score: 62.3882 bits (150), Expect = 9.943e-9
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 1096 ISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFT-FKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCD--FSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            +ST    +  +   +D  I Q+   RF  ++ C    C+Y  Q   H+HC+ P C +  F +K D+ +H + H++ D+  + GF ++   + C   + GC  +    H HC++  C+ V  S++ + +H   H++
Sbjct:  469 VSTVKNGLPPDKPPEDVNIYQKYIARFSGSQHCGHIHCAY--QYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKK 601          

HSP 7 Score: 58.5362 bits (140), Expect = 1.423e-7
Identity = 34/127 (26.77%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  769 FINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQ-KDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
             +  EN      ++  D  +R+ + EDC    CQ       HFHC +  C  T   + ++ +H  +H K +      F +F   ++C    C Y+    H+HC+ AGC   + STS +  H   H++
Sbjct:  592 VMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCSFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHER 718          

HSP 8 Score: 55.0694 bits (131), Expect = 1.530e-6
Identity = 31/108 (28.70%), Postives = 47/108 (43.52%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC +  C    +  S +  H   H+K
Sbjct: 1523 DDFKRFKSSLSCNFPDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSVDCEVSDCKYKLKCSHFHCTYPSCKHTVVGMSQMDSHKRKHEK 1630          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Mouse
Match: Casz1 (castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:1196251])

HSP 1 Score: 263.462 bits (672), Expect = 5.171e-74
Identity = 124/264 (46.97%), Postives = 170/264 (64.39%), Query Frame = 1
Query:  778 KENLQLNYAEMDEDC------IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            K  L  +   + ED       I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  160 KNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASL 422          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Mouse
Match: Casz1 (castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:1196251])

HSP 1 Score: 266.159 bits (679), Expect = 4.821e-72
Identity = 124/264 (46.97%), Postives = 170/264 (64.39%), Query Frame = 1
Query:  778 KENLQLNYAEMDEDC------IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            K  L  +   + ED       I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  446 KNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASL 708          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Mouse
Match: Casz1 (castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:1196251])

HSP 1 Score: 262.307 bits (669), Expect = 5.829e-70
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  467 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASL 708          

HSP 2 Score: 102.449 bits (254), Expect = 4.538e-21
Identity = 50/179 (27.93%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITP 1524
             F RF   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+A+  C  + C +    +THFHC+R  C+F   +   +  H+ HH + D ++  GF ++     C    CK+    +H HC    C + V   +Q++SH+RKHE++        +P
Sbjct: 1433 GFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGT-STHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQERGEPPAASP 1608          

HSP 3 Score: 99.7525 bits (247), Expect = 2.601e-20
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +R+  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C+   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C+V  C Y   + +HFHC  P C+ T    + MD HK  H++ +
Sbjct: 1434 FRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKY-KLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQE 1599          

HSP 4 Score: 99.3673 bits (246), Expect = 3.770e-20
Identity = 70/269 (26.02%), Postives = 116/269 (43.12%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM------------CTYNGRQTHYHCLHAGC-------------NKIYISTSD--------VQMHSNFHKK----------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             K ++  E+C    C+ + +  HFHCI+  C+ + L + +M  H++ H +R   L  NF R  P+      M            C+     +    +   C             N I + T+         ++  S F K+          D  +  EGF+RF   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1277 FKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRR--MLGKNFDRVPPSQGPPSLMDAETDEGMDYTGCSPGAASSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQ 1540          

HSP 5 Score: 90.1225 bits (222), Expect = 2.448e-17
Identity = 80/337 (23.74%), Postives = 138/337 (40.95%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVK------SPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINN----W--ENSSEW------------------LNDVRKFTSNDVCTN-HCSLAFK-DHFHCLFLNCNVSYKKKEKILDHCRRH-RLDKALL 1890
             F++F  ND C    C Y   + H+HCL   C  +  ++   + H   + +  ++ +N ++ F  +     C    C +  +   H+HC+R  C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P   +   S+++   +        SP +  +   T   D    S+PV + +T +     +  A       W  E+ S +                  L   R+F   + C +  C  + K  H+HC   NC   +  +  +  H + H R+D  +L
Sbjct: 1159 GFLQFQDNDPCLATDCKY-ASKFHFHCLFGNCKYVCKTSGKAESHCLDHINPSNSLVNVRDQFAYYSLQCLCPNQHCEFRMR--GHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPS-QGPPSLMDAETDEGMDYTGCSPGAASSESST--MDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVL 1489          

HSP 6 Score: 67.0106 bits (162), Expect = 2.316e-10
Identity = 59/256 (23.05%), Postives = 99/256 (38.67%), Query Frame = 1
Query:  850 CKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK------------------------DAAINQEGFQRFRATEFCSV-----SSCSYHNQRTTHFHCM----RPNCKFTFKNKADMD----KHKSHHQR---NDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            C N+ C+  + R H+HC++  C        ++  H K H+K E      F  F+  ++C    C YN   +H+HC+  GC   ++    +  H+  H +                        D  ++  G     A+   S      SS    N+ T   + +        K  F    DM     + K+   R   ++ +  EGF+++  YE C  + C+FS  + H HC R NC Y       +  H + H+R
Sbjct: 1229 CPNQHCEFRM-RGHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQGPPSLMDAETDEGMDYTGCSPGAASSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR 1483          

HSP 7 Score: 56.9954 bits (136), Expect = 2.761e-7
Identity = 30/108 (27.78%), Postives = 48/108 (44.44%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ +   C    C       HFHC++C+       ++  H K H K++      F +FS + DC    C Y  + +H+HC + GC    +  S +  H   H+K
Sbjct: 1490 DDFKRFKASLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEK 1597          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Mouse
Match: Casz1 (castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:1196251])

HSP 1 Score: 100.908 bits (250), Expect = 4.624e-21
Identity = 50/179 (27.93%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITP 1524
             F RF   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+A+  C  + C +    +THFHC+R  C+F   +   +  H+ HH + D ++  GF ++     C    CK+    +H HC    C + V   +Q++SH+RKHE++        +P
Sbjct:  297 GFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGT-STHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQERGEPPAASP 472          

HSP 2 Score: 99.3673 bits (246), Expect = 1.687e-20
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +R+  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C+   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C+V  C Y   + +HFHC  P C+ T    + MD HK  H++ +
Sbjct:  298 FRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKY-KLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQE 463          

HSP 3 Score: 82.8037 bits (203), Expect = 2.466e-15
Identity = 41/118 (34.75%), Postives = 64/118 (54.24%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+RF   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct:  290 DEGMMLEGFRRFDLYEDCKDTACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQ 404          

HSP 4 Score: 73.559 bits (179), Expect = 1.799e-12
Identity = 33/90 (36.67%), Postives = 48/90 (53.33%), Query Frame = 1
Query: 1234 HFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLS 1503
            H+HC+R  C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L 
Sbjct:    5 HYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLG 94          

HSP 5 Score: 61.2326 bits (147), Expect = 1.115e-8
Identity = 33/89 (37.08%), Postives = 43/89 (48.31%), Query Frame = 1
Query: 1051 QTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQR 1317
            + HYHCL  GC  +   T+ +  H   H+K       GF+ F   E C    C Y NQ  +HFHC+R  C+F+F  K  M  H   H R
Sbjct:    3 RGHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKY-NQVNSHFHCIREGCQFSFLLKHQMTSHARKHMR 90          

HSP 6 Score: 56.6102 bits (135), Expect = 3.137e-7
Identity = 30/108 (27.78%), Postives = 48/108 (44.44%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ +   C    C       HFHC++C+       ++  H K H K++      F +FS + DC    C Y  + +H+HC + GC    +  S +  H   H+K
Sbjct:  354 DDFKRFKASLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEK 461          
BLAST of Zinc finger protein castor-like protein 1 vs. UniProt/SwissProt
Match: sp|Q7M3M8|CAS_DROME (Transcription factor castor OS=Drosophila melanogaster OX=7227 GN=cas PE=1 SV=2)

HSP 1 Score: 270.781 bits (691), Expect = 8.491e-75
Identity = 120/230 (52.17%), Postives = 168/230 (73.04%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTIL-RREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM---CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            +++ SSY +C+N  C+++ LR+HFHC +  C+  IL +++++IRH KWHKKR+ESL   F RFS +DDC       C YN +QTHYHC++  C K+Y+STSDVQMH+NFH+KD+ I  EGF+RFRA E C +  C +  ++ +H+HC R  C  TFKNKADMDKHK++H ++  L  +GFKK +K E C F  CKFS + NHIHC+R  CDY++HSS+Q+ SH+RKH+R+
Sbjct:  354 LRKVSSYLECENSLCRQENLREHFHCHEEPCQGKILSKKDDIIRHLKWHKKRKESLKLGFARFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHANFHRKDSEIVNEGFRRFRAHETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDGFKKILKTEVCPFDACKFSTVCNHIHCVREGCDYILHSSSQMISHKRKHDRQ 583          

HSP 2 Score: 101.293 bits (251), Expect = 4.512e-20
Identity = 55/189 (29.10%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  778 KENLQLNYAEMDEDCIKRYSSYEDCK---NEQCQKDLLRDHFHCI--QCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQ-THYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDS 1326
            KE+L+L +A        R+SS +DC     E C  +  + H+HC+   C K  +   ++  H+ +H+K  E ++  F RF  ++ C    C + G++ +HYHC   GC   + + +D+  H  +H KD  +  +GF++   TE C   +C + +    H HC+R  C +   + + M  HK  H R D 
Sbjct:  406 KESLKLGFA--------RFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHANFHRKDSEIVNEGFRRFRAHETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDGFKKILKTEVCPFDACKF-STVCNHIHCVREGCDYILHSSSQMISHKRKHDRQDG 585          
BLAST of Zinc finger protein castor-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9CWL2|CASZ1_MOUSE (Zinc finger protein castor homolog 1 OS=Mus musculus OX=10090 GN=Casz1 PE=1 SV=3)

HSP 1 Score: 262.307 bits (669), Expect = 3.902e-69
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  467 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASL 708          

HSP 2 Score: 102.449 bits (254), Expect = 3.147e-20
Identity = 50/179 (27.93%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITP 1524
             F RF   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+A+  C  + C +    +THFHC+R  C+F   +   +  H+ HH + D ++  GF ++     C    CK+    +H HC    C + V   +Q++SH+RKHE++        +P
Sbjct: 1433 GFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGT-STHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQERGEPPAASP 1608          

HSP 3 Score: 100.138 bits (248), Expect = 1.774e-19
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +R+  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C+   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C+V  C Y   + +HFHC  P C+ T    + MD HK  H++ +
Sbjct: 1434 FRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKY-KLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQE 1599          

HSP 4 Score: 99.3673 bits (246), Expect = 2.592e-19
Identity = 70/269 (26.02%), Postives = 116/269 (43.12%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM------------CTYNGRQTHYHCLHAGC-------------NKIYISTSD--------VQMHSNFHKK----------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             K ++  E+C    C+ + +  HFHCI+  C+ + L + +M  H++ H +R   L  NF R  P+      M            C+     +    +   C             N I + T+         ++  S F K+          D  +  EGF+RF   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1277 FKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRR--MLGKNFDRVPPSQGPPSLMDAETDEGMDYTGCSPGAASSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQ 1540          

HSP 5 Score: 90.1225 bits (222), Expect = 1.641e-16
Identity = 80/337 (23.74%), Postives = 138/337 (40.95%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVK------SPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINN----W--ENSSEW------------------LNDVRKFTSNDVCTN-HCSLAFK-DHFHCLFLNCNVSYKKKEKILDHCRRH-RLDKALL 1890
             F++F  ND C    C Y   + H+HCL   C  +  ++   + H   + +  ++ +N ++ F  +     C    C +  +   H+HC+R  C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P   +   S+++   +        SP +  +   T   D    S+PV + +T +     +  A       W  E+ S +                  L   R+F   + C +  C  + K  H+HC   NC   +  +  +  H + H R+D  +L
Sbjct: 1159 GFLQFQDNDPCLATDCKY-ASKFHFHCLFGNCKYVCKTSGKAESHCLDHINPSNSLVNVRDQFAYYSLQCLCPNQHCEFRMR--GHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPS-QGPPSLMDAETDEGMDYTGCSPGAASSESST--MDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVL 1489          

HSP 6 Score: 67.3958 bits (163), Expect = 1.606e-9
Identity = 59/256 (23.05%), Postives = 99/256 (38.67%), Query Frame = 1
Query:  850 CKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK------------------------DAAINQEGFQRFRATEFCSV-----SSCSYHNQRTTHFHCM----RPNCKFTFKNKADMD----KHKSHHQR---NDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            C N+ C+  + R H+HC++  C        ++  H K H+K E      F  F+  ++C    C YN   +H+HC+  GC   ++    +  H+  H +                        D  ++  G     A+   S      SS    N+ T   + +        K  F    DM     + K+   R   ++ +  EGF+++  YE C  + C+FS  + H HC R NC Y       +  H + H+R
Sbjct: 1229 CPNQHCEFRM-RGHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQGPPSLMDAETDEGMDYTGCSPGAASSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR 1483          

HSP 7 Score: 56.9954 bits (136), Expect = 1.915e-6
Identity = 30/108 (27.78%), Postives = 48/108 (44.44%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ +   C    C       HFHC++C+       ++  H K H K++      F +FS + DC    C Y  + +H+HC + GC    +  S +  H   H+K
Sbjct: 1490 DDFKRFKASLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEK 1597          
BLAST of Zinc finger protein castor-like protein 1 vs. UniProt/SwissProt
Match: sp|Q86V15|CASZ1_HUMAN (Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1 PE=1 SV=4)

HSP 1 Score: 261.151 bits (666), Expect = 9.804e-69
Identity = 120/243 (49.38%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGIIITPQEF 1533
            I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+  +  +GFQRFRATE C  + C ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR+ C +   S++Q+ SH+RKHERR + S+G +  P   
Sbjct:  468 IARFSGSQHCGHIHCAYQY-REHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSL 709          

HSP 2 Score: 101.679 bits (252), Expect = 4.677e-20
Identity = 49/169 (28.99%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             F RF   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+A+  C  + C +    +THFHC+R  C+F   +   +  H+ HH + D ++  GF ++     C    CK+    +H HC    C + V   +Q++SH+RKHE++
Sbjct: 1433 GFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGT-STHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQ 1598          

HSP 3 Score: 100.138 bits (248), Expect = 1.629e-19
Identity = 71/269 (26.39%), Postives = 120/269 (44.61%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPN-----------DDCNEFM-CTYNGRQTHYHCLHAGC-------------NKIYISTSD--------VQMHSNFHKK----------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             K ++  E+C    C+ + +  HFHCI+  C+ + L + +M  H++ H +R   L  NF R  P+           D+C ++  C+     +    +   C             N I + T+         ++  S F K+          D  +  EGF+RF   E C  ++C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1277 FKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRR--MLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQ 1540          

HSP 4 Score: 99.3673 bits (246), Expect = 2.527e-19
Identity = 54/174 (31.03%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  808 MDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
            M  +  +R+  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C+   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C+V  C Y   + +HFHC  P C+ T    + MD HK  H++ +
Sbjct: 1429 MMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLR--CRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKY-KLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQE 1599          

HSP 5 Score: 86.6557 bits (213), Expect = 1.768e-15
Identity = 74/334 (22.16%), Postives = 134/334 (40.12%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSN------------GIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSS------PVNDINTNSEFLSLIMNAINNWENSSE---------WLNDVRKFTSNDVCTN-HCSLAFK-DHFHCLFLNCNVSYKKKEKILDHCRRH-RLDKALL 1890
             F++F  ND C    C Y   + H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+R  C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L              G++    +   DY+  +        ++ + S  +    NE+ ++      P         ++   M+       ++           L   R+F   + C +  C  + K  H+HC   NC   +  +  +  H + H R+D  +L
Sbjct: 1159 GFLQFQENDPCLATDCKY-ANKFHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMR--GHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVL 1489          

HSP 6 Score: 67.3958 bits (163), Expect = 1.279e-9
Identity = 56/257 (21.79%), Postives = 94/257 (36.58%), Query Frame = 1
Query:  850 CKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHS----------NFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFT--------FKNKADMDKHKSHHQR-----------------------NDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHER 1491
            C N+ C+  + R H+HC++  C        ++  H K H+K E      F  F+  ++C    C YN   +H+HC+  GC   ++    +  H+          NF +   +    G       E    + CS     ++    M  +C  T          N   M       +R                       ++ +  EGF+++  YE C  + C+FS  + H HC R NC Y       +  H + H+R
Sbjct: 1229 CPNQHCEFRM-RGHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCS-PGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR 1483          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A5K3EWY9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 4.552e-135
Identity = 275/714 (38.52%), Postives = 368/714 (51.54%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR--------VLSNGIIITPQEFKSDYSI----------LNLSKNVKSPNSDENSIIT--REFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDV----RKFTSNDVC-TNHCSLAFKD--HFHCLFLNC----------------------NVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCK-WNNCSY---IHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHF-TDSLNGIKCGFKFYSSSNVFCLDDLCMY-FGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSIXXXXXXXXXXXXXXHYHCVRHNCDYSFKRFNTMHQHTKKH------LDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLP 2781
            +K++SS+ +C N  C+    R+HFHC  C+K I RREE IRH KWHKKREESL F FMR+SP DDC    CT+N +QTHYHCL   C+KIYISTSDVQMH+N+H+KDA I QEGFQRFRA E C  + C + ++RTTHFHC RP C FTFKNKADM+KHK+HHQ+ND++AK+GF+KY K EHC + GCK+S +MNHIHCIR  CDY+VHS++QI+SH+RKHERR        V S    ITP  F++   +            LS    SP  D  +I +  R        S V      +     + + ++  E + E L DV    + F     C +  CSL   D  HFHC    C                       +S    +   +H   H     L +  Y  C+  S       +    H HC  W NC++   +   P S +              H   H+   H F   +   + TS   E                        +RKRGRPPK+ +++ +P++E++ ++  D     +LT   F T+  + I  G KFY S    C+D  C +  GR AH+HC+R RC+ AT +L  +N HRREFH  + I+ GY+YFDRSI+CRR  C   +  NH+HC+R  C YSF R   M QHT  H             +   +S+N   P           T+P
Sbjct:   75 LKKFSSFHECGNPHCRTAGHREHFHCTHCEKVINRREETIRHLKWHKKREESLQFGFMRYSPGDDCGVSSCTHNMKQTHYHCLRPNCSKIYISTSDVQMHANYHRKDAVILQEGFQRFRAAEDCGSNDCPFSSERTTHFHCRRPGCNFTFKNKADMEKHKNHHQKNDAIAKDGFRKYTKSEHCKYLGCKYSGIMNHIHCIRPGCDYIVHSASQISSHKRKHERRELLTFPSPVASQPHQITPTSFENGSDVTTTPSTTTTTPKLSPQPGSPLVDPQTITSTARILQRVTKISEVCWHKFQNPGFKHLHDDVDT-ETADEVLQDVLPSLKVFKDGQSCDSQQCSLNGTDMEHFHCYRTGCMDVVDADANEEETHGGSAVECPTLSSGDMDAWREHWFTHAWQSTLAVIGYSRCSGGS---CGLGVAGKDHLHCYLWPNCTFTAEVSSTPPSLMR-------------HLARHD---HHFAAVQVKEQATSLPVEPGAT--------------------QRKRGRPPKHSRDIHVPRLEVSPDKCADPTPHVELTMEDFLTNKPDMIAGGAKFYQSDGPACVDRCCPFHAGRQAHFHCIRPRCHMATASLFVLNTHRREFHAQVTIEPGYDYFDRSIDCRRPSCYAKKDTNHFHCLRLRCGYSFVRVGKMQQHTALHEGGGGGGGGGGGSVVEARSLNHALPLFPPLGMGRDGTVP 748          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A3P6HQU9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7388 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 1.018e-134
Identity = 275/714 (38.52%), Postives = 368/714 (51.54%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR--------VLSNGIIITPQEFKSDYSI----------LNLSKNVKSPNSDENSIIT--REFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDV----RKFTSNDVC-TNHCSLAFKD--HFHCLFLNC----------------------NVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHC-KWNNCSY---IHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHF-TDSLNGIKCGFKFYSSSNVFCLDDLCMY-FGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSIXXXXXXXXXXXXXXHYHCVRHNCDYSFKRFNTMHQHTKKH------LDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLP 2781
            +K++SS+ +C N  C+    R+HFHC  C+K I RREE IRH KWHKKREESL F FMR+SP DDC    CT+N +QTHYHCL   C+KIYISTSDVQMH+N+H+KDA I QEGFQRFRA E C  + C + ++RTTHFHC RP C FTFKNKADM+KHK+HHQ+ND++AK+GF+KY K EHC + GCK+S +MNHIHCIR  CDY+VHS++QI+SH+RKHERR        V S    ITP  F++   +            LS    SP  D  +I +  R        S V      +     + + ++  E + E L DV    + F     C +  CSL   D  HFHC    C                       +S    +   +H   H     L +  Y  C+  S       +    H HC  W NC++   +   P S +              H   H+   H F   +   + TS   E                        +RKRGRPPK+ +++ +P++E++ ++  D     +LT   F T+  + I  G KFY S    C+D  C +  GR AH+HC+R RC+ AT +L  +N HRREFH  + I+ GY+YFDRSI+CRR  C   +  NH+HC+R  C YSF R   M QHT  H             +   +S+N   P           T+P
Sbjct:  152 LKKFSSFHECGNPHCRTAGHREHFHCTHCEKVINRREETIRHLKWHKKREESLQFGFMRYSPGDDCGVSSCTHNMKQTHYHCLRPNCSKIYISTSDVQMHANYHRKDAVILQEGFQRFRAAEDCGSNDCPFSSERTTHFHCRRPGCNFTFKNKADMEKHKNHHQKNDAIAKDGFRKYTKSEHCKYLGCKYSGIMNHIHCIRPGCDYIVHSASQISSHKRKHERRELLTFPSPVASQPHQITPTSFENGSDVTTTPSTTTTTPKLSPQPGSPLVDPQTITSTARILQRVTKISEVCWHKFQNPGFKHLHDDVDT-ETADEVLQDVLPSLKVFKDGQSCDSQQCSLNGTDMEHFHCYRTGCMDVVDADANEEETHGGSAVECPTLSSGDMDAWREHWFTHAWQSTLAVIGYSRCSGGS---CGLGVAGKDHLHCYLWPNCTFTAEVSSTPPSLMR-------------HLARHD---HHFAAVQVKEQATSLPVEPGAT--------------------QRKRGRPPKHSRDIHVPRLEVSPDKCADPTPHVELTMEDFLTNKPDMIAGGAKFYQSDGPACVDRCCPFHAGRQAHFHCIRPRCHMATASLFVLNTHRREFHAQVTIEPGYDYFDRSIDCRRPSCYAKKDTNHFHCLRLRCGYSFVRVGKMQQHTALHEGGGGGGGGGGGSVVEARSLNHALPLFPPLGMGRDGTVP 825          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A267EJ43 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021561g2 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 8.944e-131
Identity = 249/654 (38.07%), Postives = 352/654 (53.82%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSI-LNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEF---LSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCY---------QNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPK-----------YRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIK--CGFKFYSSSNV--FC--LDDLCMYFGRS---AHYHCLRFRCNHATDNLTAVNLHRREFHHYM-QIDDGYEYFDRSIXXXXXXXXXXXXXXHYHCVRHNCDYSFKRFNTMHQHTKKH 2682
            I+RY  +E+C +  C+   +R+H+HC  C++ + RREEMIRH KWHKKR ESL   F+R+SP D C    C++NGRQTHYHC H GC K+YISTSDVQ+H+N+H+KDAAI ++GFQRFRATE C  S+C Y  +RTTHFHC+RPNC FTFKNK DM+KH+ HH RND  A++GF+KY+KYE C+F+ CKFS+LMNHIHCIR  CD+VVHSS+QI SH RKHERR   +             +   N +++       E+  ++    +++  + V D  T +E     + +   +   +     L   ++FT+ND C   C L FKDH HCL   C  +++ KE+  DH R H LD     + +          +C+D+  +          H HC+     Y    P +  E+           +H   HE           T+K       +      +Q               +R+RGRPPK                Q P++E + E + DD +++ L + HF  + +G +  CGF+   +++    C   D  C +   S    H+HC+R RCN A+D+L  +N HRR FH  + ++  G+EYF   + CR   CQ +    H+HCVR  C Y F R  TM  H  KH
Sbjct:  174 IRRYLGFENCGDPGCRSACVREHYHCGDCRRPLGRREEMIRHVKWHKKRAESLALGFLRYSPADQCGSSTCSFNGRQTHYHCAHRGCAKVYISTSDVQIHANYHRKDAAIIRQGFQRFRATEECPDSTCQYQKERTTHFHCLRPNCSFTFKNKTDMEKHRGHHARNDQFARDGFRKYMKYETCEFADCKFSRLMNHIHCIREGCDFVVHSSSQILSHCRKHERRGRDDSGSAAAAAASGSSAADFNNAQDAAVEEHQEDDDVS---GDDSRYAIVADRATLAELEASRAAVRAKLEAADKDQLLLGHCKRFTANDPCQARCELLFKDHQHCLL--CPATFRSKERARDHARLHFLDGEFAAALFYRHQPEEACPHCSDSGSV----------HLHCR-----YCLARPSADGEAEQAAAPPLACLNHVRCHE-AVQLPPPIPPTSKADQQQAAAAAPRLEWQ---------------QRRRGRPPKSASLTTSSSVSIAAQPQPPQLEASPEALFDDGSLALLRREHFLAASSGGRPICGFRMAGAADSPEACGQGDSGCPFADSSNVVEHFHCVRPRCNWASDSLAELNEHRRSFHGQLGELPPGFEYFSPRVACRWPGCQRSGSAGHFHCVRPRCGYVFVRPTTMAAHLAKH 791          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A267GRS0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021561g1 PE=4 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 2.924e-130
Identity = 248/654 (37.92%), Postives = 350/654 (53.52%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSI-LNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEF---LSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCY---------QNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPK-----------YRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIK--CGFKFYSSSN---VFCLDDLCMYFGRSA----HYHCLRFRCNHATDNLTAVNLHRREFHHYM-QIDDGYEYFDRSIXXXXXXXXXXXXXXHYHCVRHNCDYSFKRFNTMHQHTKKH 2682
            I+RY  +E+C +  C+   +R+H+HC  C++ + RREEMIRH KWHKKR ESL   F+R+SP D C    C++NGRQTHYHC H GC K+YISTSDVQ+H+N+H+KDAAI ++GFQRFRATE C  S+C Y  +RTTHFHC+RPNC FTFKNK DM+KH+ HH RND  A++GF+KY+KYE C+F+ CKFS+LMNHIHCIR  CD+VVHSS+QI SH RKHERR   +             +   N +++       E+  ++    +++  + V D  T +E     + +   +   +     L   ++FT+ND C   C L FKDH HCL   C  +++ KE+  DH R H LD     + +          +C+D+  +          H HC+     Y    P +  E+           +H   HE           T+K       +      +Q               +R+RGRPPK                Q P++E + E + DD +++ L + HF  + +G +  CGF+   +++        D    F  S     H+HC+R RCN A+D+L  +N HRR FH  + ++  G+EYF   + CR   CQ +    H+HCVR  C Y F R  TM  H  KH
Sbjct:  174 IRRYLGFENCGDPGCRSACVREHYHCGDCRRPLGRREEMIRHVKWHKKRAESLALGFLRYSPADQCGSSTCSFNGRQTHYHCAHRGCAKVYISTSDVQIHANYHRKDAAIIRQGFQRFRATEECPDSTCQYQKERTTHFHCLRPNCSFTFKNKTDMEKHRGHHARNDQFARDGFRKYMKYETCEFADCKFSRLMNHIHCIREGCDFVVHSSSQILSHCRKHERRGRDDSGSAAAAAASGSSAADFNNAQDAAVEEHQEDDDVS---GDDSRYAIVADRATLAELEASRAAVRAKLEAADKDQLLLGHCKRFTANDPCQARCELLFKDHQHCLL--CPATFRSKERARDHARLHFLDGEFAAALFYRHQPEEACPHCSDSGSV----------HLHCR-----YCLARPSADGEAEQAAAPPLACLNHVRCHE-AVQLPPPIPPTSKADQQQAAAAAPRLEWQ---------------QRRRGRPPKSASLTTSSSVSIATQPQPPQLEASPEALFDDGSLALLRREHFLAAGSGGRPVCGFRMAGAADSPEACGQGDSGCPFADSPNVVEHFHCVRPRCNWASDSLAELNEHRRSFHGQLGELPPGFEYFSPRVACRWPGCQRSGSAGHFHCVRPRCGYVFVRPTTMAAHLAKH 791          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A1I8FSK8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 5.241e-116
Identity = 228/603 (37.81%), Postives = 325/603 (53.90%), Query Frame = 1
Query:  814 EDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSI-LNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEF---LSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCY---------QNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPK-----------YRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIK--CGFKFYSSSNV--FC--LDDLCMYFGRS---AHYHCLRFRCNHATDNLTAVNLHRREFHHYM 2523
            E  I+RY  +E+C +  C+   +R+H+HC  C++ + RREEMIRH KWHKKR ESL   F+R+SP D C    C++NGRQTHYHC H GC K+YISTSDVQ+H+N+H+KDAAI ++GFQRFRATE C  S+C Y  +RTTHFHC+RPNC FTFKNK DM+KH+ HH RND  A++GF+KY+KYE C+F+ CKFS+LMNHIHCIR  CD+VVHSS+QI SH RKHERR   +             +   N +++       E+  ++    +++  + V D  T +E     + +   +   +     L   ++FT+ND C   C L FKDH HCL   C  +++ KE+  DH R H LD     + +          +C+D+  +          H HC+     Y    P +  E+           +H   HE           T+K       +      +Q               +R+RGRPPK                Q P++E + E + DD +++ L + HF  + +G +  CGF+   +++    C   D  C +   S    H+HC+R RCN A+D+L  +N HRR FH  +
Sbjct:   47 ESYIRRYLGFENCGDPGCRSACVREHYHCGDCRRPLGRREEMIRHVKWHKKRAESLALGFLRYSPADQCGSSTCSFNGRQTHYHCAHRGCAKVYISTSDVQIHANYHRKDAAIIRQGFQRFRATEECPDSTCQYQKERTTHFHCLRPNCSFTFKNKTDMEKHRGHHARNDQFARDGFRKYMKYETCEFADCKFSRLMNHIHCIREGCDFVVHSSSQILSHCRKHERRGRDDSGSAAAAAASGSSAADFNNAQDAAVEEHQEDDDVS---GDDSRYAIVADRATLAELEASRAAVRAKLEAADKDQLLLGHCKRFTANDPCQARCELLFKDHQHCLL--CPATFRSKERARDHARLHFLDGEFAAALFYRHQPEEACPHCSDSGSV----------HLHCR-----YCLARPSADGEAEQAAAPPLACLNHVRCHE-AVQLPPPIPPTSKADQQQAAAAAPRLEWQ---------------QRRRGRPPKSASLTTSSSVSIAAQPQPPQLEASPEALFDDGSLALLRREHFLAASSGGRPICGFRMAGAADSPEACGQGDSGCPFADSSNVVEHFHCVRPRCNWASDSLAELNEHRRSFHGQL 613          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Cavefish
Match: casz1 (castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060130-108])

HSP 1 Score: 260.766 bits (665), Expect = 1.630e-69
Identity = 124/252 (49.21%), Postives = 164/252 (65.08%), Query Frame = 1
Query:  754 PTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            P EK      N+   Y       I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+A +  +GFQRFRATE C   SC ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR  C +   S++Q+ SH+RKHERR
Sbjct:  501 PPEKPVTEDVNVYQKY-------IARFSGSQHCGHVHCAYQY-REHYHCMDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNAQLINDGFQRFRATEDCGTVSCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRQGCGFTFTSTSQMTSHKRKHERR 744          

HSP 2 Score: 102.449 bits (254), Expect = 3.800e-21
Identity = 48/181 (26.52%), Postives = 92/181 (50.83%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQE 1530
             F R+   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C  + C + +  +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+ + CK+    +H HC    C + V   +Q++SH+RKHE++       ++P +
Sbjct: 1511 GFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCGFTDCQF-SGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQERGEPPSVSPNQ 1688          

HSP 3 Score: 102.449 bits (254), Expect = 3.800e-21
Identity = 55/169 (32.54%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C    C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V+ C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1512 FRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCGFTDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVADCKY-KLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQE 1677          

HSP 4 Score: 90.1225 bits (222), Expect = 1.799e-17
Identity = 52/184 (28.26%), Postives = 86/184 (46.74%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQE 1530
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +
Sbjct: 1207 GFLQFQDNDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFSYYSLQCLCPNQHCEF--RMRGHYHCLRPGCFFVTNITTKLPWHVKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCMFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQ 1387          

HSP 5 Score: 84.7297 bits (208), Expect = 9.523e-16
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1504 DEGMMLEGFRRYDLYEDCKDSACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCGFTDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1618          

HSP 6 Score: 55.4546 bits (132), Expect = 6.485e-7
Identity = 64/268 (23.88%), Postives = 104/268 (38.81%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFS--------PNDDCNEFMCTYNGRQTHYHCLHAGCNKIY--------------ISTSDVQMHSNFHKKDAAINQE--GFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYS 1548
             K ++  E+C    C+ + +  HFHCI+  C  + L + +M  H++ H +R   L  NF R          P+D+  + M       T     H G N  +                 S + + S    +D +      G     A    S+ + +   +R      M P   F  + K       S    ++ +  EGF++Y  YE C  S C+FS  + H HC R NC Y       +  H + H+R  + N ++   + FKS  S
Sbjct: 1325 FKYFTKREECGRLGCKYNQVNSHFHCIREGCMFSFLLKHQMTSHARKHMRR--MLGKNFDRVPSQVVAHGHPSDEM-QHMAGLGSPGTMGG--HPGMNSSFPGMMDDNDDYMDYMAGGSPLGLSSESSNQDRSCTSTPVGNDSSPAGNTISIPTATGAKKRFWIIEDMSP---FGKRRKTA----SSRKMLDEGMMLEGFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR--VDNLVLDDFKRFKSSLS 1578          

HSP 7 Score: 55.4546 bits (132), Expect = 7.114e-7
Identity = 31/108 (28.70%), Postives = 47/108 (43.52%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC +  C    +  S +  H   H+K
Sbjct: 1568 DDFKRFKSSLSCGFTDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEK 1675          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Cavefish
Match: casz1 (castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060130-108])

HSP 1 Score: 258.07 bits (658), Expect = 6.057e-69
Identity = 124/252 (49.21%), Postives = 164/252 (65.08%), Query Frame = 1
Query:  754 PTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCI--QCK-KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            P EK      N+   Y       I R+S  + C +  C     R+H+HC+  +C  +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GCNK+Y STSDV  H NFHKK+A +  +GFQRFRATE C   SC ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIR  C +   S++Q+ SH+RKHERR
Sbjct:  465 PPEKPVTEDVNVYQKY-------IARFSGSQHCGHVHCAYQY-REHYHCMDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNAQLINDGFQRFRATEDCGTVSCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRQGCGFTFTSTSQMTSHKRKHERR 708          

HSP 2 Score: 101.679 bits (252), Expect = 5.950e-21
Identity = 55/169 (32.54%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YEDCK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  C    C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V+ C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1373 FRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCGFTDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVADCKY-KLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQE 1538          

HSP 3 Score: 100.138 bits (248), Expect = 1.481e-20
Identity = 47/169 (27.81%), Postives = 87/169 (51.48%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             F R+   +DC +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C  + C +    +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+ + CK+    +H HC    C + V   +Q++SH+RKHE++
Sbjct: 1372 GFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCGFTDCQFSGN-STHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEKQ 1537          

HSP 4 Score: 93.9745 bits (232), Expect = 1.287e-18
Identity = 78/324 (24.07%), Postives = 136/324 (41.98%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVND-----INTNSEFLSLIMNAINNWE------------NSSEWLNDVRKFTSNDVCTNH-CSLAFK-DHFHCLFLNCNVSYKKKEKILDHCRRH-RLDKALL 1890
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  +  +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +       + L  + +S N D +   T      N SSP  +       T ++    I+  ++ +             +    L   R++   + C +  C  + K  H+HC   NC   +  +  +  H + H R+D  +L
Sbjct: 1118 GFLQFQDNDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNNLVNVRDQFSYYSLQCLCPNQHCEFRMR--GHYHCLRPGCFFVTNITTKLPWHVKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCMFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQ-------VPLGLSSESSNQDRSCTST---PVGNDSSPAGNTISIPTATGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVL 1428          

HSP 5 Score: 93.5893 bits (231), Expect = 1.590e-18
Identity = 69/250 (27.60%), Postives = 114/250 (45.60%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNF------MRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSD--------VQMHSNFHKK----------DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
             K ++  E+C    C+ + +  HFHCI+  C  + L + +M  H++ H +R    +F+       +  S      +  CT            AG N I I T+         ++  S F K+          D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C F+ C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1236 FKYFTKREECGRLGCKYNQVNSHFHCIREGCMFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQVPLGLSSESSNQDRSCTST--PVGNDSSPAG-NTISIPTATGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRYDLYEDCKDSACQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCGFTDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1479          

HSP 6 Score: 72.4034 bits (176), Expect = 5.187e-12
Identity = 65/257 (25.29%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  850 CKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRT---------------THFHCMRPNCKFTFKNKADMD----KHKSHHQR---NDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYS 1548
            C N+ C+  + R H+HC++  C        ++  H K H+K E      F  F+  ++C    C YN   +H+HC+  GC   ++    +  H+  H +   +  + F R  +     +SS S +  R+               T         K  F    DM     + K+   R   ++ +  EGF++Y  YE C  S C+FS  + H HC R NC Y       +  H + H+R  + N ++   + FKS  S
Sbjct: 1188 CPNQHCEFRM-RGHYHCLRPGCFFVTNITTKLPWHVKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCMFSFLLKHQMTSHARKHMRR--MLGKNFDRVPSQVPLGLSSESSNQDRSCTSTPVGNDSSPAGNTISIPTATGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRYDLYEDCKDSACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDR--VDNLVLDDFKRFKSSLS 1439          

HSP 7 Score: 54.6842 bits (130), Expect = 1.003e-6
Identity = 31/108 (28.70%), Postives = 47/108 (43.52%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC +  C    +  S +  H   H+K
Sbjct: 1429 DDFKRFKSSLSCGFTDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVADCKYKLKCSHFHCTYPECKHTVVGMSQMDSHKRKHEK 1536          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Medaka
Match: casz1 (castor zinc finger 1 [Source:NCBI gene;Acc:101161403])

HSP 1 Score: 265.003 bits (676), Expect = 7.740e-71
Identity = 127/262 (48.47%), Postives = 172/262 (65.65%), Query Frame = 1
Query:  754 PTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILR---REEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGII 1515
            P +K   +  NL   Y       I R+S  + C +  C     R+H+HC+   C   + R   ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GC+K+Y STSDV  H NFHKK+A +  +GFQRFRATE C   SC ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIRS C +   S++Q+ SH+RKHERR + S+G++
Sbjct:  518 PPDKPTTDDVNLYQKY-------IARFSGSQHCGHVHCAYQY-REHYHCMDPDCNYQVSRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCSKVYTSTSDVMTHENFHKKNAQLINDGFQRFRATEDCGTVSCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRSGCGFTFTSTSQMTSHKRKHERRHIRSSGVM 771          

HSP 2 Score: 100.523 bits (249), Expect = 1.414e-20
Identity = 55/169 (32.54%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YE+CK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V  C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1655 FRRYDLYENCKDSTCQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKY-KLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEKQE 1820          

HSP 3 Score: 98.2117 bits (243), Expect = 7.249e-20
Identity = 47/181 (25.97%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQE 1530
             F R+   ++C +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C +    +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+   CK+    +H HC    C + V   +Q++SH+RKHE++       ++P++
Sbjct: 1654 GFRRYDLYENCKDSTCQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGN-STHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKYKLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEKQERGELPSVSPKQ 1831          

HSP 4 Score: 93.5893 bits (231), Expect = 1.971e-18
Identity = 52/185 (28.11%), Postives = 87/185 (47.03%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEF 1533
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  ++ +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P + 
Sbjct: 1231 GFLQFQENDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNSLVNVRDQFSYYSLQCLCPNQQCEFRMR--GHYHCLRPGCFFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIRDGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQV 1412          

HSP 5 Score: 84.3445 bits (207), Expect = 1.111e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1647 DEGMMLEGFRRYDLYENCKDSTCQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1761          

HSP 6 Score: 53.9138 bits (128), Expect = 2.205e-6
Identity = 31/108 (28.70%), Postives = 46/108 (42.59%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC    C    +  S +  H   H+K
Sbjct: 1711 DDFKRFKSSLSCNFPDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKYKLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEK 1818          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Medaka
Match: casz1 (castor zinc finger 1 [Source:NCBI gene;Acc:101161403])

HSP 1 Score: 265.003 bits (676), Expect = 7.952e-71
Identity = 127/262 (48.47%), Postives = 172/262 (65.65%), Query Frame = 1
Query:  754 PTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILR---REEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGII 1515
            P +K   +  NL   Y       I R+S  + C +  C     R+H+HC+   C   + R   ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GC+K+Y STSDV  H NFHKK+A +  +GFQRFRATE C   SC ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIRS C +   S++Q+ SH+RKHERR + S+G++
Sbjct:  508 PPDKPTTDDVNLYQKY-------IARFSGSQHCGHVHCAYQY-REHYHCMDPDCNYQVSRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCSKVYTSTSDVMTHENFHKKNAQLINDGFQRFRATEDCGTVSCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRSGCGFTFTSTSQMTSHKRKHERRHIRSSGVM 761          

HSP 2 Score: 100.523 bits (249), Expect = 1.400e-20
Identity = 55/169 (32.54%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YE+CK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V  C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1645 FRRYDLYENCKDSTCQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKY-KLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEKQE 1810          

HSP 3 Score: 98.2117 bits (243), Expect = 7.240e-20
Identity = 47/181 (25.97%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQE 1530
             F R+   ++C +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C +    +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+   CK+    +H HC    C + V   +Q++SH+RKHE++       ++P++
Sbjct: 1644 GFRRYDLYENCKDSTCQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGN-STHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKYKLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEKQERGELPSVSPKQ 1821          

HSP 4 Score: 93.5893 bits (231), Expect = 1.840e-18
Identity = 52/185 (28.11%), Postives = 87/185 (47.03%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEF 1533
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  ++ +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P + 
Sbjct: 1221 GFLQFQENDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNSLVNVRDQFSYYSLQCLCPNQQCEFRMR--GHYHCLRPGCFFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIRDGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQV 1402          

HSP 5 Score: 84.3445 bits (207), Expect = 1.119e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1637 DEGMMLEGFRRYDLYENCKDSTCQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1751          

HSP 6 Score: 53.9138 bits (128), Expect = 2.043e-6
Identity = 31/108 (28.70%), Postives = 46/108 (42.59%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC    C    +  S +  H   H+K
Sbjct: 1701 DDFKRFKSSLSCNFPDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKYKLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEK 1808          
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Medaka
Match: casz1 (castor zinc finger 1 [Source:NCBI gene;Acc:101161403])

HSP 1 Score: 262.692 bits (670), Expect = 3.504e-70
Identity = 120/237 (50.63%), Postives = 163/237 (68.78%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQCK---KTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFM--CTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR-VLSNGII 1515
            I R+S  + C +  C     R+H+HC+      +    ++++IRH   HKKR+ SL   FMRFSP DDC+ +   C  NG+ THYHC+  GC+K+Y STSDV  H NFHKK+A +  +GFQRFRATE C   SC ++ Q+TTHFHC RP C FTFKNK D++KHKS+H ++D+ AK+GFKK+ KYE C + GC +SK  NH HCIRS C +   S++Q+ SH+RKHERR + S+G++
Sbjct:  534 IARFSGSQHCGHVHCAYQY-REHYHCMDPDCNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCSKVYTSTSDVMTHENFHKKNAQLINDGFQRFRATEDCGTVSCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRSGCGFTFTSTSQMTSHKRKHERRHIRSSGVM 769          

HSP 2 Score: 100.138 bits (248), Expect = 1.658e-20
Identity = 55/169 (32.54%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  823 IKRYSSYEDCKNEQCQKDLLRDHFHCIQ--CKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRND 1323
             +RY  YE+CK+  CQ  L   H+HC +  C      R  M +H++ H + +  +  +F RF  +  CN   C ++G  TH+HCL   C      ++ V  H   H K   I+  GF +F ++  C V  C Y   + +HFHC  P CK T    + MD HK  H++ +
Sbjct: 1534 FRRYDLYENCKDSTCQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKY-KLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEKQE 1699          

HSP 3 Score: 98.2117 bits (243), Expect = 7.127e-20
Identity = 47/181 (25.97%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQE 1530
             F R+   ++C +  C ++ + THYHC    C   +   + +  H+  H +   +  + F+RF+++  C+   C +    +THFHC+R  C F   +   +  H+ HH + D ++  GF ++     C+   CK+    +H HC    C + V   +Q++SH+RKHE++       ++P++
Sbjct: 1533 GFRRYDLYENCKDSTCQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGN-STHFHCLR--CGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKYKLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEKQERGELPSVSPKQ 1710          

HSP 4 Score: 93.5893 bits (231), Expect = 1.709e-18
Identity = 86/362 (23.76%), Postives = 145/362 (40.06%), Query Frame = 1
Query:  988 NFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMH--SNFHKKDAAIN-QEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSK--------NVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNH----------CSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMS------CYQNCTDNSHINTDNPIQNPCHYHCKWNNCSY 1992
             F++F  ND C    C Y+ +  H+HCL   C  +  ++   + H   + +  ++ +N ++ F  +     C    C +  +   H+HC+RP C F       +  H   H++ +  A  GFK + K E C   GCK++++ +H HCIR  C +      Q+ SH RKH RR+L       P +      ++ LS+        +  S  +  ++ IT    +         ++   E++  +    +    SSE  N  R  TS  V  +            +   K  F    +     Y K+ K      R  LD+ +++        Y+NC D    +T        HYHC   NC Y
Sbjct: 1229 GFLQFQENDPCLATDCKYSNK-FHFHCLFGNCKYVCKTSGKAESHCLDHINPNNSLVNVRDQFSYYSLQCLCPNQQCEFRMR--GHYHCLRPGCFFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIRDGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPSQ------VMPLSQRGDEMHASSYGSGPAAAHTGITSCLSSAA-------LDETDEYMDYVGGGGSPLGLSSESSNQDRSCTSTPVGNDSSPAGNTISIPTATGAKKRF--WIIEDMSPYGKRRKTAS--SRKMLDEGMMLEGFRRYDLYENCKD----STCQFSLKVTHYHCTRENCGY 1566          

HSP 5 Score: 84.3445 bits (207), Expect = 1.143e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1141 DAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERR 1494
            D  +  EGF+R+   E C  S+C + + + TH+HC R NC + F  +  M KH  HH R D+L  + FK++     C+F  C+FS    H HC+R  C +    S ++ +HR+ H ++
Sbjct: 1526 DEGMMLEGFRRYDLYENCKDSTCQF-SLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKSSLSCNFPDCQFSGNSTHFHCLR--CGFRCTDSTKVTAHRKHHGKQ 1640          

HSP 6 Score: 53.5286 bits (127), Expect = 2.401e-6
Identity = 31/108 (28.70%), Postives = 46/108 (42.59%), Query Frame = 1
Query:  817 DCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKK 1140
            D  KR+ S   C    CQ      HFHC++C        ++  H K H K++      F +FS + DC    C Y  + +H+HC    C    +  S +  H   H+K
Sbjct: 1590 DDFKRFKSSLSCNFPDCQFSGNSTHFHCLRCGFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCEVPDCKYKLKCSHFHCTFPECKHTVVGMSQMDSHKRKHEK 1697          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000038913.1 (SMESG000038913.1)

HSP 1 Score: 1821.21 bits (4716), Expect = 0.000e+0
Identity = 930/946 (98.31%), Postives = 932/946 (98.52%), Query Frame = 1
Query:  187 MAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNPTDELNARRRKRKTSVPKSITDKDQIKTDKLVFDKSCGALDLSLNQRNLSEPIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQSNLFNKQTNXXXXXXXXXXXXXXAKEIQVQNLIDQESKFNFSNVSISSNPTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDLCMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSIXXXXXXXXXXXXXXHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSNDQILYRNPQENMSLPIIPSLTNNSGISLPPXXXXXXXXXXXXXXXXXHNTIKALM 3024
            MAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNPTDELNARRRKRKTSVPK             +FDKSCGALDLSLNQRNLSEPIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQSNLFNK TNS+TSSDSDSKSEDDAKEIQVQNLIDQESKFNFSNVSISSNPTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDLCMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSINCRRNQCQNNRVNNHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSNDQILYRNPQENMSLPIIPSLTNNSGISLPPSMNLNLLMSFNNSLSNFHNTIKALM
Sbjct:    1 MAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNPTDELNARRRKRKTSVPK-------------IFDKSCGALDLSLNQRNLSEPIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQSNLFNKPTNSQTSSDSDSKSEDDAKEIQVQNLIDQESKFNFSNVSISSNPTEKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDLCMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSINCRRNQCQNNRVNNHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSNDQILYRNPQENMSLPIIPSLTNNSGISLPPSMNLNLLMSFNNSLSNFHNTIKALM 933          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000038913.1 (SMESG000038913.1)

HSP 1 Score: 1816.97 bits (4705), Expect = 0.000e+0
Identity = 930/947 (98.20%), Postives = 932/947 (98.42%), Query Frame = 1
Query:  187 MAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNPTDELNARRRKRKTSVPKSITDKDQIKTDKLVFDKSCGALDLSLNQRNLSEPIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQSNLFNKQTNXXXXXXXXXXXXXXAKEIQVQNLIDQESKFNFSNVSISSNPTEKGFINK-ENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDLCMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSIXXXXXXXXXXXXXXHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSNDQILYRNPQENMSLPIIPSLTNNSGISLPPXXXXXXXXXXXXXXXXXHNTIKALM 3024
            MAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNPTDELNARRRKRKTSVPK             +FDKSCGALDLSLNQRNLSEPIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQSNLFNK TNS+TSSDSDSKSEDDAKEIQVQNLIDQESKFNFSNVSISSNPTEKGFINK ENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDLCMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSINCRRNQCQNNRVNNHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSNDQILYRNPQENMSLPIIPSLTNNSGISLPPSMNLNLLMSFNNSLSNFHNTIKALM
Sbjct:    1 MAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNPTDELNARRRKRKTSVPK-------------IFDKSCGALDLSLNQRNLSEPIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQSNLFNKPTNSQTSSDSDSKSEDDAKEIQVQNLIDQESKFNFSNVSISSNPTEKGFINKAENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQCKKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTHYHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSCSYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIKYEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNGIIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINTNSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNKSTNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQIPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDLCMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRSINCRRNQCQNNRVNNHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLTATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSNDQILYRNPQENMSLPIIPSLTNNSGISLPPSMNLNLLMSFNNSLSNFHNTIKALM 934          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000013006.1 (SMESG000013006.1)

HSP 1 Score: 444.891 bits (1143), Expect = 1.592e-132
Identity = 311/315 (98.73%), Postives = 314/315 (99.68%), Query Frame = 1
Query: 3676 PVYSIHQATNINNTPLVSAASQSYTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMXXXXXXXXXXXXXXXXXXXXXXXXFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNXXXXXXXXXXXXXXXXXXWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALXXXXXXXXXXXXXXXXXXXFGCDIXXXXXXXXXXXXXXXXXXXXQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI 4620
            PVYSIHQATNINNTPLVSAASQ+YTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMNQSPNPSQPTPIIN QNNIPQPIPFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALATQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALSYNIQQSSLSNSNESSSASFGCDINTT+T+NSNKNTISSSSSSSQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI
Sbjct:  870 PVYSIHQATNINNTPLVSAASQNYTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMNQSPNPSQPTPIINQQNNIPQPIPFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALATQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALSYNIQQSSLSNSNESSSASFGCDINTTVTTNSNKNTISSSSSSSQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI 1184          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000013006.1 (SMESG000013006.1)

HSP 1 Score: 444.506 bits (1142), Expect = 2.391e-127
Identity = 311/315 (98.73%), Postives = 314/315 (99.68%), Query Frame = 1
Query: 3676 PVYSIHQATNINNTPLVSAASQSYTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMXXXXXXXXXXXXXXXXXXXXXXXXFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNXXXXXXXXXXXXXXXXXXWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALXXXXXXXXXXXXXXXXXXXFGCDIXXXXXXXXXXXXXXXXXXXXQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI 4620
            PVYSIHQATNINNTPLVSAASQ+YTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMNQSPNPSQPTPIIN QNNIPQPIPFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALATQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALSYNIQQSSLSNSNESSSASFGCDINTT+T+NSNKNTISSSSSSSQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI
Sbjct: 2311 PVYSIHQATNINNTPLVSAASQNYTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMNQSPNPSQPTPIINQQNNIPQPIPFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALATQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALSYNIQQSSLSNSNESSSASFGCDINTTVTTNSNKNTISSSSSSSQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI 2625          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000013006.1 (SMESG000013006.1)

HSP 1 Score: 444.506 bits (1142), Expect = 2.613e-127
Identity = 311/315 (98.73%), Postives = 314/315 (99.68%), Query Frame = 1
Query: 3676 PVYSIHQATNINNTPLVSAASQSYTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMXXXXXXXXXXXXXXXXXXXXXXXXFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNXXXXXXXXXXXXXXXXXXWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALXXXXXXXXXXXXXXXXXXXFGCDIXXXXXXXXXXXXXXXXXXXXQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI 4620
            PVYSIHQATNINNTPLVSAASQ+YTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMNQSPNPSQPTPIIN QNNIPQPIPFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALATQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALSYNIQQSSLSNSNESSSASFGCDINTT+T+NSNKNTISSSSSSSQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI
Sbjct: 2309 PVYSIHQATNINNTPLVSAASQNYTSKSHNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLDLNSPLTSSEFTVLINNIMNQSPNPSQPTPIINQQNNIPQPIPFLPANNGINYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALATQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQTAFNSALSYNIQQSSLSNSNESSSASFGCDINTTVTTNSNKNTISSSSSSSQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI 2623          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CASZ11.356e-7149.38castor zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
CASZ12.042e-6949.38castor zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
CASZ12.872e-1435.05castor zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cas4.611e-7652.17gene:FBgn0004878 transcript:FBtr0339518[more]
cas8.471e-7652.17gene:FBgn0004878 transcript:FBtr0078725[more]
CG75121.759e-1625.76gene:FBgn0036168 transcript:FBtr0113163[more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
casz14.628e-6848.97castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
casz18.176e-6848.97castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CASZ14.682e-7249.38castor zinc finger 1 [Source:NCBI gene;Acc:1001276... [more]
CASZ19.085e-7249.38castor zinc finger 1 [Source:NCBI gene;Acc:1001276... [more]
CASZ18.288e-7049.38castor zinc finger 1 [Source:NCBI gene;Acc:1001276... [more]
CASZ11.067e-6949.38castor zinc finger 1 [Source:NCBI gene;Acc:1001276... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Casz15.171e-7446.97castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Casz14.821e-7246.97castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Casz15.829e-7049.38castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:11... [more]
Casz14.624e-2127.93castor zinc finger 1 [Source:MGI Symbol;Acc:MGI:11... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q7M3M8|CAS_DROME8.491e-7552.17Transcription factor castor OS=Drosophila melanoga... [more]
sp|Q9CWL2|CASZ1_MOUSE3.902e-6949.38Zinc finger protein castor homolog 1 OS=Mus muscul... [more]
sp|Q86V15|CASZ1_HUMAN9.804e-6949.38Zinc finger protein castor homolog 1 OS=Homo sapie... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EWY94.552e-13538.52Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3P6HQU91.018e-13438.52Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A267EJ438.944e-13138.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GRS02.924e-13037.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FSK85.241e-11637.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
casz11.630e-6949.21castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
casz16.057e-6949.21castor zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
casz17.740e-7148.47castor zinc finger 1 [Source:NCBI gene;Acc:1011614... [more]
casz17.952e-7148.47castor zinc finger 1 [Source:NCBI gene;Acc:1011614... [more]
casz13.504e-7050.63castor zinc finger 1 [Source:NCBI gene;Acc:1011614... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038913.10.000e+098.31SMESG000038913.1[more]
SMESG000038913.10.000e+098.20SMESG000038913.1[more]
SMESG000013006.11.592e-13298.73SMESG000013006.1[more]
SMESG000013006.12.391e-12798.73SMESG000013006.1[more]
SMESG000013006.12.613e-12798.73SMESG000013006.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024786 ID=SMED30024786|Name=Zinc finger protein castor-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5170bp
TAGACGACGATGACGACAACAACACCATCTTTTTATGAAATATTAATTTA
CCAACAAAATCAAACAAACCCGAAAAAGATTTTTCAGTTTTTATTTTTTT
TGTTGTTTCTTTTTCTCCAATTAAACTACCGACAACACAAGCGAACAACA
AAAATGTTTTATTCATCGAAATTCAACTGTTTTCAGATGGCAGAAGTCGA
AGCGATTTGCGCGAAACTTCAGAATAAGCCGATGATGACAATAAAAAGCG
AGAAAGAAACCAATTGTGTTTGTTTTCCCAACCCAACAATGCAAATTGAT
ATGAATCCTACCGACGAATTGAATGCGAGGCGCCGGAAAAGAAAAACAAG
TGTCCCGAAAAGTATTACTGATAAAGATCAAATTAAAACTGATAAGTTAG
TATTCGATAAATCGTGCGGAGCTCTTGATTTGAGTTTGAATCAACGAAAT
CTTTCAGAACCGATAGATGTCAATGGTAGCCAAGATTCTGATTATGACGC
GAAGCCAGGGGTGAATATCAATTTCCTACAAAATCCTCTCATGAATATCT
TCATGAAAAATCGAGAACATTTGGAACACTTCAAATTCTTTAATGCATCA
GTACAATCAAACCTCTTTAATAAGCAAACAAATTCCAAAACGTCATCGGA
TTCCGATTCAAAGAGTGAAGACGACGCCAAAGAGATTCAAGTTCAGAATT
TAATAGACCAAGAAAGTAAATTCAATTTCTCAAATGTCTCAATTTCGTCG
AATCCAACAGAAAAAGGTTTCATTAATAAAGAAAATTTGCAACTAAATTA
CGCTGAAATGGATGAAGATTGCATCAAACGATATTCGAGTTACGAAGATT
GCAAAAACGAGCAGTGCCAAAAGGACCTATTGAGAGACCACTTCCATTGT
ATTCAGTGTAAAAAGACAATTTTACGCCGGGAAGAAATGATTAGACATTC
TAAATGGCACAAGAAGCGGGAAGAAAGTCTTCATTTTAATTTTATGAGAT
TCAGTCCCAACGATGATTGCAATGAATTCATGTGCACCTACAATGGTAGA
CAAACTCATTATCATTGTTTGCATGCAGGTTGTAACAAGATTTATATCAG
CACATCGGATGTCCAGATGCATTCGAATTTCCATAAAAAGGATGCAGCAA
TTAATCAAGAAGGATTTCAGAGATTTAGAGCCACCGAATTTTGCAGTGTT
TCTAGTTGCTCCTATCACAATCAGAGAACCACCCATTTCCATTGTATGAG
ACCCAATTGTAAATTTACCTTCAAAAATAAAGCCGACATGGATAAACACA
AGAGTCACCATCAAAGAAATGATTCACTGGCAAAAGAAGGCTTCAAAAAA
TATATTAAATATGAACACTGCGATTTTAGCGGGTGCAAATTTTCAAAACT
GATGAATCACATACATTGTATAAGATCAAATTGTGATTATGTTGTACATT
CTTCTGCTCAAATAAATTCCCACAGACGGAAACACGAGAGACGTGTTCTA
TCTAACGGCATTATCATCACCCCCCAAGAATTTAAATCAGACTATTCCAT
TTTAAATCTTTCTAAAAATGTCAAATCTCCAAATTCCGACGAAAACTCTA
TAATCACCAGAGAATTCGACAATGAAAATCACTCATCACCCGTTAATGAT
ATTAATACAAATTCAGAGTTTTTATCCTTGATTATGAATGCGATTAACAA
TTGGGAAAACTCCTCAGAGTGGTTGAATGACGTAAGAAAGTTTACGTCGA
ATGATGTTTGCACTAATCATTGCAGTTTGGCATTTAAAGATCATTTTCAT
TGTTTGTTTCTTAACTGTAACGTTTCATATAAGAAAAAAGAAAAAATTCT
CGATCATTGTCGTCGTCATAGATTGGACAAAGCTTTACTAATGAGCTGCT
ATCAAAATTGCACGGACAATTCTCATATAAATACTGATAATCCCATACAA
AACCCTTGTCACTATCATTGTAAATGGAATAACTGCTCATACATTCATGG
AGGTCCGGATTCAAAGTTGGAGTCGGGAATAGATTTTAATTTCCTTCAAG
ATGTATACGATCATTTTGATAGTCATGAACCGAAATTTCATTGTTTTGTT
ACAAACAAATCCACCAATAAAGACACATCGGGATCAAATGAAAGCAACGA
TGAAGCCGATGTCTATCAATTCAATGTTGATTCAGAGAAACCCGATTCGT
ATTATGTCAATGGAGAACGAAAACGAGGACGTCCTCCAAAATATAGGAAA
AATGTCCAAATTCCAAAAATCGAGTTGAACAACGAAGAGATCCTGGATGA
CGAAACGATTTCTGATTTGACAAAAACACATTTTACCGACTCACTTAACG
GCATTAAATGCGGTTTTAAATTTTACTCTAGTAGCAACGTTTTTTGTCTC
GACGATCTGTGCATGTATTTTGGTCGCAGTGCACATTACCATTGTTTGAG
GTTTCGTTGCAATCATGCCACAGATAATCTCACCGCCGTCAATTTGCATC
GCCGTGAATTCCATCACTATATGCAAATTGATGACGGCTACGAATACTTT
GATCGCAGCATCAATTGTCGCCGAAATCAGTGTCAGAATAATCGAGTCAA
CAACCATTACCATTGTGTTCGACACAATTGCGACTACTCCTTCAAAAGAT
TCAACACCATGCATCAACACACGAAAAAGCATTTAGATTTAGAAAAACAA
AAATTAACAGCAACTCAGTCGGTGAACGACGAACAGCCATTCGTGTCCAA
TGCAATATTTTCATCATCTAACACTCTTCCATTATCAACCGGTCAAATGC
CACAAACCGAATACCAAAACCCAGCAAATGGCCTGTTTCCATTCCCGAAT
AATTCGAATGATCAAATCCTTTATCGCAATCCCCAAGAGAACATGTCCTT
ACCAATCATTCCATCGTTAACGAACAATTCCGGTATATCTTTACCACCTA
GCATGAATCTCAATCTTTTGATGAGTTTTAACAATTCCCTTTCTAATTTT
CACAACACCATAAAAGCCTTAATGAGTAATAATAATAACAATAACAACAA
TAATAATATCAACGTTGATACGCACCAGATTCTTCGAGATTCCAAAGAAA
TATCATACCTGATGCCCAATTCCACATCGAACGCTGTCATCAATAATGAT
GACATGATCAATCAGCATTTCAACAAATCCTTGAGGAATAAACTTGACGG
GAAAAAGAACATCAACGCTGAAATTGATAACTCATTCAATTATAAAAACT
ATATATCAGCTCATAATAATTCCGATGATTCATTGACAAAATCTATAAAT
AATATATCAAACAAAAAGATAAATAGATGCAATTATGGTTCGTTTATAGA
TTTCGAACGACCTGATTCTCTGGGAGATAATGGCATTTCTGATAATTCTA
ATCTCAACTTGTCTAATAATTCAATCATAACGAAACCGAACCTGTCAACT
TTTCACAATCAGAATAATAAATTGAGTATTAAAGAAACCGCCGATCAGAT
GGTAGAGAACCTACTGAAACGATCACTAAATAATTGCCCTTCAAATAAGC
AGCATTCGAAAGATGTTCATGTGTCTAATGCAGTTCAATGTAAAGAAATT
CAATCAAAACCTACAAATAACAACAACAACAATAATAATAATAATTCCAC
AATCAATAAGAACGTGAAGAACTCCCCGGTGTATTCAATCCATCAAGCAA
CGAATATCAATAACACGCCGCTCGTGTCTGCCGCTTCACAAAGCTACACA
TCAAAGTCTCATAATTCCTTTATTCCTCAAGAGGAACGAGTAATCCGACT
GCAGGATCACATTAACAAGGCAATCAATATTCTGATAAGCACAACCAATT
ACGATCAGAATATGGCGGAGGCTGCTTTTTCCAGCTTTATGAGATCGGCA
AATCTCGATCTCAACAGTCCTTTAACCAGTTCGGAATTTACCGTTCTAAT
CAATAATATAATGAATCAAAGTCCGAATCCATCACAGCCAACTCCAATAA
TCAATCCACAAAACAACATACCTCAGCCGATTCCATTCCTGCCGGCTAAC
AATGGAATTAACTATCCACTGCCGCCAACCAATCACATAACCGATATGAG
CAACAGTGACAATATCAATCGAATTCTGCCGACACAGACTCCTCTTTCAC
TCCGACATCAGCAAATACTTCTCAATCAAATTCCCGCAACTCCACAGACA
GCTTTGGCTACCCAGCCAGCTCAAACACCGTGGCCTATATTAAACAATGT
TTCACTTTCGAATTTCAATTCAATCTGGGCAGCTCCGGGCTCGAATAACA
CTTTGGGTTCATTGAATTCACCGTATTTTTCCACAATAGGCCACTGCGTT
TCTGCACAGACAGCTTTCAACAGTGCTTTATCCTACAATATTCAACAGTC
ATCACTTTCTAATTCTAATGAATCGTCCTCTGCCTCATTCGGATGTGATA
TCAATACCACACTAACTAGCAATAGTAATAAGAATACAATATCATCGTCG
TCGTCATCTTCACAGAAATTGTTGGATTCTACTGTCAAGGTAGCAGCAGC
GTCAACAAATATCAATGACATTAACGGTCCTATTCCAATGCATGAGAACG
ATTTCGAAAAAAAGGAAATTTAACAACAACAACAATCAATTAATCATCGT
CAGACTCCTCCTGATATATTATTTGCTTGCCATCATGATGTGATGTCTTT
AAATAAAAAATATATTGTATAGTTTGAACAAATAAATCTGTTTATTGCTA
AATGATATTTCAATTCATCGTGGACCGTATAGATTATGCTCGATTATTCT
TTTTCATAAAATCTAATTCTTGTCATCATTGTTTATGGTGAAATATTATT
ATATTATAATATATAACACGTTGGGAAATAATTTGAAATTGACTAAGTTG
TTGATTCAATATCTCTGTGCTTCTTTCTAATTTCAATGTGATAACATGGT
ATTCTGTCTTCAGAAGCCTGAATCTATTTTTTAATATTTTTAATAAAAAT
TATAATTGTATAGTATATTGAAAAAGAAATTTAGGTACAATTAATAATTT
GTTATGTTTACTTATTTTGGTGATAATTTGTTATTATATTGATCTGTTTC
GTTATAATCACTGTTTACATCTTGATTAATAATTTATTTTTTTGATAAAA
TCTGTAATTTAATAGTATAA
back to top

protein sequence of SMED30024786-orf-1

>SMED30024786-orf-1 ID=SMED30024786-orf-1|Name=SMED30024786-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1538bp
MTTTTPSFYEILIYQQNQTNPKKIFQFLFFLLFLFLQLNYRQHKRTTKMF
YSSKFNCFQMAEVEAICAKLQNKPMMTIKSEKETNCVCFPNPTMQIDMNP
TDELNARRRKRKTSVPKSITDKDQIKTDKLVFDKSCGALDLSLNQRNLSE
PIDVNGSQDSDYDAKPGVNINFLQNPLMNIFMKNREHLEHFKFFNASVQS
NLFNKQTNSKTSSDSDSKSEDDAKEIQVQNLIDQESKFNFSNVSISSNPT
EKGFINKENLQLNYAEMDEDCIKRYSSYEDCKNEQCQKDLLRDHFHCIQC
KKTILRREEMIRHSKWHKKREESLHFNFMRFSPNDDCNEFMCTYNGRQTH
YHCLHAGCNKIYISTSDVQMHSNFHKKDAAINQEGFQRFRATEFCSVSSC
SYHNQRTTHFHCMRPNCKFTFKNKADMDKHKSHHQRNDSLAKEGFKKYIK
YEHCDFSGCKFSKLMNHIHCIRSNCDYVVHSSAQINSHRRKHERRVLSNG
IIITPQEFKSDYSILNLSKNVKSPNSDENSIITREFDNENHSSPVNDINT
NSEFLSLIMNAINNWENSSEWLNDVRKFTSNDVCTNHCSLAFKDHFHCLF
LNCNVSYKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPC
HYHCKWNNCSYIHGGPDSKLESGIDFNFLQDVYDHFDSHEPKFHCFVTNK
STNKDTSGSNESNDEADVYQFNVDSEKPDSYYVNGERKRGRPPKYRKNVQ
IPKIELNNEEILDDETISDLTKTHFTDSLNGIKCGFKFYSSSNVFCLDDL
CMYFGRSAHYHCLRFRCNHATDNLTAVNLHRREFHHYMQIDDGYEYFDRS
INCRRNQCQNNRVNNHYHCVRHNCDYSFKRFNTMHQHTKKHLDLEKQKLT
ATQSVNDEQPFVSNAIFSSSNTLPLSTGQMPQTEYQNPANGLFPFPNNSN
DQILYRNPQENMSLPIIPSLTNNSGISLPPSMNLNLLMSFNNSLSNFHNT
IKALMSNNNNNNNNNNINVDTHQILRDSKEISYLMPNSTSNAVINNDDMI
NQHFNKSLRNKLDGKKNINAEIDNSFNYKNYISAHNNSDDSLTKSINNIS
NKKINRCNYGSFIDFERPDSLGDNGISDNSNLNLSNNSIITKPNLSTFHN
QNNKLSIKETADQMVENLLKRSLNNCPSNKQHSKDVHVSNAVQCKEIQSK
PTNNNNNNNNNNSTINKNVKNSPVYSIHQATNINNTPLVSAASQSYTSKS
HNSFIPQEERVIRLQDHINKAINILISTTNYDQNMAEAAFSSFMRSANLD
LNSPLTSSEFTVLINNIMNQSPNPSQPTPIINPQNNIPQPIPFLPANNGI
NYPLPPTNHITDMSNSDNINRILPTQTPLSLRHQQILLNQIPATPQTALA
TQPAQTPWPILNNVSLSNFNSIWAAPGSNNTLGSLNSPYFSTIGHCVSAQ
TAFNSALSYNIQQSSLSNSNESSSASFGCDINTTLTSNSNKNTISSSSSS
SQKLLDSTVKVAAASTNINDINGPIPMHENDFEKKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR040373CASZ1
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 596..620
e-value: 8.7
score: 13.8
coord: 867..891
e-value: 9.3
score: 13.5
coord: 810..835
e-value: 49.0
score: 7.2
coord: 410..434
e-value: 1.5
score: 17.8
coord: 351..375
e-value: 5.5
score: 15.6
coord: 295..317
e-value: 22.0
score: 10.3
coord: 468..492
e-value: 7.0
score: 14.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 869..891
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 353..375
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 598..620
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 412..434
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 297..317
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 867..896
score: 8.891
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 295..322
score: 9.182
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 205..224
NoneNo IPR availableTMHMMTMhelixcoord: 24..41
IPR040373Transcription factor castorPANTHERPTHR12451TRANSCRIPTION FACTOR CASTOR PROTEIN MING -RELATEDcoord: 210..535
coord: 857..898