SMB domain-containing protein

Overview
NameSMB domain-containing protein
Smed IDSMED30024778
Length (bp)1014
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMB domain-containing protein (SMED30024778) t-SNE clustered cells

Violin plots show distribution of expression levels for SMB domain-containing protein (SMED30024778) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMB domain-containing protein (SMED30024778) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMB domain-containing protein (SMED30024778) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024778

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024778SMESG000022577.1 Contig50773newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024778SMESG000022577.1 Contig50773uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30024778SMESG000022577.1 Contig50773newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024778SMESG000022577.1 Contig50773uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30024778SMESG000022577.1 Contig50773newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30024778SMESG000022577.1 Contig50773uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024778SMESG000022577.1 Contig50773newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024778SMESG000022577.1 Contig50773uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024778SMESG000022577.1 Contig34942newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30024778SMESG000022577.1 Contig34942uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024778SMESG000022577.1 dd_Smed_v4_5786_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMB domain-containing protein vs. Ensembl Human
Match: SBSPON (somatomedin B and thrombospondin type 1 domain containing [Source:HGNC Symbol;Acc:HGNC:30362])

HSP 1 Score: 72.4034 bits (176), Expect = 5.403e-14
Identity = 68/275 (24.73%), Postives = 106/275 (38.55%), Query Frame = 2
Query:  134 NRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLY---KPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
             RCC G++ +C +     ++    C+CD  C  + DCC D+ + C       C +  W+PW+ C   C    + R R +   P+N G  C  L +   C                     + ++   Q    + + A I     +K   RQ     S H    TE  D  YC  +K       C     L+      W Q   +L++   +C  C        +S +C G GL     +   W+AI +  C G +K + +   CSCP  +SFI I
Sbjct:   26 GRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARP---CFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCL--------------------EYSTPQGQDCGHTYVPAFITTSAFNKERTRQA---TSPHWSTHTE--DAGYCMEFKTESLTPHC----ALENWPLTRWMQ---YLREGYTVCVDC-QPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI 264          
BLAST of SMB domain-containing protein vs. Ensembl Human
Match: THSD7A (thrombospondin type 1 domain containing 7A [Source:HGNC Symbol;Acc:HGNC:22207])

HSP 1 Score: 53.9138 bits (128), Expect = 2.986e-7
Identity = 19/69 (27.54%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKF 451
             +Q C    + +C++S ++ W++C++ CG G Q R+R ++ PP+  G  C +L + + C +  C  ++ 
Sbjct:  183 LEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEEL 251          

HSP 2 Score: 49.6766 bits (117), Expect = 6.070e-6
Identity = 31/95 (32.63%), Postives = 43/95 (45.26%), Query Frame = 2
Query:  164 CVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCG-QGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQ 445
            CV  D       YC+A               C     VNC LS+W+PW++C++ CG  G   R R +  P + +GR C SL D     +  CPV+
Sbjct: 1251 CVRSDGKSVDLKYCEALGLEKN---WQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGRPCPSLMD----QSKPCPVK 1338          
BLAST of SMB domain-containing protein vs. Ensembl Human
Match: THSD7A (thrombospondin type 1 domain containing 7A [Source:HGNC Symbol;Acc:HGNC:22207])

HSP 1 Score: 53.9138 bits (128), Expect = 3.013e-7
Identity = 19/69 (27.54%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKF 451
             +Q C    + +C++S ++ W++C++ CG G Q R+R ++ PP+  G  C +L + + C +  C  ++ 
Sbjct:  183 LEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEEL 251          

HSP 2 Score: 49.6766 bits (117), Expect = 6.017e-6
Identity = 31/95 (32.63%), Postives = 43/95 (45.26%), Query Frame = 2
Query:  164 CVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCG-QGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQ 445
            CV  D       YC+A               C     VNC LS+W+PW++C++ CG  G   R R +  P + +GR C SL D     +  CPV+
Sbjct: 1251 CVRSDGKSVDLKYCEALGLEKN---WQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGRPCPSLMD----QSKPCPVK 1338          
BLAST of SMB domain-containing protein vs. Ensembl Human
Match: THSD7B (thrombospondin type 1 domain containing 7B [Source:HGNC Symbol;Acc:HGNC:29348])

HSP 1 Score: 51.6026 bits (122), Expect = 1.747e-6
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  275 VNCVLSNWTPWTKCTRNCGQGFQF-RSRKIIFPPKNNGRKCDS-LRDVKTCHNVLCPVQKFGN 457
            VNC LS WT WT+C++ CG G +  R+R II P +  GR C + L   KTC    C     GN
Sbjct: 1217 VNCQLSGWTAWTECSQTCGHGGRMSRTRFIIMPTQGEGRPCPTELTQEKTCPVTPCYSWVLGN 1279          

HSP 2 Score: 50.8322 bits (120), Expect = 3.014e-6
Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 2
Query:  248 KQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVL-CPV 442
            +Q C      +CV+S + PW+ C++ CG+  Q R+R +I PP   G +C +L + + C   + CP+
Sbjct:  138 EQACLIPCPRDCVVSEFLPWSNCSKGCGKKLQHRTRAVIAPPLFGGLQCPNLTESRACDAPISCPL 203          
BLAST of SMB domain-containing protein vs. Ensembl Human
Match: THSD7B (thrombospondin type 1 domain containing 7B [Source:HGNC Symbol;Acc:HGNC:29348])

HSP 1 Score: 51.2174 bits (121), Expect = 1.929e-6
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  275 VNCVLSNWTPWTKCTRNCGQGFQF-RSRKIIFPPKNNGRKCDS-LRDVKTCHNVLCPVQKFGN 457
            VNC LS WT WT+C++ CG G +  R+R II P +  GR C + L   KTC    C     GN
Sbjct: 1248 VNCQLSGWTAWTECSQTCGHGGRMSRTRFIIMPTQGEGRPCPTELTQEKTCPVTPCYSWVLGN 1310          

HSP 2 Score: 50.447 bits (119), Expect = 3.477e-6
Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 2
Query:  248 KQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVL-CPV 442
            +Q C      +CV+S + PW+ C++ CG+  Q R+R +I PP   G +C +L + + C   + CP+
Sbjct:  169 EQACLIPCPRDCVVSEFLPWSNCSKGCGKKLQHRTRAVIAPPLFGGLQCPNLTESRACDAPISCPL 234          
BLAST of SMB domain-containing protein vs. Ensembl Celegans
Match: R17.3 (pep chromosome:WBcel235:III:10837445:10839451:1 gene:WBGene00011269.1 transcript:R17.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R17.3)

HSP 1 Score: 71.2478 bits (173), Expect = 4.790e-14
Identity = 61/243 (25.10%), Postives = 104/243 (42.80%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRN---CGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSC 913
            +CYCD  C    DCC D+   C      +CVL++W  WT+CT +   CG G Q R R +I   +  G  C+ L++++TC         F   + K +    +T +VA +L         Y+H   +  IR++     L  +    +  T YC  Y I +   +C +    + +++         L +   +C  C  E  Y   + +C           W+ I   +C+G +  I++ +NC C
Sbjct:   32 ECYCDEHCVTLGDCCSDYTFVCPPR---DCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTC---------FVECRPKKSALDDIT-TVALILD--------YRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNCVS----RLLNKG--------LSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTENCQC 241          
BLAST of SMB domain-containing protein vs. Ensembl Celegans
Match: R17.3 (pep chromosome:WBcel235:III:10832936:10839451:1 gene:WBGene00011269.1 transcript:R17.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R17.3)

HSP 1 Score: 69.3218 bits (168), Expect = 7.408e-13
Identity = 61/243 (25.10%), Postives = 104/243 (42.80%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRN---CGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSC 913
            +CYCD  C    DCC D+   C      +CVL++W  WT+CT +   CG G Q R R +I   +  G  C+ L++++TC         F   + K +    +T +VA +L         Y+H   +  IR++     L  +    +  T YC  Y I +   +C +    + +++         L +   +C  C  E  Y   + +C           W+ I   +C+G +  I++ +NC C
Sbjct:  207 ECYCDEHCVTLGDCCSDYTFVCPPR---DCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTC---------FVECRPKKSALDDIT-TVALILD--------YRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNCVS----RLLNKG--------LSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTENCQC 416          
BLAST of SMB domain-containing protein vs. Ensembl Celegans
Match: R17.3 (pep chromosome:WBcel235:III:10835014:10839451:1 gene:WBGene00011269.1 transcript:R17.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R17.3)

HSP 1 Score: 69.3218 bits (168), Expect = 7.408e-13
Identity = 61/243 (25.10%), Postives = 104/243 (42.80%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRN---CGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSC 913
            +CYCD  C    DCC D+   C      +CVL++W  WT+CT +   CG G Q R R +I   +  G  C+ L++++TC         F   + K +    +T +VA +L         Y+H   +  IR++     L  +    +  T YC  Y I +   +C +    + +++         L +   +C  C  E  Y   + +C           W+ I   +C+G +  I++ +NC C
Sbjct:  207 ECYCDEHCVTLGDCCSDYTFVCPPR---DCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTC---------FVECRPKKSALDDIT-TVALILD--------YRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNCVS----RLLNKG--------LSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTENCQC 416          
BLAST of SMB domain-containing protein vs. Ensembl Celegans
Match: R17.3 (pep chromosome:WBcel235:III:10832936:10839451:1 gene:WBGene00011269.1 transcript:R17.3a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R17.3)

HSP 1 Score: 69.3218 bits (168), Expect = 8.263e-13
Identity = 61/243 (25.10%), Postives = 104/243 (42.80%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRN---CGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSC 913
            +CYCD  C    DCC D+   C      +CVL++W  WT+CT +   CG G Q R R +I   +  G  C+ L++++TC         F   + K +    +T +VA +L         Y+H   +  IR++     L  +    +  T YC  Y I +   +C +    + +++         L +   +C  C  E  Y   + +C           W+ I   +C+G +  I++ +NC C
Sbjct:  218 ECYCDEHCVTLGDCCSDYTFVCPPR---DCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTC---------FVECRPKKSALDDIT-TVALILD--------YRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNCVS----RLLNKG--------LSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTENCQC 427          
BLAST of SMB domain-containing protein vs. Ensembl Celegans
Match: R17.3 (pep chromosome:WBcel235:III:10835014:10839451:1 gene:WBGene00011269.1 transcript:R17.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R17.3)

HSP 1 Score: 69.3218 bits (168), Expect = 8.263e-13
Identity = 61/243 (25.10%), Postives = 104/243 (42.80%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRN---CGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSC 913
            +CYCD  C    DCC D+   C      +CVL++W  WT+CT +   CG G Q R R +I   +  G  C+ L++++TC         F   + K +    +T +VA +L         Y+H   +  IR++     L  +    +  T YC  Y I +   +C +    + +++         L +   +C  C  E  Y   + +C           W+ I   +C+G +  I++ +NC C
Sbjct:  218 ECYCDEHCVTLGDCCSDYTFVCPPR---DCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAACEPLKEMRTC---------FVECRPKKSALDDIT-TVALILD--------YRHNKTRSKIRRNNIYWDLPNVAEKMKKATYYCVHYTIDWVNRNCVS----RLLNKG--------LSEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTENCQC 427          
BLAST of SMB domain-containing protein vs. Ensembl Fly
Match: CG42339 (gene:FBgn0259241 transcript:FBtr0299862)

HSP 1 Score: 87.4261 bits (215), Expect = 6.880e-19
Identity = 55/193 (28.50%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  140 CCKGQNSSCVSH--------DSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHL---YRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNF 685
            CC G++SSCV          + + +K CYCD  C +  DCC DFK  C     ++C + +W  W++C R+CG G   R+R+I+   +N G+ C +L+  ++C    C     G+  +K+ +       +A LLP +        H N   D+R +L   YR++          D  YC  +++I +  +C+  
Sbjct:   32 CCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLGDCCDDFKDHCGV---LDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC----HGHHDKKILR------EMALLLPAALTH---NHHVNESGDLRHNLRTRYRDTYKH-----NHDQEYCVEFEVIKSSKACNKL 203          
BLAST of SMB domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-178e17.3 (si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-335])

HSP 1 Score: 95.9005 bits (237), Expect = 8.971e-23
Identity = 74/277 (26.71%), Postives = 115/277 (41.52%), Query Frame = 2
Query:  119 NLSCQNR----CCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
               C NR    CC G+N+ C S  S     CYCD +C RS DCC D+     T    +C ++ W  W+ C+  CG G   RSR++  PP+N G  C  L+  + C                 T        VA++LPDS       +++   +  R H+         + ++    YC   ++     +C    K++      WS   +    +R +C  C S+    +  N+C+G GL    T W A ++  C G +      +NC CP  S I +
Sbjct:   11 EAGCANRIDPTCCPGRNNDC-SDRSFRRTVCYCDTYCRRSGDCCEDYN----TVSAKDCEVTLWGAWSPCSSVCGAGTTERSRQVATPPRNGGTPCPDLKQRRGCF--------------APTDTCSAAKEVAKILPDS-----FKRNFKDPWR-RPHM---------LMKEEKKSYCVQMRVKQASAAC----KVRP-----WSAGLIH---ERSVCVECQSDAMATD--NRCRGDGLQNIRTFWAAAQAPGCSGSWVRESLTENCRCPSYSVIFV 239          
BLAST of SMB domain-containing protein vs. Ensembl Zebrafish
Match: SBSPON (somatomedin B and thrombospondin type 1 domain containing [Source:NCBI gene;Acc:100151218])

HSP 1 Score: 83.5741 bits (205), Expect = 3.594e-18
Identity = 66/278 (23.74%), Postives = 114/278 (41.01%), Query Frame = 2
Query:  125 SCQNRCCKGQNSSCVSHDSVGN---KKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYK---PTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
             C  RCC+G + +C + D   +     CYCD  C ++KDCC D+   C       CV+S W+ W+ C + C   F+ R R +   P+NNG  C SL +   C        ++ + + +    ++  + +  +    G   ++Y                           D  +C  +K+      C    +      A W Q   +L++   +C  C     +   S  CQG G L +      W+A+ +  C G ++ + + ++CSCP  +SFI I
Sbjct:   27 GCSGRCCQGSDFTCFTTDWRMDHVYGTCYCDEKCLKTKDCCFDYPAECPAQP---CVVSEWSNWSGCAQPCQPSFRVRRRNVERLPQNNGEACLSLEEQAGC-------MEYQDHQGQFCSQTQGAAFITTMEYSKGRTHELYG-----------------------APVDAGFCMEFKMESLTAQCMGENR----PYARWMQ---YLREGYTVCVACQPPANH---SWGCQGDGNLAERNDLLHWQAVGNPPCRGTWRKVQRLQHCSCPQVHSFIFI 261          
BLAST of SMB domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-7k24.5 (si:dkey-7k24.5 [Source:ZFIN;Acc:ZDB-GENE-131127-626])

HSP 1 Score: 75.8702 bits (185), Expect = 2.793e-15
Identity = 71/296 (23.99%), Postives = 123/296 (41.55%), Query Frame = 2
Query:   80 INIITALLQISAENLSCQNRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKII-FTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTG--LLYKPT---RWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            + ++  L+  S         CC GQN SC+S D   ++   +CYCD  C  + DCCHD+   C     V+CV+S W+ W+ C   C    + R R++I   +N G  C SL+    C                   H +    +  L+P + I    Y +   K ++  ++               T YC  +++   T G   +F    +  R        +L++  ++C  C            C G G  + Y  +   +W+A+ +  C G ++ + +R++CSCP  +SF+ I
Sbjct:   29 LALLVTLVSQSEGGCQDTGMCCIGQNQSCISEDWRKDRSFGECYCDQACKTTLDCCHDYDLAC---PAVSCVVSEWSLWSGCLEPCKPTLRSRRRQVIQEARNGGEPCPSLQQTAGCAEY----------------HDQHGPCLQSLVP-ALITTGGYGNARKKREVLDNI---------------TGYCVEFELTSLTAGCQRSFSSHTRWMR--------YLKEGHQVCVEC-QPPALTPGQRYCSGDGENMGYDRSVSLQWQAVGNSQCRGVWRRVRRRESCSCPTVHSFLFI 280          
BLAST of SMB domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-7k24.5 (si:dkey-7k24.5 [Source:ZFIN;Acc:ZDB-GENE-131127-626])

HSP 1 Score: 75.8702 bits (185), Expect = 2.793e-15
Identity = 71/296 (23.99%), Postives = 123/296 (41.55%), Query Frame = 2
Query:   80 INIITALLQISAENLSCQNRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKII-FTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTG--LLYKPT---RWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            + ++  L+  S         CC GQN SC+S D   ++   +CYCD  C  + DCCHD+   C     V+CV+S W+ W+ C   C    + R R++I   +N G  C SL+    C                   H +    +  L+P + I    Y +   K ++  ++               T YC  +++   T G   +F    +  R        +L++  ++C  C            C G G  + Y  +   +W+A+ +  C G ++ + +R++CSCP  +SF+ I
Sbjct:   29 LALLVTLVSQSEGGCQDTGMCCIGQNQSCISEDWRKDRSFGECYCDQACKTTLDCCHDYDLAC---PAVSCVVSEWSLWSGCLEPCKPTLRSRRRQVIQEARNGGEPCPSLQQTAGCAEY----------------HDQHGPCLQSLVP-ALITTGGYGNARKKREVLDNI---------------TGYCVEFELTSLTAGCQRSFSSHTRWMR--------YLKEGHQVCVEC-QPPALTPGQRYCSGDGENMGYDRSVSLQWQAVGNSQCRGVWRRVRRRESCSCPTVHSFLFI 280          
BLAST of SMB domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-178e17.3 (si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-335])

HSP 1 Score: 67.781 bits (164), Expect = 4.762e-13
Identity = 52/220 (23.64%), Postives = 89/220 (40.45%), Query Frame = 2
Query:  278 NCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
            +C ++ W  W+ C+  CG G   RSR++  PP+N G  C  L+  + C                 T        VA++LPDS       +++   +  R H+         + ++    YC   ++     +C    K++      WS   +    +R +C  C S+    +  N+C+G GL    T W A ++  C G +      +NC CP  S I +
Sbjct:    9 DCEVTLWGAWSPCSSVCGAGTTERSRQVATPPRNGGTPCPDLKQRRGCF--------------APTDTCSAAKEVAKILPDS-----FKRNFKDPWR-RPHM---------LMKEEKKSYCVQMRVKQASAAC----KVRP-----WSAGLIH---ERSVCVECQSDAMATD--NRCRGDGLQNIRTFWAAAQAPGCSGSWVRESLTENCRCPSYSVIFV 185          
BLAST of SMB domain-containing protein vs. Ensembl Xenopus
Match: fam107a (family with sequence similarity 107 member A [Source:Xenbase;Acc:XB-GENE-986180])

HSP 1 Score: 106.686 bits (265), Expect = 1.886e-26
Identity = 75/283 (26.50%), Postives = 121/283 (42.76%), Query Frame = 2
Query:  101 LQISAENLSCQNR----CCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
            L I     +C  R    CC G+N++C +    G   CYCD++C RS DCC D++  C  S   +CV+  W  W++C+  CG G + R+R+++ PP + G  C  LR    C+                     M++ VA++LPDS            K D R    R     L   ++    YC ++++      C             WS+  +   +++ +C  C  E      + +CQG GL    T W A    +C G +     R++C+C   SF+ +
Sbjct:   18 LHIPGGRSACARRAHPKCCPGRNNACTAPSRTG-PTCYCDSYCTRSGDCCQDYRSQCGGSVS-HCVVGPWGSWSECSSRCGIGSRERTRQVVVPPSSGGSPCPDLRQRCGCYGG--------------DPDCHMSTDVAKILPDS-----------FKRDFRDPWRR----YLTTVQERAPSYCVYFRLKHVGLGC---------QLQGWSRQLI---REQLVCVECQKEAAGS--NGRCQGDGLAGVRTFWAAASLSSCQGSWVQEDLREHCTCKLVSFLFV 255          
BLAST of SMB domain-containing protein vs. Ensembl Xenopus
Match: SBSPON (somatomedin B and thrombospondin type 1 domain containing [Source:NCBI gene;Acc:100489582])

HSP 1 Score: 77.411 bits (189), Expect = 8.735e-16
Identity = 68/290 (23.45%), Postives = 125/290 (43.10%), Query Frame = 2
Query:   95 ALLQISAENLSCQN-RCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQG-----TGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCP-PNSFIM 934
            A+L  SAE    +  +CC+G++ +C S     ++    C+CD  C  + DCC D+ Q C       C++  W+ W+ C   C    + R R+++  P+N G  C +L +   C      ++ F ++  +  Q S +T+ +                    ++  +   R +L     TE+ D  YC  +++      C     ++    A W Q   +L++   +C  C         +++C G      GLL+    W A+ +  C G +K + + ++CSCP  +SFI 
Sbjct:   19 AVLIRSAEGGCMEAAKCCRGRDMNCTSQGWRLDRLYGTCFCDQACGLTGDCCFDYSQACPARA---CIVGEWSHWSGCADPCTPALRVRRRQVVQEPENGGNPCPALEEKAGC------LEYFTSQGTECAQ-SHVTAFIT------------------TFEYNKSRRRRALSPNWATEKEDAGYCVEFQVKSLSQDC----LIESRPHARWMQ---YLREGYTVCVAC-QHPAMNMRNHRCYGDGRNANGLLH----WEAVGNPQCQGTWKKLKEVESCSCPLVHSFIF 268          
BLAST of SMB domain-containing protein vs. Ensembl Xenopus
Match: fam107a (family with sequence similarity 107 member A [Source:Xenbase;Acc:XB-GENE-986180])

HSP 1 Score: 72.0182 bits (175), Expect = 3.367e-14
Identity = 60/249 (24.10%), Postives = 99/249 (39.76%), Query Frame = 2
Query:  209 AFCYRSKDCCHDFKQFCRTSQKVN------CVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
             FC  + D   D      TS +V       CV+  W  W++C+  CG G + R+R+++ PP + G  C  LR    C+         G+          M++ VA++LPDS            K D R    R     L   ++    YC ++++      C             WS+  +   +++ +C  C  E      + +CQG GL    T W A    +C G +     R++C+C   SF+ +
Sbjct:    6 VFCVSNTD--MDLTPGPSTSPQVTLCLFSHCVVGPWGSWSECSSRCGIGSRERTRQVVVPPSSGGSPCPDLRQRCGCYG--------GD------PDCHMSTDVAKILPDS-----------FKRDFRDPWRRY----LTTVQERAPSYCVYFRLKHVGLGC---------QLQGWSRQLI---REQLVCVECQKEAAGS--NGRCQGDGLAGVRTFWAAASLSSCQGSWVQEDLREHCTCKLVSFLFV 209          
BLAST of SMB domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 50.447 bits (119), Expect = 4.178e-6
Identity = 23/54 (42.59%), Postives = 27/54 (50.00%), Query Frame = 2
Query:  287 LSNWTPWTKCTRNCGQGFQFRSRKIIFP-PKNNGRKCDSLR-DVKTCHNVLCPV 442
             S W PW  C+  CGQG Q R R    P P N G  C     + ++C N LCPV
Sbjct: 4453 FSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPV 4506          
BLAST of SMB domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 50.0618 bits (118), Expect = 4.641e-6
Identity = 23/54 (42.59%), Postives = 27/54 (50.00%), Query Frame = 2
Query:  287 LSNWTPWTKCTRNCGQGFQFRSRKIIFP-PKNNGRKCDSLR-DVKTCHNVLCPV 442
             S W PW  C+  CGQG Q R R    P P N G  C     + ++C N LCPV
Sbjct: 4413 FSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPV 4466          
BLAST of SMB domain-containing protein vs. Ensembl Mouse
Match: Sbspon (somatomedin B and thrombospondin, type 1 domain containing [Source:MGI Symbol;Acc:MGI:2684952])

HSP 1 Score: 68.1662 bits (165), Expect = 1.219e-12
Identity = 65/294 (22.11%), Postives = 121/294 (41.16%), Query Frame = 2
Query:   86 IITALLQISAENLSC---QNRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLY---KPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            ++ AL ++    L+      RCC G++ +C +     ++    C+CD  C  + DCC D+ + C       C +  W+PW+ C   C    + R R +   P N G  C  L +   C        ++ + + +   HS + + +   + +   K  I +  + ++       +++ + +    +S TP+CA      T                 W Q   +L++   +C  C        +S +C G GL     +  RW+AI +  C G +K + + + CSCP  + FI I
Sbjct:    7 VLCALARLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTGDCCFDYDRACPARP---CFVGEWSPWSGCAGQCQPTTRVRRRSVRQEPLNGGAPCPPLEERAGCL-------EYSSSQSQDCGHSFVPAFITSSVFN---KKRIIQAVSPQWSTHT---KDAGYCMEFKTESLTPHCALVNSPLT----------------RWMQ---YLREGYTVCVDC-QPPAMNSVSLRCSGDGLDSDGNQTLRWQAIGNPRCQGTWKKVRRVEQCSCPDVHRFIFI 264          
BLAST of SMB domain-containing protein vs. Ensembl Mouse
Match: Thsd7a (thrombospondin, type I, domain containing 7A [Source:MGI Symbol;Acc:MGI:2685683])

HSP 1 Score: 56.9954 bits (136), Expect = 2.182e-8
Identity = 21/64 (32.81%), Postives = 39/64 (60.94%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLC 436
             +Q C    + +C++S ++PW++C+R CG G Q R+R ++ PP+  G  C +L + + C +  C
Sbjct:  172 LEQACLIPCQKDCIVSEFSPWSECSRTCGSGLQHRTRHVVAPPQYGGSGCPNLTEFQVCQSNPC 235          
BLAST of SMB domain-containing protein vs. Ensembl Mouse
Match: Thsd7a (thrombospondin, type I, domain containing 7A [Source:MGI Symbol;Acc:MGI:2685683])

HSP 1 Score: 56.9954 bits (136), Expect = 2.202e-8
Identity = 21/64 (32.81%), Postives = 39/64 (60.94%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLC 436
             +Q C    + +C++S ++PW++C+R CG G Q R+R ++ PP+  G  C +L + + C +  C
Sbjct:  172 LEQACLIPCQKDCIVSEFSPWSECSRTCGSGLQHRTRHVVAPPQYGGSGCPNLTEFQVCQSNPC 235          
BLAST of SMB domain-containing protein vs. Ensembl Mouse
Match: Thsd7b (thrombospondin, type I, domain containing 7B [Source:MGI Symbol;Acc:MGI:2443925])

HSP 1 Score: 51.6026 bits (122), Expect = 1.072e-6
Identity = 28/63 (44.44%), Postives = 36/63 (57.14%), Query Frame = 2
Query:  275 VNCVLSNWTPWTKCTRNCGQGFQF-RSRKIIFPPKNNGRKCDS-LRDVKTCHNVLCPVQKFGN 457
            VNC LS WT WT+C++ CGQG +  R+R II P +  GR+C + L   K C    C     GN
Sbjct: 1247 VNCQLSGWTTWTECSQTCGQGGRMSRTRFIIMPTQGEGRQCPTELTQQKPCPVTPCYSWVLGN 1309          

HSP 2 Score: 50.447 bits (119), Expect = 2.584e-6
Identity = 24/68 (35.29%), Postives = 37/68 (54.41%), Query Frame = 2
Query:  248 KQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCH-NVLCPVQK 448
            +Q C      +CV+S ++PW+ C   CG+  Q R+R  I PP   G +C +L + + C   V CP+ K
Sbjct:  169 EQACLIPCPRDCVVSEFSPWSTCPEGCGKKLQHRTRVAIAPPLYGGLQCPNLTESRACEAPVSCPLGK 236          
BLAST of SMB domain-containing protein vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 51.6026 bits (122), Expect = 1.143e-6
Identity = 24/54 (44.44%), Postives = 29/54 (53.70%), Query Frame = 2
Query:  287 LSNWTPWTKCTRNCGQGFQFRSRKIIF-PPKNNGRKCDSL-RDVKTCHNVLCPV 442
             S W+ W  C+  CG+G Q RSR     PP N GR C     + + CHN LCPV
Sbjct: 4531 FSLWSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPV 4584          
BLAST of SMB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q32L50|SBSPO_BOVIN (Somatomedin-B and thrombospondin type-1 domain-containing protein OS=Bos taurus OX=9913 GN=SBSPON PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 3.919e-15
Identity = 71/294 (24.15%), Postives = 113/294 (38.44%), Query Frame = 2
Query:   86 IITALLQISAENLSCQNRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSG---IKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLY---KPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            ++  L   +    +   RCC G++ +C +     ++    C+CD  C  + DCC D+ + C       C++  W+PW+ C   C    + R R +   P+N G  C +L +   C     P  +                       D G   + A I     +K   RQ     S H    TE  D  YC  +K       C     L+      W Q   +L++   +C  C        +S +C G GL     +   W+AI +  C G +K + + + CSCP  +SFI I
Sbjct:   10 VLARLWPGALAGCADAGRCCPGRDPACFASGWRQDRVYGTCFCDQACRLTGDCCFDYARACPARP---CIVGEWSPWSGCASQCRPTARVRRRAVQQEPQNGGEPCPALEERAGCLEYATPQGE-----------------------DCGHAFVPAFITTSAFNKERTRQAA---SPHWTTSTE--DAGYCMEFKTESLTHHC----ALENRPLTRWMQ---YLREGYTVCVDC-QPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVEQCSCPAVHSFIFI 264          
BLAST of SMB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IVN8|SBSPO_HUMAN (Somatomedin-B and thrombospondin type-1 domain-containing protein OS=Homo sapiens OX=9606 GN=SBSPON PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.594e-13
Identity = 68/275 (24.73%), Postives = 106/275 (38.55%), Query Frame = 2
Query:  134 NRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLY---KPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
             RCC G++ +C +     ++    C+CD  C  + DCC D+ + C       C +  W+PW+ C   C    + R R +   P+N G  C  L +   C                     + ++   Q    + + A I     +K   RQ     S H    TE  D  YC  +K       C     L+      W Q   +L++   +C  C        +S +C G GL     +   W+AI +  C G +K + +   CSCP  +SFI I
Sbjct:   26 GRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARP---CFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCL--------------------EYSTPQGQDCGHTYVPAFITTSAFNKERTRQA---TSPHWSTHTE--DAGYCMEFKTESLTPHC----ALENWPLTRWMQ---YLREGYTVCVDC-QPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI 264          
BLAST of SMB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3UPR9|SBSPO_MOUSE (Somatomedin-B and thrombospondin type-1 domain-containing protein OS=Mus musculus OX=10090 GN=Sbspon PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.527e-12
Identity = 65/294 (22.11%), Postives = 121/294 (41.16%), Query Frame = 2
Query:   86 IITALLQISAENLSC---QNRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLY---KPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            ++ AL ++    L+      RCC G++ +C +     ++    C+CD  C  + DCC D+ + C       C +  W+PW+ C   C    + R R +   P N G  C  L +   C        ++ + + +   HS + + +   + +   K  I +  + ++       +++ + +    +S TP+CA      T                 W Q   +L++   +C  C        +S +C G GL     +  RW+AI +  C G +K + + + CSCP  + FI I
Sbjct:    7 VLCALARLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTGDCCFDYDRACPARP---CFVGEWSPWSGCAGQCQPTTRVRRRSVRQEPLNGGAPCPPLEERAGCL-------EYSSSQSQDCGHSFVPAFITSSVFN---KKRIIQAVSPQWSTHT---KDAGYCMEFKTESLTPHCALVNSPLT----------------RWMQ---YLREGYTVCVDC-QPPAMNSVSLRCSGDGLDSDGNQTLRWQAIGNPRCQGTWKKVRRVEQCSCPDVHRFIFI 264          
BLAST of SMB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q69ZU6|THS7A_MOUSE (Thrombospondin type-1 domain-containing protein 7A OS=Mus musculus OX=10090 GN=Thsd7a PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 1.526e-7
Identity = 21/64 (32.81%), Postives = 39/64 (60.94%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLC 436
             +Q C    + +C++S ++PW++C+R CG G Q R+R ++ PP+  G  C +L + + C +  C
Sbjct:  172 LEQACLIPCQKDCIVSEFSPWSECSRTCGSGLQHRTRHVVAPPQYGGSGCPNLTEFQVCQSNPC 235          
BLAST of SMB domain-containing protein vs. UniProt/SwissProt
Match: sp|A7MBS7|THS7A_DANRE (Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 5.154e-7
Identity = 27/87 (31.03%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  176 DSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLC 436
            D V  +   C+ F  + +      +Q C      +CV+S ++PWT C+++CG G Q R R ++ PP   G  C +L + +TC    C
Sbjct:  154 DGVPAEDAICEYFEPKPR-----LEQACLIPCPRDCVVSEFSPWTSCSKSCGMGLQNRLRSVLAPPLFGGSACPNLTEFRTCQPGKC 235          
BLAST of SMB domain-containing protein vs. TrEMBL
Match: A0A0R3SFP9 (SMB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3680 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.223e-43
Identity = 92/272 (33.82%), Postives = 144/272 (52.94%), Query Frame = 2
Query:  182 VGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDT-PYCAFYKIIFTFGSCDNFQKLKK-------------IDRANWSQHFL----FLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIH-KRKNCSC--PPNSFIM 934
            +   KC+CD +C R+ DCC D+++ C +  K+NC +S W+ W+ C+R CG+G Q R+R I+   +N G +C  L + + C   LC  ++ G       ++ +++S VA LLP  G   +  K ++ ++DIR+ LY   L Q N T+  D  PYC  Y+II +  +C       K              DR   + H L     L+  ++IC TCY +    EL N C GTG     +RWRA+ + +C G F++I   ++ C+C   PNSFI+
Sbjct:   75 IQKAKCFCDEYCVRTNDCCSDYREVC-SKPKINCEVSAWSLWSSCSRVCGRGNQTRTRNIVRESENGGDQCPILMESRPCTGYLCNRRRVGRSDYNAYRNMELSSEVANLLPVDGDVEEKIKQFDMRWDIRRKLYYGRLIQQNKTDIPDPEPYCVHYEIIKSNEACKAISAPPKHQQSGFWSRPGSFFDRNYDTNHPLLSTVLLRPGQQICATCYPKYMRPELGNHCPGTGYPGMTSRWRALNTFDCQGIFRMISVPQRACTCRRQPNSFIL 345          
BLAST of SMB domain-containing protein vs. TrEMBL
Match: W6V4P8 (RPE-spondin OS=Echinococcus granulosus OX=6210 GN=EGR_04012 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 9.721e-41
Identity = 88/270 (32.59%), Postives = 139/270 (51.48%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDT-PYCAFYKIIFTFGSC-------------------DNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLI---HKRKNCSCPPNSFIM 934
            +C+CD +C R+ DCC D++  C    K+NC +S W+ W+ C R CG+G Q R+R I     N G +C  L + +TC    C  ++ G  +    +H ++ S VA LLP  G   +  K ++ ++DIR+ LY   L Q N T+  D  PY A+Y+II +  +C                    +F+++  +D   W    L L+  ++IC TCY +    EL N+C GTG     +RWRA+ + +C G F++I    +   C   P +FI+
Sbjct:   83 RCFCDEYCLRTNDCCWDYRDVC-AKPKINCGVSAWSRWSPCNRLCGKGNQTRTRSITREAANGGDQCPLLMESRTCSGFTCNRRRVGRSEYNSYRHMELPSEVANLLPVDGDIEETIKQFDMRWDIRRKLYYGRLIQQNKTDIPDPEPYSAYYEIIKSNDACKAGGAPPRRQEGRSQNPWGSSFERIYDLDHP-WLSTAL-LRPGQQICATCYPKYMRPELGNRCPGTGYPGLTSRWRALNTFDCQGTFRMISVPQRASTCRQQPTAFIL 349          
BLAST of SMB domain-containing protein vs. TrEMBL
Match: A0A0X3P2U1 (Somatomedin-B and thrombospondin type-1 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SBSPO PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 4.073e-40
Identity = 104/341 (30.50%), Postives = 155/341 (45.45%), Query Frame = 2
Query:  110 SAENLSCQNRCCKGQNSSCVSHD----------------SVG-NKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTC---HNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDT-PYCAFYKIIFTFGSC-------------------------------DNFQKLKKIDRAN-----------WSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKN---CSCPPNSFIM 934
            S  N     +CC G+ + C                    +VG N++CYCD  C  ++DCC D++Q C    K++C +S W+ W+ C+ +CG G Q RSR II  P+N G +C  L + + C   H  +C   + G+R R+L      ++ VA LLP  G   D  K ++ ++DIR+ LY   L Q N TE  D  PYC  YKI+    SC                                N + L K                W +    L   ++IC TCY +   K+  N+C GTG L   ++WRA+R+ +C G F++I   ++   CS  P SF++
Sbjct:   31 SCRNSDGSAKCCVGRKADCAGQKIVFASFHHLNFSPLKRTVGTNQRCYCDEHCLLTEDCCPDYRQVC-NKPKIDCRVSAWSNWSPCSNDCGPGKQRRSRLIIELPRNGGDQCPFLEETRKCDGEHGSICRFVRSGSRMRRL----DASTEVANLLPVQGDIQDQLKLFDMRWDIRRKLYLVQLIQQNRTEVPDPEPYCVMYKIVQANPSCQKRNSGWSFSLDDDAWTDRRRRRSVWSSGWQSNRRTLTKFAGGEPKQAARALVHPWLRAADLLHPGQEICATCYPQYMRKDRDNRCPGTGYLGMVSKWRALRTQDCRGTFRMISMPRSACTCSAGPASFVL 366          
BLAST of SMB domain-containing protein vs. TrEMBL
Match: A0A0R3W6I4 (SMB domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5810 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.034e-39
Identity = 85/268 (31.72%), Postives = 136/268 (50.75%), Query Frame = 2
Query:  194 KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDT-PYCAFYKIIFTFGSCDN----FQKLKKIDRANWSQHF-------------LFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSC---PPNSFIM 934
            +C+CD +C R+ DCC D++  C    K+NC +S W+ W+ C R CG+G Q R+R I     N G +C  L + + C    C  ++ G  +    +H ++ S VA LLP  G   +  K ++ ++DIR+ LY   L Q N T+  D  PYCA+Y+II    +C       ++ ++  ++ W   F               L+  ++I   CY +    EL N+C GTG     +RWRA+ + +C G F++I   ++ S     P SFI+
Sbjct:   74 RCFCDEYCLRTNDCCWDYRDVC-AKPKINCDVSAWSRWSPCNRLCGKGNQTRTRSITREAANGGDQCPLLMESRVCSGYTCSRKRVGRSEYNSYRHMELPSEVANLLPVDGDVEEKIKQFDMRWDIRRKLYYGRLIQQNKTDLPDPEPYCAYYEIIKANDACKAAKAPLERQQRGSQSLWGSLFERNYDLDHPWLSTALLRPGQQISAICYPKYMRPELGNRCPGTGYPGMTSRWRALNTFDCQGTFRMISAPQHASTCRQQPTSFIL 340          
BLAST of SMB domain-containing protein vs. TrEMBL
Match: A0A0R3T6P3 (SMB domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2730 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.206e-39
Identity = 87/285 (30.53%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  182 VGNKKCYCDAFCYRSKDCCHDFKQFCRTSQK-------------VNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDT-PYCAFYKIIFTFGSCDNFQKLKK-------------IDRANWSQH----FLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIH-KRKNCSC--PPNSFIM 934
            +   KC+CD +C R+ DCC D+++ C    +             +NC +S W+ W+ C+R CG+G Q R+R ++   +N G +C  L + + C   +C  ++ G       ++ +++S VA LLP  G   +  K ++ ++DIR+ LY   L Q N T+  D  PYC  Y+II +  +C       +              DR   + H     + L+  ++IC TCY +    EL N C GTG     +RWRA+ + +C G F++I   ++ C+C   PNSFI+
Sbjct:   75 IQKAKCFCDEYCVRTNDCCPDYREVCSKPSRFIFLTANRIDLLEINCEVSGWSRWSSCSRLCGKGNQTRTRIVVKESQNGGEQCPILMESRACTGYMCNRRRVGRSDYNAYRNMELSSEVANLLPVDGDMEEKIKQFDMRWDIRRKLYYGRLIQQNKTDIPDPEPYCVHYEIIKSNEACKAISTPPEHRQSRLWGKLGSFFDRNYDTDHPWLSTVLLRPGQQICATCYPKYMRPELGNHCPGTGYPGMTSRWRALNTFDCQGIFRMISVPQRACTCRRQPNSFIL 359          
BLAST of SMB domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-178e17.3 (somatomedin-B and thrombospondin type-1 domain-containing protein-like [Source:NCBI gene;Acc:103038119])

HSP 1 Score: 105.145 bits (261), Expect = 5.138e-26
Identity = 73/285 (25.61%), Postives = 124/285 (43.51%), Query Frame = 2
Query:  101 LQISAENLSCQNR----CCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTC--HNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
            L +      C +R    CC G+N+ C   +      CYCD++C ++ DCC D++Q C+ S  ++C +  W  W+ C+  CG G   RSR++  PP+N G  C  L+  + C  H   C   K                 VA++LPDS       +++   +  R H+         + ++    YC   ++     +C    ++K      WS     + ++R +C  C S+    +  N+C+G GL    T W A  +  C G +      ++C CP +S + I
Sbjct:   22 LWLPGARAGCADRESPACCTGRNNECAELNRR-KTACYCDSYCEKTGDCCEDYRQVCQISAAIDCEVGEWGVWSPCSSVCGAGTTERSRQVTTPPRNGGSPCPDLKQRRGCLAHLDTCSTAK----------------EVAKILPDS-----FKRNFKDPWR-RPHM---------LIKEERKSYCVNMRVKQVSAAC----RMKV-----WSSQ---MARERSVCVECQSDAMAAD--NRCRGDGLQSIRTFWAAASAPGCLGSWIRESWSESCYCPAHSLLFI 260          
BLAST of SMB domain-containing protein vs. Ensembl Cavefish
Match: SBSPON (somatomedin B and thrombospondin type 1 domain containing [Source:NCBI gene;Acc:103035495])

HSP 1 Score: 89.3521 bits (220), Expect = 2.791e-20
Identity = 70/295 (23.73%), Postives = 130/295 (44.07%), Query Frame = 2
Query:   74 SNINIITALLQISAENLSCQNRCCKGQNSSCVSHDSVGNK---KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLY---KPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            +++ + T           C  +CC G++ +C S D   ++    CYCD  C RSKDCC D+   C T+Q   CV+S WT W+ C R C   ++ R R I   P+N+G+ C +L +   C        ++ + + +   HS+  + +  +   +G  A +             +Y   +         D+ +C  +K+       ++  +   ++    ++   +L++   +C +C         S+ C G G         +W+A+ +  C G +K + K ++CSCP  +SFI I
Sbjct:   10 ASVLLATVFGPYHPAEGGCSGQCCPGKDLTCSSLDWRSDRVYTTCYCDESCVRSKDCCFDYPTEC-TAQP--CVVSEWTHWSGCARPCQPSYRVRRRSIEIKPQNSGQACPALEERAGC-------MEYQDYEGQSCGHSQGPALITTMEYSNGRIAHV-------------VYGTPV---------DSGFCMEFKV-------ESLSRHCMVENKPHTRWMQYLREGFVVCVSC-QPPAISNRSHTCNGDGQSANRDTILQWQAVGNPRCRGTWKKVQKLQHCSCPSVHSFIFI 264          
BLAST of SMB domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-7k24.5 (somatomedin-B and thrombospondin type-1 domain-containing protein-like [Source:NCBI gene;Acc:103032161])

HSP 1 Score: 69.3218 bits (168), Expect = 3.560e-13
Identity = 67/289 (23.18%), Postives = 117/289 (40.48%), Query Frame = 2
Query:  101 LQISAENLSCQNRCCKGQNSSCVSHDSVGNKK---CYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSD-TPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTR-----WRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            ++  AE       CC G++SSC S     ++    CYCD  C    DCCHD++Q C     + CV+S W+ W+ C+  C    + R R+++   +N G  C  L     C        ++ N      QH     S+   L  +G                   Y ++  +  +++ +D   YC  +++     +C +           W Q   +LQ+  ++C  C            C G G   +  R     W+A+ +  C G ++ + +R +C+CP  +SF+ I
Sbjct:   19 VEAEAEGCLPTGLCCSGRDSSCHSQGWRTDRSHGDCYCDQACRTMLDCCHDYEQAC---PAIPCVVSEWSTWSGCSEPCKATVRVRERRVLQDAQNGGEPCPPLLQTAGC-------AEYHN------QHGHCLQSLVPALITTG------------------GYGSARKKREVSDMNDIIGYCVEFELTSLTAACQH----SIGPHTQWMQ---YLQEGHQVCVEC-QPPALAAGQKHCSGDGEDVEHDRRVSLQWQAVGNPRCRGVWRRVRRRDSCTCPTVHSFLFI 265          
BLAST of SMB domain-containing protein vs. Ensembl Cavefish
Match: thsd7aa (thrombospondin, type I, domain containing 7Aa [Source:NCBI gene;Acc:557991])

HSP 1 Score: 59.6918 bits (143), Expect = 2.509e-9
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCP 439
             +Q C      +CV+S ++PWT C++ CG G Q R R I+ PP   G  C +L + +TC   LCP
Sbjct:  170 LEQACLIPCPRDCVVSEFSPWTICSKTCGMGLQNRVRSILAPPLFGGSACPNLTEFRTCQPGLCP 234          
BLAST of SMB domain-containing protein vs. Ensembl Cavefish
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:ZFIN;Acc:ZDB-GENE-070424-99])

HSP 1 Score: 56.9954 bits (136), Expect = 1.709e-8
Identity = 27/75 (36.00%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  221 RSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLR-DVKTCHNVLCPV 442
            R+ + C+   +  R S++V+ V   W+PW+ C+  CG+G + R+R +  PP++ GR CD      K C+  LCPV
Sbjct:  235 RAANACNLSAEVKRPSKEVHGVWEEWSPWSLCSFTCGRGHRTRTR-LCTPPQHGGRACDGPETQSKLCNIALCPV 308          
BLAST of SMB domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-178e17.3 (si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-335])

HSP 1 Score: 67.0106 bits (162), Expect = 1.450e-13
Identity = 51/223 (22.87%), Postives = 84/223 (37.67%), Query Frame = 2
Query:  272 KVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTR--WRAIRSDNCHGYFKLIHKRKNCSCPPNSFIM 934
              +C +  W  W+ C+  CG G + R R++  PP N G KC  LR  + C+          +   +L Q  ++T +V  +  D+G  +          D   H  R                C F+++      C +   +     A W      LQ  R++C  C  E   +    +C G G+     R  W A+    C G +       +C CPP+S ++
Sbjct:    1 ATDCAVLGWGAWSPCSSACGVGSRERIRQVTVPPHNGGAKCPHLRQRQGCY----------SHSLQLCQGIRVT-AVPFITRDAGTSSKTLA------DTTAHEPRTEFAS----------SCVFFRVDDASSPCASRSAV-----APW---LRLLQAGRRVCVECQGE-AVRRGEGRCSGDGVQGTSNRTFWAAVSVPGCRGSWLRERHHNDCHCPPHSSLL 187          
BLAST of SMB domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-178e17.3 (si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-335])

HSP 1 Score: 61.2326 bits (147), Expect = 1.515e-11
Identity = 49/225 (21.78%), Postives = 82/225 (36.44%), Query Frame = 2
Query:  272 KVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLN-ITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTR--WRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
              +C +  W  W+ C+  CG G + R R++  PP N G KC  LR  + C++                 HS  +                  H    +   +   R+   Q++ +T  S    C F+++      C +   +     A W      LQ  R++C  C  E   +    +C G G+     R  W A+    C G +       +C CPP+S ++ 
Sbjct:    1 ATDCAVLGWGAWSPCSSACGVGSRERIRQVTVPPHNGGAKCPHLRQRQGCYS-----------------HSLQS-------------GGWCLHCKRPHFFLKARCRHVQTQISQLTPPSPPSSCVFFRVDDASSPCASRSAV-----APW---LRLLQAGRRVCVECQGE-AVRRGEGRCSGDGVQGTSNRTFWAAVSVPGCRGSWLRERHHNDCHCPPHSSLLF 186          
BLAST of SMB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000912.1 (pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 1.053e-6
Identity = 29/101 (28.71%), Postives = 48/101 (47.52%), Query Frame = 2
Query:  143 CKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQ 445
            C  +  SC S + V ++K      C   +DC     +       ++CV+S WT W++C+R+CG G  FR R ++   +  G    +L   + C    CPV+
Sbjct:  270 CSARQFSCASGECVSSEK-----RCDLHRDCLDGSDEL----DCLDCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVE 361          
BLAST of SMB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000917.1 (pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.221e-6
Identity = 29/101 (28.71%), Postives = 48/101 (47.52%), Query Frame = 2
Query:  143 CKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQ 445
            C  +  SC S + V ++K      C   +DC     +       ++CV+S WT W++C+R+CG G  FR R ++   +  G    +L   + C    CPV+
Sbjct:  213 CSARQFSCASGECVSSEK-----RCDLHRDCLDGSDEL----DCLDCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVE 304          
BLAST of SMB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004444.1 (pep scaffold:Pmarinus_7.0:GL476640:140507:141319:-1 gene:ENSPMAG00000004050.1 transcript:ENSPMAT00000004444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.748e-6
Identity = 24/78 (30.77%), Postives = 40/78 (51.28%), Query Frame = 2
Query:  200 YCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCG--QGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHN 427
             C  F  R  D     ++ C  +   +CV S ++ W+ C R CG   G Q+R+R ++ PP+  G  C +L +V +C +
Sbjct:  131 LCRVFDPRPSD-----QESCTAACPRDCVASEFSAWSPCERPCGADSGLQYRTRTVLVPPEFGGALCPNLTEVHSCRD 203          
BLAST of SMB domain-containing protein vs. Ensembl Nematostella
Match: EDO47504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY4])

HSP 1 Score: 98.2117 bits (243), Expect = 1.007e-23
Identity = 77/276 (27.90%), Postives = 115/276 (41.67%), Query Frame = 2
Query:  140 CCKGQNSSCV--------SHDSVGNKKCYCDAFCYRSKDCCHDFKQF---CRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIF-PPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHG-YFKLIHKRKNCSCPPNSF 928
            CCKG+NS+C         S  S   K C+CD FC  + DCC DFK     C+     +CV+S W+ W+ C+  CG G + RSR++I  P +  G++C  LR  + C                  +H    S +A +LP       IYK   ++Y+  + L       L   ++    YC  +KI      C          +  W+     L   + +C  C S    K     C+G G+  + T W A+   +CHG + +L  K   C C    F
Sbjct:   35 CCKGRNSTCAVERFDEEESRPSNRPKVCFCDEFCEPAGDCCPDFKAVKEECKLQGVQDCVVSTWSRWSPCSHRCGVGMRKRSRRVIVRPSQRGGKECPPLRQKRGC----------------FLEHCGKESGLANILP------KIYKRLPNQYE--EILPAKKSLTLRQEKEERPSYCTLFKIESKHPYC----------QGTWASQ---LDPKKPVCVECQSSAMNKH--GNCKGHGVTGELTSWFAVDIYSCHGEWIRLGPKMSPCKCDSKDF 271          
BLAST of SMB domain-containing protein vs. Ensembl Nematostella
Match: EDO49202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHC2])

HSP 1 Score: 47.3654 bits (111), Expect = 4.367e-7
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  296 WTPWTKCTRNCGQGFQFRSRKIIFP-PKNNGRKCDSLR---DVKTCHNVLCPV 442
            WT WT+C+  CG G Q R+R    P PKNNG  C+SL    + + C++  CPV
Sbjct:    7 WTEWTECSATCGGGIQQRTRACSNPAPKNNGTSCESLGPSFETQACNSKPCPV 59          
BLAST of SMB domain-containing protein vs. Ensembl Nematostella
Match: EDO43462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYH3])

HSP 1 Score: 44.669 bits (104), Expect = 1.475e-6
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = 2
Query:  269 QKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFP-PKNNGRKCDSLRDVKT 418
            + V+   S W PWTKC+++CG GF+ R R    P P+N G+KC    +  T
Sbjct:   10 ETVDGKWSPWGPWTKCSKSCGTGFKSRERTCTNPVPENGGKKCKGPAEQST 60          
BLAST of SMB domain-containing protein vs. Ensembl Nematostella
Match: EDO49895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF43])

HSP 1 Score: 48.1358 bits (113), Expect = 2.488e-6
Identity = 21/57 (36.84%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  266 SQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLC 436
            S +++C L++W+ WT C+  CG G Q R R II  P+++G  C +L + + C    C
Sbjct:  229 SARIDCQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNLYEHRPCARQRC 285          
BLAST of SMB domain-containing protein vs. Ensembl Nematostella
Match: EDO38920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBG9])

HSP 1 Score: 45.0542 bits (105), Expect = 3.234e-6
Identity = 31/81 (38.27%), Postives = 40/81 (49.38%), Query Frame = 2
Query:  224 SKDCCHDFKQFCRTSQKVNCVL----SNWTPWTKCTRNCGQGFQFRSRKIIFP-PKNNGRKC-DSLRDVKTCHNVLCPVQK 448
             KDC  D KQ  R   K  C +    S ++ WTKCT+ CG G Q R+R    P P N G+ C    ++ K C+   CP  K
Sbjct:   38 GKDCVGDAKQT-RECGKAPCPVNGGWSEFSEWTKCTKTCGGGKQERTRTCTNPSPSNGGKDCVGDAKEEKDCNTDKCPPSK 117          
BLAST of SMB domain-containing protein vs. Ensembl Medaka
Match: si:dkey-178e17.3 (somatomedin-B and thrombospondin type-1 domain-containing protein [Source:NCBI gene;Acc:101155034])

HSP 1 Score: 107.457 bits (267), Expect = 3.434e-27
Identity = 74/268 (27.61%), Postives = 121/268 (45.15%), Query Frame = 2
Query:  140 CCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHN--VLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
            CC G+N+ C    S     CYCD +C ++ DCC D++  C+ S  ++CV+ +W  W+ CT  CG G   RSR++  PP+N G  C  LR  + C+    +C   K                 VA++LPDS                 +  +++   + ++  + +  YC + ++     +C    KLK      WS   +   ++R IC  C S+   K  S++C+G G L   T W A  +  C G +      ++C CPP S + +
Sbjct:   12 CCSGRNNDCY-ESSRRKTVCYCDTYCQKTGDCCEDYRGVCQIS-AIDCVVGSWGAWSLCTSKCGVGSTERSRQVSVPPRNGGAPCPDLRQRRGCYGNAAVCSAAK-----------------VAKILPDS----------------FKRNFKDPWRRPHMMIKEEKAYCVYLRVKQASSAC----KLKL-----WSAQLV---RERLICAECQSDAMSK--SDRCEGDG-LKNITFWAAASAPGCQGSWVRESSSEHCRCPPYSVLYV 229          
BLAST of SMB domain-containing protein vs. Ensembl Medaka
Match: SBSPON (somatomedin B and thrombospondin type 1 domain containing [Source:NCBI gene;Acc:101174055])

HSP 1 Score: 78.5666 bits (192), Expect = 1.986e-16
Identity = 70/300 (23.33%), Postives = 121/300 (40.33%), Query Frame = 2
Query:   80 INIITALLQISAENLSCQNRCCKGQNSSCVSHDSVGNKK---CYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQ---LNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTG-------LLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPP-NSFIMI 937
            + +   + Q S     C  +CC G++ SC + D   ++    CYCD  C ++KDCC D+   C      +CV+SNW+PW+ C + C    + R R +   P N G  C  L +   C       +++ + +     H    +S+                   K   ++  Y N L     + +  +S TP C       T                 W +   ++ +  K+C TC  E    +  + CQG G       +L+    W+A  +  C+G ++ I + + C CPP ++F+ I
Sbjct:   12 LLLAITVGQNSLVTGGCSGKCCWGRDLSCYTSDWRMDRSYGTCYCDESCVKTKDCCFDYFTECPAR---DCVVSNWSPWSGCAKPCQLSVRSRVRHVKQKPSNGGEPCPRLEERAGC-------KEYRDHRGSRCGHPAFITSMQ----------------FGKGRPKRDSYGNPLDPGFCMELKLESRTPPCTAENRPHTL----------------WMR---YIAEGFKVCVTC--EPPASQNRSLCQGDGQDSDKQAVLH----WQAAGNPRCYGTWRKIQRMQQCDCPPQHTFVFI 260          
BLAST of SMB domain-containing protein vs. Ensembl Medaka
Match: thsd7ba (thrombospondin type 1 domain containing 7B [Source:NCBI gene;Acc:101159088])

HSP 1 Score: 53.5286 bits (127), Expect = 1.974e-7
Identity = 22/63 (34.92%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  245 FKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVL 433
             +Q C      +CV+S++TPW+ C++ CG G Q R+R ++ PP   G    +L + +TC N +
Sbjct:  177 VEQACLIPCPQDCVVSDFTPWSSCSKTCGVGLQHRTRHVLAPPMYGGADFPNLTETRTCTNSV 239          
BLAST of SMB domain-containing protein vs. Ensembl Medaka
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:NCBI gene;Acc:101172925])

HSP 1 Score: 52.373 bits (124), Expect = 5.176e-7
Identity = 25/70 (35.71%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  236 CHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLR-DVKTCHNVLCPV 442
            C+   +  R  ++V+ V   W+PW+ C+  CG+G + R+R +  PP++ GR CD      K C+  LCPV
Sbjct:  239 CNLSAEVKRPPKEVHGVWEEWSPWSLCSFTCGRGQRTRTR-MCAPPQHGGRACDGPETQTKLCNIALCPV 307          
BLAST of SMB domain-containing protein vs. Ensembl Medaka
Match: thsd7aa (thrombospondin type-1 domain-containing protein 7A [Source:NCBI gene;Acc:101170357])

HSP 1 Score: 51.9878 bits (123), Expect = 6.008e-7
Identity = 23/63 (36.51%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  248 KQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLC 436
            +Q C      +CV+S +TPWT C++ CG G + R R ++ PP   G  C +L + +TC    C
Sbjct:  174 EQACLIPCPRDCVVSEFTPWTLCSKTCGMGLRNRVRNVLAPPLFGGSACPNLTEFQTCQVGPC 236          
BLAST of SMB domain-containing protein vs. Planmine SMEST
Match: SMESG000022577.1 (SMESG000022577.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 278/284 (97.89%), Postives = 279/284 (98.24%), Query Frame = 2
Query:   86 IITALLQISAENLSCQNRCCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKFGNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 937
             + ALLQISAENLSCQNRCCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIF PKNNGRKCDSLRDVKTCHNVLCPVQKF NRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKIC TCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI
Sbjct:   18 FVAALLQISAENLSCQNRCCKGQNSSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFHPKNNGRKCDSLRDVKTCHNVLCPVQKFENRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICATCYSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI 301          
BLAST of SMB domain-containing protein vs. Planmine SMEST
Match: SMESG000079236.1 (SMESG000079236.1)

HSP 1 Score: 164.466 bits (415), Expect = 3.861e-48
Identity = 94/276 (34.06%), Postives = 141/276 (51.09%), Query Frame = 2
Query:  140 CCKGQNSSCVSHDSVGNK------KCYCDAFCYRSKDCCHDFKQFCRTSQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTCHNVLCPVQKF-----GNRKRKLTQHSKMTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPYCAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTC--YSENKYKELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSF 928
            CC+G+N +C   D +G+K      KC+CD  C +SKDCC D+K+ C T + +NC+LSNW  W+ C+ +CG G Q R RK+I P ++NGR CD     + CHN  C + +        R  K  +  K   +   L+P      D  K  ++++     +Y   L   N  +     YCA Y+I  +  SC  ++ L K+++  W  H   L   +++C TC  +S+N YK     C     L    +W A+RSDNC+G F++I   K C CP  S 
Sbjct:   31 CCQGKNHTCHGFDKIGSKWAGRQIKCFCDEHCVKSKDCCSDYKRLCST-KAINCILSNWGHWSPCSVDCGAGVQTRFRKVIIPQQHNGRTCDHTEQARFCHNNSCSILRRVAKVKTKRHSKSKRRPKKLRTEIHLIPKLERNIDTRKLISNRFGRNGKIYMADLSSRNNADPKRNVYCATYQITNSTSSCKVWKDLSKLEQIYWKSHSERLNNGQRVCLTCSSHSDNNYK-----CFEGNKLNNLNKWTAVRSDNCYGQFRMIETPKTCHCPNGSL 300          
BLAST of SMB domain-containing protein vs. Planmine SMEST
Match: SMESG000032462.1 (SMESG000032462.1)

HSP 1 Score: 51.6026 bits (122), Expect = 6.778e-7
Identity = 29/89 (32.58%), Postives = 47/89 (52.81%), Query Frame = 2
Query:  158 SSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRT-SQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTC 421
            +SC S   V ++    D  C  S        Q C + +  ++C++S W+ W++C +NC  G ++R+R II  PK  G  C +L+D  TC
Sbjct:  333 NSCGSGYQVSSRYVVIDEACGGSCSMPLTRNQTCSSFADNLDCLVSPWSEWSECIKNCNNGIKYRTRNIIQLPKCKGISCPNLQDNSTC 421          
BLAST of SMB domain-containing protein vs. Planmine SMEST
Match: SMESG000032462.1 (SMESG000032462.1)

HSP 1 Score: 51.6026 bits (122), Expect = 6.834e-7
Identity = 29/89 (32.58%), Postives = 47/89 (52.81%), Query Frame = 2
Query:  158 SSCVSHDSVGNKKCYCDAFCYRSKDCCHDFKQFCRT-SQKVNCVLSNWTPWTKCTRNCGQGFQFRSRKIIFPPKNNGRKCDSLRDVKTC 421
            +SC S   V ++    D  C  S        Q C + +  ++C++S W+ W++C +NC  G ++R+R II  PK  G  C +L+D  TC
Sbjct:  319 NSCGSGYQVSSRYVVIDEACGGSCSMPLTRNQTCSSFADNLDCLVSPWSEWSECIKNCNNGIKYRTRNIIQLPKCKGISCPNLQDNSTC 407          
The following BLAST results are available for this feature:
BLAST of SMB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SBSPON5.403e-1424.73somatomedin B and thrombospondin type 1 domain con... [more]
THSD7A2.986e-727.54thrombospondin type 1 domain containing 7A [Source... [more]
THSD7A3.013e-727.54thrombospondin type 1 domain containing 7A [Source... [more]
THSD7B1.747e-644.44thrombospondin type 1 domain containing 7B [Source... [more]
THSD7B1.929e-644.44thrombospondin type 1 domain containing 7B [Source... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R17.34.790e-1425.10pep chromosome:WBcel235:III:10837445:10839451:1 ge... [more]
R17.37.408e-1325.10pep chromosome:WBcel235:III:10832936:10839451:1 ge... [more]
R17.37.408e-1325.10pep chromosome:WBcel235:III:10835014:10839451:1 ge... [more]
R17.38.263e-1325.10pep chromosome:WBcel235:III:10832936:10839451:1 ge... [more]
R17.38.263e-1325.10pep chromosome:WBcel235:III:10835014:10839451:1 ge... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG423396.880e-1928.50gene:FBgn0259241 transcript:FBtr0299862[more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-178e17.38.971e-2326.71si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
SBSPON3.594e-1823.74somatomedin B and thrombospondin type 1 domain con... [more]
si:dkey-7k24.52.793e-1523.99si:dkey-7k24.5 [Source:ZFIN;Acc:ZDB-GENE-131127-62... [more]
si:dkey-7k24.52.793e-1523.99si:dkey-7k24.5 [Source:ZFIN;Acc:ZDB-GENE-131127-62... [more]
si:dkey-178e17.34.762e-1323.64si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam107a1.886e-2626.50family with sequence similarity 107 member A [Sour... [more]
SBSPON8.735e-1623.45somatomedin B and thrombospondin type 1 domain con... [more]
fam107a3.367e-1424.10family with sequence similarity 107 member A [Sour... [more]
eftud24.178e-642.59elongation factor Tu GTP binding domain containing... [more]
eftud24.641e-642.59elongation factor Tu GTP binding domain containing... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sbspon1.219e-1222.11somatomedin B and thrombospondin, type 1 domain co... [more]
Thsd7a2.182e-832.81thrombospondin, type I, domain containing 7A [Sour... [more]
Thsd7a2.202e-832.81thrombospondin, type I, domain containing 7A [Sour... [more]
Thsd7b1.072e-644.44thrombospondin, type I, domain containing 7B [Sour... [more]
Hmcn11.143e-644.44hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
back to top
BLAST of SMB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32L50|SBSPO_BOVIN3.919e-1524.15Somatomedin-B and thrombospondin type-1 domain-con... [more]
sp|Q8IVN8|SBSPO_HUMAN2.594e-1324.73Somatomedin-B and thrombospondin type-1 domain-con... [more]
sp|Q3UPR9|SBSPO_MOUSE8.527e-1222.11Somatomedin-B and thrombospondin type-1 domain-con... [more]
sp|Q69ZU6|THS7A_MOUSE1.526e-732.81Thrombospondin type-1 domain-containing protein 7A... [more]
sp|A7MBS7|THS7A_DANRE5.154e-731.03Thrombospondin type-1 domain-containing protein 7A... [more]
back to top
BLAST of SMB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SFP92.223e-4333.82SMB domain-containing protein OS=Hymenolepis dimin... [more]
W6V4P89.721e-4132.59RPE-spondin OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A0X3P2U14.073e-4030.50Somatomedin-B and thrombospondin type-1 domain-con... [more]
A0A0R3W6I41.034e-3931.72SMB domain-containing protein OS=Taenia asiatica O... [more]
A0A0R3T6P31.206e-3930.53SMB domain-containing protein OS=Rodentolepis nana... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-178e17.35.138e-2625.61somatomedin-B and thrombospondin type-1 domain-con... [more]
SBSPON2.791e-2023.73somatomedin B and thrombospondin type 1 domain con... [more]
si:dkey-7k24.53.560e-1323.18somatomedin-B and thrombospondin type-1 domain-con... [more]
thsd7aa2.509e-940.00thrombospondin, type I, domain containing 7Aa [Sou... [more]
adgrb31.709e-836.00adhesion G protein-coupled receptor B3 [Source:ZFI... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-178e17.31.450e-1322.87si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
si:dkey-178e17.31.515e-1121.78si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
ENSPMAT00000000912.11.053e-628.71pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:... [more]
ENSPMAT00000000917.11.221e-628.71pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gen... [more]
ENSPMAT00000004444.11.748e-630.77pep scaffold:Pmarinus_7.0:GL476640:140507:141319:-... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475041.007e-2327.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492024.367e-745.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434621.475e-641.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498952.488e-636.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389203.234e-638.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-178e17.33.434e-2727.61somatomedin-B and thrombospondin type-1 domain-con... [more]
SBSPON1.986e-1623.33somatomedin B and thrombospondin type 1 domain con... [more]
thsd7ba1.974e-734.92thrombospondin type 1 domain containing 7B [Source... [more]
adgrb35.176e-735.71adhesion G protein-coupled receptor B3 [Source:NCB... [more]
thsd7aa6.008e-736.51thrombospondin type-1 domain-containing protein 7A... [more]
back to top
BLAST of SMB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022577.10.000e+097.89SMESG000022577.1[more]
SMESG000079236.13.861e-4834.06SMESG000079236.1[more]
SMESG000032462.16.778e-732.58SMESG000032462.1[more]
SMESG000032462.16.834e-732.58SMESG000032462.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024778 ID=SMED30024778|Name=SMB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1014bp
ATTTTTCCGATTACTACCAATGTCCTCGATGTTACTGATTTTATCGCACC
AATCAACGTGATTCGCCACCGAGTCGAATATAAATATAATCACAGCATTA
TTGCAAATTTCAGCCGAAAATTTGAGCTGTCAAAATCGATGTTGCAAGGG
ACAAAACTCTTCTTGTGTCAGCCATGATTCAGTTGGGAATAAAAAGTGTT
ACTGTGACGCGTTTTGCTACAGATCCAAAGATTGCTGCCATGATTTCAAA
CAATTTTGTAGAACTTCTCAAAAAGTCAACTGTGTCCTTTCTAACTGGAC
TCCGTGGACTAAATGTACAAGAAATTGTGGACAAGGCTTTCAGTTTAGAT
CAAGAAAGATTATATTTCCTCCTAAAAATAACGGCAGAAAATGTGATTCT
CTTCGAGACGTAAAGACCTGTCACAACGTTCTTTGTCCGGTGCAAAAATT
TGGAAACCGCAAACGAAAACTCACACAGCATTCAAAAATGACCTCCTCAG
TTGCCCAGCTATTGCCTGATTCCGGGATCAAAGCAGATATCTATAAGCAC
TATAATCATAAATATGACATTCGACAGCATTTGTATCGCAATAGCCTTCA
CCAGCTAAACATTACCGAACAATCCGACACGCCATATTGCGCCTTTTATA
AAATAATATTCACTTTTGGATCGTGTGATAATTTTCAGAAATTGAAGAAA
ATTGATCGCGCAAATTGGAGTCAGCATTTTCTTTTTCTACAGAAAGACCG
AAAGATTTGCACCACCTGTTATTCGGAAAACAAATACAAAGAATTGTCCA
ACCAATGTCAGGGCACTGGGCTGTTGTATAAACCCACCCGATGGCGCGCC
ATTCGTTCAGACAATTGCCATGGCTATTTTAAATTAATTCACAAAAGAAA
AAATTGCTCTTGCCCCCCAAATTCATTTATAATGATCTAATGATGAAGTT
TAATTGCTCAGCATTTTATAAAGAAGACTTAATTGTAATTTTCACGACTT
AATTTAAACGGTTT
back to top

protein sequence of SMED30024778-orf-1

>SMED30024778-orf-1 ID=SMED30024778-orf-1|Name=SMED30024778-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MTSSVAQLLPDSGIKADIYKHYNHKYDIRQHLYRNSLHQLNITEQSDTPY
CAFYKIIFTFGSCDNFQKLKKIDRANWSQHFLFLQKDRKICTTCYSENKY
KELSNQCQGTGLLYKPTRWRAIRSDNCHGYFKLIHKRKNCSCPPNSFIMI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000036eye
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002142parenchyma
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000884TSP1_rpt
IPR001212Somatomedin_B_dom
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0006898receptor-mediated endocytosis
Vocabulary: molecular function
TermDefinition
GO:0005044scavenger receptor activity
GO:0030247polysaccharide binding