SMED30024776

Overview
NameSMED30024776
Smed IDSMED30024776
Length (bp)586
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024776 (SMED30024776) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024776 (SMED30024776) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024776 (SMED30024776) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024776 (SMED30024776) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30024776 vs. Ensembl Celegans
Match: ZK250.9 (ATP-dependent DNA helicase [Source:UniProtKB/TrEMBL;Acc:G5ED32])

HSP 1 Score: 90.1225 bits (222), Expect = 5.585e-21
Identity = 56/152 (36.84%), Postives = 85/152 (55.92%), Query Frame = -3
Query:    9 ILAATN-DVNAINFKIQIGIPGEVTTYKSINTVM--NQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNIN-PLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLLPIVPTY----MQLEFKHLQFSM*LAFSMTINKAQGQSL 440
            IL   N DV  +N  +   + GE   Y S + V+  +Q + ++YPTEFLN +    +PPHIL LK G  IILLRN++    LCNG+R  V  +  + +      G+ KG   ++P +  Y    +  + +  QF + L+F+++INKAQGQS 
Sbjct: 1267 ILTPKNVDVAQLNDDVHNRMVGEERIYLSRDEVIVEHQADTMHYPTEFLNKMSPSSLPPHILKLKKGSVIILLRNLDVSAGLCNGSRFIVETLASHSLGCRFATGERKGHFTIIPRIDCYDDKNISFQLRRTQFPVRLSFALSINKAQGQSF 1418          
BLAST of SMED30024776 vs. Ensembl Celegans
Match: Y16E11A.2 (ATP-dependent DNA helicase [Source:UniProtKB/TrEMBL;Acc:G5ED32])

HSP 1 Score: 90.1225 bits (222), Expect = 5.585e-21
Identity = 56/152 (36.84%), Postives = 85/152 (55.92%), Query Frame = -3
Query:    9 ILAATN-DVNAINFKIQIGIPGEVTTYKSINTVM--NQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNIN-PLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLLPIVPTY----MQLEFKHLQFSM*LAFSMTINKAQGQSL 440
            IL   N DV  +N  +   + GE   Y S + V+  +Q + ++YPTEFLN +    +PPHIL LK G  IILLRN++    LCNG+R  V  +  + +      G+ KG   ++P +  Y    +  + +  QF + L+F+++INKAQGQS 
Sbjct: 1267 ILTPKNVDVAQLNDDVHNRMVGEERIYLSRDEVIVEHQADTMHYPTEFLNKMSPSSLPPHILKLKKGSVIILLRNLDVSAGLCNGSRFIVETLASHSLGCRFATGERKGHFTIIPRIDCYDDKNISFQLRRTQFPVRLSFALSINKAQGQSF 1418          
BLAST of SMED30024776 vs. Ensembl Celegans
Match: F59H6.5 (ATP-dependent DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q9N5Q7])

HSP 1 Score: 90.1225 bits (222), Expect = 5.592e-21
Identity = 56/152 (36.84%), Postives = 85/152 (55.92%), Query Frame = -3
Query:    9 ILAATN-DVNAINFKIQIGIPGEVTTYKSINTVM--NQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNIN-PLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLLPIVPTY----MQLEFKHLQFSM*LAFSMTINKAQGQSL 440
            IL   N DV  +N  +   + GE   Y S + V+  +Q + ++YPTEFLN +    +PPHIL LK G  IILLRN++    LCNG+R  V  +  + +      G+ KG   ++P +  Y    +  + +  QF + L+F+++INKAQGQS 
Sbjct: 1287 ILTPKNVDVAQLNDDVHNRMVGEERIYLSRDEVIVEHQADTMHYPTEFLNKMSPSSLPPHILKLKKGSVIILLRNLDVSAGLCNGSRFIVETLASHSLGCRFATGERKGHFTIIPRIDCYDDKNISFQLRRTQFPVRLSFALSINKAQGQSF 1438          
BLAST of SMED30024776 vs. Ensembl Celegans
Match: F33H12.6 (ATP-dependent DNA helicase [Source:UniProtKB/TrEMBL;Acc:O44843])

HSP 1 Score: 89.7373 bits (221), Expect = 6.782e-21
Identity = 56/152 (36.84%), Postives = 85/152 (55.92%), Query Frame = -3
Query:    9 ILAATN-DVNAINFKIQIGIPGEVTTYKSINTVM--NQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNIN-PLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLLPIVPTY----MQLEFKHLQFSM*LAFSMTINKAQGQSL 440
            IL   N DV  +N  +   + GE   Y S + V+  +Q + ++YPTEFLN +    +PPHIL LK G  IILLRN++    LCNG+R  V  +  + +      G+ KG   ++P +  Y    +  + +  QF + L+F+++INKAQGQS 
Sbjct: 1161 ILTPKNVDVAQLNDDVHNRMVGEERIYLSRDEVIVEHQADTMHYPTEFLNKMSPSSLPPHILKLKKGSVIILLRNLDVSAGLCNGSRFIVETLASHSLGCRFATGERKGHFTIIPRIDCYDDKNISFQLRRTQFPVRLSFALSINKAQGQSF 1312          
BLAST of SMED30024776 vs. Ensembl Celegans
Match: Y46B2A.2 (ATP-dependent DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q9N4X4])

HSP 1 Score: 89.7373 bits (221), Expect = 8.877e-21
Identity = 56/152 (36.84%), Postives = 85/152 (55.92%), Query Frame = -3
Query:    9 ILAATN-DVNAINFKIQIGIPGEVTTYKSINTVM--NQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNIN-PLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLLPIVPTY----MQLEFKHLQFSM*LAFSMTINKAQGQSL 440
            IL   N DV  +N  +   + GE   Y S + V+  +Q + ++YPTEFLN +    +PPHIL LK G  IILLRN++    LCNG+R  V  +  + +      G+ KG   ++P +  Y    +  + +  QF + L+F+++INKAQGQS 
Sbjct: 1166 ILTPKNVDVAQLNDDVHNRMVGEERIYLSRDEVIVEHQADTMHYPTEFLNKMSPSSLPPHILKLKKGSVIILLRNLDVSAGLCNGSRFIVETLASHSLGCRFATGERKGHFTIIPRIDCYDDKNISFQLRRTQFPVRLSFALSINKAQGQSF 1317          
BLAST of SMED30024776 vs. TrEMBL
Match: A0A293LUY1 (ATP-dependent DNA helicase (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.114e-84
Identity = 133/180 (73.89%), Postives = 149/180 (82.78%), Query Frame = -3
Query:    3 MTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLL---PIVPTYMQLEFKHLQFSM*LAFSMTINKAQGQSLQV 530
            M STK+ELIQ+VF NI RNYKNHQWLSAR ILA+TN DVNAIN  IQ GIPGE TTYKS++TVM QDE VNYPTE LNSLDFPG+ PHIL LKIGVPII LRN+NP +LCNG+RLSV + M NVIE TILN K KGED+LL   P++PT M  +FK LQF + LAF+MTINKAQGQSLQV
Sbjct:    8 MVSTKDELIQKVFPNIARNYKNHQWLSARAILASTNYDVNAINLSIQNGIPGEATTYKSLDTVMTQDEVVNYPTELLNSLDFPGMRPHILTLKIGVPII-LRNMNPPRLCNGSRLSVKKTMNNVIEGTILNRKLKGEDVLLPRIPMIPTDMPFQFKRLQFPVRLAFAMTINKAQGQSLQV 186          
BLAST of SMED30024776 vs. TrEMBL
Match: J9KU39 (ATP-dependent DNA helicase OS=Acyrthosiphon pisum OX=7029 PE=3 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 1.035e-82
Identity = 128/189 (67.72%), Postives = 156/189 (82.54%), Query Frame = -3
Query:    3 ITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLL---PIVPTYMQLEFKHLQFSM*LAFSMTINKAQGQSLQV 557
            ITL  +FC++T+T +ELI +VF N+ +NY+N QWL A  ILAA N DVNAINF+IQ  IPG++TTYKSI+TV NQDE VNYPTEFLNSLD PG+PPH+L LKIGVPIILLRNINP +LCNGTRLSV ++M N+IEATILNGKFK E+++L   P+VPT +   FK LQ+ + +AF+MTIN AQGQSLQV
Sbjct:   15 ITLRADFCRITATADELIAKVFPNLPQNYRNLQWLGAWAILAAKNIDVNAINFRIQNKIPGDLTTYKSIDTVTNQDEVVNYPTEFLNSLDLPGMPPHVLSLKIGVPIILLRNINPPRLCNGTRLSVKKLMNNIIEATILNGKFKSENVMLPRIPMVPTDLPFTFKRLQYPVRIAFAMTINIAQGQSLQV 203          
BLAST of SMED30024776 vs. TrEMBL
Match: A0A4C1U2M7 (ATP-dependent DNA helicase OS=Eumeta variegata OX=151549 GN=pif1 PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.980e-76
Identity = 120/190 (63.16%), Postives = 149/190 (78.42%), Query Frame = -3
Query:    3 FITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLL---LPIVPTYMQLEFKHLQFSM*LAFSMTINKAQGQSLQV 560
            +IT PTNFC    +K ELI++VF NI +NYK+H W+S R ILAA N DVN +NF+IQ  I GE+ TYKSI++V NQD+ VNYPTEFLNSL+ PG+PPH L LKIG  II+LRNIN  +LCNGTRL+V R+M NVIEATIL GK+KGED+L   +P++P  M  +FK LQF + LAF+M+INK+QGQSL V
Sbjct:  109 YITFPTNFCHFMKSKTELIEKVFPNIAQNYKDHVWMSDRVILAAKNIDVNEMNFQIQNKITGELITYKSIDSVTNQDDIVNYPTEFLNSLELPGLPPHNLQLKIGSVIIMLRNINQPRLCNGTRLAVKRLMNNVIEATILKGKYKGEDVLIPRIPLIPNDMSFDFKRLQFPVRLAFAMSINKSQGQSLSV 298          
BLAST of SMED30024776 vs. TrEMBL
Match: A0A2G9FVM7 (ATP-dependent DNA helicase OS=Handroanthus impetiginosus OX=429701 GN=CDL12_30576 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.902e-75
Identity = 112/189 (59.26%), Postives = 151/189 (79.89%), Query Frame = -3
Query:    3 ITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLL---PIVPTYMQLEFKHLQFSM*LAFSMTINKAQGQSLQV 557
            I LPT+FC + +++N LI Q+F +I   Y NH+WL+ R ILAA N DVN +NFKIQ  +PG++ +YKSI+TV + +E VNYP EFLNSLD PG+PPH L LK+G P+ILLRN+NP +LCNGTRL + ++MKNV+EA+ILNGKF+GED+LL   PI+PT + ++FK +QF + LAF+MTINK+QGQ++ V
Sbjct:   31 IKLPTDFCTIINSQNALIDQIFPDINTRYLNHEWLAERAILAAKNVDVNDLNFKIQQLLPGDLVSYKSIDTVCDTNEAVNYPAEFLNSLDLPGMPPHHLQLKVGSPVILLRNLNPPRLCNGTRLIIKKLMKNVVEASILNGKFRGEDVLLPRIPIIPTDVPIDFKRVQFPIRLAFAMTINKSQGQTMSV 219          
BLAST of SMED30024776 vs. TrEMBL
Match: A0A4C1UN33 (ATP-dependent DNA helicase OS=Eumeta variegata OX=151549 GN=PIF6 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.914e-74
Identity = 112/189 (59.26%), Postives = 149/189 (78.84%), Query Frame = -3
Query:    3 ITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLL---LPIVPTYMQLEFKHLQFSM*LAFSMTINKAQGQSLQV 557
            I  P +FC++T +K+ELIQ+VF ++++NY+NH WLS R ILAA N DVN +NFKIQ  I GE+  YKS+++  NQD+ VNYP EFLNSLD PG+PPH L LK+G  +I+LRNIN  +LCNGTRL++ +++ NVIEATIL GK+KGED+L   +P++PT +  EFK LQF + LAF+MTINK+QGQSL +
Sbjct:   80 INFPQSFCQLTRSKDELIQKVFPDVSQNYRNHDWLSERAILAAKNIDVNELNFKIQEQITGELRIYKSVDSATNQDDVVNYPPEFLNSLDLPGLPPHNLQLKVGSVVIMLRNINQPRLCNGTRLAIKKLLNNVIEATILKGKYKGEDVLIPRIPMIPTDVPFEFKRLQFPVRLAFAMTINKSQGQSLSI 268          
BLAST of SMED30024776 vs. Planmine SMEST
Match: SMESG000079276.1 (SMESG000079276.1)

HSP 1 Score: 231.491 bits (589), Expect = 5.248e-78
Identity = 123/171 (71.93%), Postives = 133/171 (77.78%), Query Frame = -3
Query:   57 ITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLL---PIVPTYMQLEFKHLQFSM 557
            ITLP N CKMTSTK+ELI QVF NITR YKNH W S+R ILA+ N  VNAINFKIQ GIP E TTYK I+T MNQDE VNY +EFLN LD P IP HILILKIGVPIILLRNIN  QLCNGTRLSV  IMK VIEATILN KFKGED+LL   P+V T +  EF  + FS+
Sbjct:   10 ITLPANICKMTSTKDELIHQVFPNITRKYKNHHWFSSRAILASINCGVNAINFKIQSGIPDEATTYKPIDTGMNQDEVVNYLSEFLNLLDLPDIPSHILILKIGVPIILLRNINRPQLCNGTRLSVKIIMKKVIEATILNAKFKGEDVLLSRIPMVSTDIPFEFNCVHFSV 180          
BLAST of SMED30024776 vs. Planmine SMEST
Match: SMESG000025940.1 (SMESG000025940.1)

HSP 1 Score: 184.496 bits (467), Expect = 5.419e-60
Identity = 92/120 (76.67%), Postives = 101/120 (84.17%), Query Frame = -3
Query:  123 RNYKNHQWLSARPILAATND-VNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGE 479
            +NYKNHQW S+R ILA TN+ VNAINFKIQ GIP E TTYKSI+TVMNQDE VNYPTEF NSLD  GIPPHILILKIG+ IILLRNINP QLCN TRLSV ++ KNV EATILNG  +G+
Sbjct:    2 QNYKNHQWFSSRAILATTNNGVNAINFKIQSGIPDEATTYKSIDTVMNQDEVVNYPTEFSNSLDLSGIPPHILILKIGMAIILLRNINPPQLCNKTRLSVKKLKKNVYEATILNGNSRGK 121          
BLAST of SMED30024776 vs. Planmine SMEST
Match: SMESG000039910.1 (SMESG000039910.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.670e-59
Identity = 96/124 (77.42%), Postives = 104/124 (83.87%), Query Frame = -3
Query:  189 ITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRL 557
            ITLP N CK+TSTK ELIQQVF NITRNY+NHQWL++R ILA TN DVNAINF+IQ GIP E TTYKSI+T MNQD+F NYPTEFLNSL+  GIP HILILKI VPIILLRNINP QLCN   L
Sbjct:   10 ITLPANLCKLTSTKEELIQQVFPNITRNYENHQWLNSRAILADTNNDVNAINFQIQSGIPDEATTYKSIDTEMNQDKFTNYPTEFLNSLNLTGIPSHILILKIVVPIILLRNINPPQLCNDDEL 133          
BLAST of SMED30024776 vs. Planmine SMEST
Match: SMESG000073501.1 (SMESG000073501.1)

HSP 1 Score: 179.489 bits (454), Expect = 1.747e-58
Identity = 91/113 (80.53%), Postives = 97/113 (85.84%), Query Frame = -3
Query:  195 MTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGT 530
            MT  K+ELIQQVF N+TRNYKNHQWLS+  IL + N DVNAINFKIQ GIPGE TTYKSI+TVMNQDE VNYPTEFLNSLD PGI P ILILKIGVPI LLRNINP Q+CNGT
Sbjct:    1 MTPIKDELIQQVFSNLTRNYKNHQWLSSPAILISNNNDVNAINFKIQSGIPGEATTYKSIDTVMNQDEIVNYPTEFLNSLDLPGISPRILILKIGVPINLLRNINPPQVCNGT 113          
BLAST of SMED30024776 vs. Planmine SMEST
Match: SMESG000059169.1 (SMESG000059169.1)

HSP 1 Score: 171.4 bits (433), Expect = 6.531e-55
Identity = 96/145 (66.21%), Postives = 106/145 (73.10%), Query Frame = -3
Query:   99 MTSTKNELIQQVFLNITRNYKNHQWLSARPILAATN-DVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFPGIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGKFKGEDLLLPIVP 530
            MTSTK+ELIQQVF NIT+NYKN+ WLS+  ILAAT  DVNAINFK Q GIPGEV                 YPTE  NSL+ P IP +ILILKIGVPII LRNINP QLCN TRLSV +IMKN IEATI NGKFK +D+ LP +P
Sbjct:    1 MTSTKDELIQQVFPNITQNYKNNHWLSSCAILAATKIDVNAINFKNQSGIPGEV----------------EYPTELFNSLNLPDIPLYILILKIGVPIIYLRNINPPQLCNSTRLSVKKIMKNFIEATISNGKFKRKDVPLPRIP 129          
The following BLAST results are available for this feature:
BLAST of SMED30024776 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK250.95.585e-2136.84ATP-dependent DNA helicase [Source:UniProtKB/TrEM... [more]
Y16E11A.25.585e-2136.84ATP-dependent DNA helicase [Source:UniProtKB/TrEM... [more]
F59H6.55.592e-2136.84ATP-dependent DNA helicase [Source:UniProtKB/TrEM... [more]
F33H12.66.782e-2136.84ATP-dependent DNA helicase [Source:UniProtKB/TrEM... [more]
Y46B2A.28.877e-2136.84ATP-dependent DNA helicase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of SMED30024776 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A293LUY11.114e-8473.89ATP-dependent DNA helicase (Fragment) OS=Ornithodo... [more]
J9KU391.035e-8267.72ATP-dependent DNA helicase OS=Acyrthosiphon pisum ... [more]
A0A4C1U2M71.980e-7663.16ATP-dependent DNA helicase OS=Eumeta variegata OX=... [more]
A0A2G9FVM74.902e-7559.26ATP-dependent DNA helicase OS=Handroanthus impetig... [more]
A0A4C1UN333.914e-7459.26ATP-dependent DNA helicase OS=Eumeta variegata OX=... [more]
back to top
BLAST of SMED30024776 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024776 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079276.15.248e-7871.93SMESG000079276.1[more]
SMESG000025940.15.419e-6076.67SMESG000025940.1[more]
SMESG000039910.11.670e-5977.42SMESG000039910.1[more]
SMESG000073501.11.747e-5880.53SMESG000073501.1[more]
SMESG000059169.16.531e-5566.21SMESG000059169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024776 ID=SMED30024776|Name=SMED30024776|organism=Schmidtea mediterranea sexual|type=transcript|length=586bp
CACACTTGCAGCGATTGTCCTTGTGCTTTGTTAATGGTCATTGAAAAAGC
GAGTCACATCGAAAACTGTAAATGTTTAAATTCCAATTGCATATATGTTG
GGACAATTGGTAACAGTAAATCTTCCCCCTTGAATTTGCCATTCAAAATT
GTGGCTTCGATGACATTTTTCATAATTCTTGTTACCGAAAGTCTCGTACC
GTTGCAAAGTTGTAGTGGATTGATGTTTCGGAGAAGAATGATAGGCACTC
CAATTTTCAATATTAAAATGTGCGGTGGAATACCAGGAAAATCCAGTGAA
TTCAAGAATTCCGTTGGGTAATTGACAAATTCGTCTTGATTCATCACGGT
GTTGATGGACTTATATGTTGTCACTTCGCCTGGTATTCCAATTTGAATTT
TGAAATTAATGGCATTCACATCATTGGTAGCGGCTAATATAGGACGTGCA
CTGAGCCACTGATGATTTTTGTAATTTCGCGTGATATTTAGAAAAACTTG
TTGAATCAATTCGTTTTTAGTTGATGTCATCTTACAAAAATTTGTTGGTA
ATGTGATAAACCGGTAAGTAATTGCACATAAATGAC
back to top

protein sequence of SMED30024776-orf-1

>SMED30024776-orf-1 ID=SMED30024776-orf-1|Name=SMED30024776-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
HLCAITYRFITLPTNFCKMTSTKNELIQQVFLNITRNYKNHQWLSARPIL
AATNDVNAINFKIQIGIPGEVTTYKSINTVMNQDEFVNYPTEFLNSLDFP
GIPPHILILKIGVPIILLRNINPLQLCNGTRLSVTRIMKNVIEATILNGK
FKGEDLLLPIVPTYMQLEFKHLQFSM*
back to top

protein sequence of SMED30024776-orf-2

>SMED30024776-orf-2 ID=SMED30024776-orf-2|Name=SMED30024776-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
HTCSDCPCALLMVIEKASHIENCKCLNSNCIYVGTIGNSKSSPLNLPFKI
VASMTFFIILVTESLVPLQSCSGLMFRRRMIGTPIFNIKMCGGIPGKSSE
FKNSVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR010285DNA_helicase_pif1-like
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0000723telomere maintenance
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010285DNA helicase Pif1-likePFAMPF05970PIF1coord: 4..55
e-value: 2.0E-9
score: 37.1
NoneNo IPR availablePANTHERPTHR10492:SF71coord: 4..70
NoneNo IPR availablePANTHERPTHR10492UNCHARACTERIZEDcoord: 4..70