Cyclin-dependent kinase 6

Overview
NameCyclin-dependent kinase 6
Smed IDSMED30024759
Length (bp)2904
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin-dependent kinase 6 (SMED30024759) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin-dependent kinase 6 (SMED30024759) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin-dependent kinase 6 (SMED30024759) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin-dependent kinase 6 (SMED30024759) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024759

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024759SMESG000072644.1 SmedASXL_011720SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024759SMESG000072644.1 SmedASXL_011720SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30024759SMESG000072644.1 dd_Smed_v4_6179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024759SMESG000072644.1 dd_Smed_v4_6179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024759SMESG000072644.1 dd_Smed_v4_6179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Human
Match: CDK4 (cyclin dependent kinase 4 [Source:HGNC Symbol;Acc:HGNC:1773])

HSP 1 Score: 151.754 bits (382), Expect = 5.812e-40
Identity = 76/180 (42.22%), Postives = 112/180 (62.22%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEAN 1512
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L     +  ++E N
Sbjct:  130 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPP--RGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRI---SAFRALQ--HSYLHKDEGN 301          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Human
Match: CDK4 (cyclin dependent kinase 4 [Source:HGNC Symbol;Acc:HGNC:1773])

HSP 1 Score: 147.132 bits (370), Expect = 1.841e-39
Identity = 69/155 (44.52%), Postives = 101/155 (65.16%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPE 1437
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D  +   +        R ++ V+   ++   +L+ E+L F+P 
Sbjct:   56 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPP--RGPRPVQSVVPEMEESGAQLLLEMLTFNPH 207          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Human
Match: CDK4 (cyclin dependent kinase 4 [Source:HGNC Symbol;Acc:HGNC:1773])

HSP 1 Score: 140.969 bits (354), Expect = 1.382e-37
Identity = 62/113 (54.87%), Postives = 83/113 (73.45%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQD 1311
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D
Sbjct:   56 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRD 167          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Human
Match: CDK6 (cyclin dependent kinase 6 [Source:HGNC Symbol;Acc:HGNC:1777])

HSP 1 Score: 143.665 bits (361), Expect = 6.065e-37
Identity = 75/173 (43.35%), Postives = 107/173 (61.85%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI-----LSNEAFKKLD 1476
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   KP+F G +++ Q+ KI+  +G    ++WP+D  +   +  S    ++ +E  +   D+    L+ + L F+P  RI     LS+  F+ L+
Sbjct:  135 FLHSHRVVHRDLKPQNILVTSSG-QIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHS--KSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLE 304          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Human
Match: CDK6 (cyclin dependent kinase 6 [Source:HGNC Symbol;Acc:HGNC:1777])

HSP 1 Score: 143.665 bits (361), Expect = 6.065e-37
Identity = 75/173 (43.35%), Postives = 107/173 (61.85%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI-----LSNEAFKKLD 1476
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   KP+F G +++ Q+ KI+  +G    ++WP+D  +   +  S    ++ +E  +   D+    L+ + L F+P  RI     LS+  F+ L+
Sbjct:  135 FLHSHRVVHRDLKPQNILVTSSG-QIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHS--KSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLE 304          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Celegans
Match: cdk-4 (Cyclin-dependent kinase 4 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XTR1])

HSP 1 Score: 131.339 bits (329), Expect = 5.877e-33
Identity = 63/167 (37.72%), Postives = 104/167 (62.28%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            A+ F+H+H +IHRDLKP NIL+NRD T +K+ DFGL++     ++ T +VVTLWYRSPE+LLQ  Y +  D+W+ GCI++E+   +P+F G NE  Q+  I  ++G     +WP ++VI   S      +  +L+ +  +  +  ++ +++ LR+D   R+ +  A 
Sbjct:  156 ALDFLHTHSIIHRDLKPQNILLNRDQT-VKLADFGLSKEYSNTTAFTTLVVTLWYRSPEVLLQSYYNSTVDMWALGCIVSEIYCRQPLFVGQNEAEQLTDIFKKMGTPVGKDWPSESVIARDSFPQY--RPTNLKDLSPQMSKQAIEFVQQCLRYDHSKRLSARGAL 319          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Celegans
Match: cdk-4 (Cyclin-dependent kinase 4 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XTR1])

HSP 1 Score: 129.798 bits (325), Expect = 5.407e-32
Identity = 63/167 (37.72%), Postives = 104/167 (62.28%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            A+ F+H+H +IHRDLKP NIL+NRD T +K+ DFGL++     ++ T +VVTLWYRSPE+LLQ  Y +  D+W+ GCI++E+   +P+F G NE  Q+  I  ++G     +WP ++VI   S      +  +L+ +  +  +  ++ +++ LR+D   R+ +  A 
Sbjct:  220 ALDFLHTHSIIHRDLKPQNILLNRDQT-VKLADFGLSKEYSNTTAFTTLVVTLWYRSPEVLLQSYYNSTVDMWALGCIVSEIYCRQPLFVGQNEAEQLTDIFKKMGTPVGKDWPSESVIARDSFPQY--RPTNLKDLSPQMSKQAIEFVQQCLRYDHSKRLSARGAL 383          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Celegans
Match: cdk-7 (Cyclin-dependent kinase 7 [Source:UniProtKB/Swiss-Prot;Acc:G5EFV5])

HSP 1 Score: 117.857 bits (294), Expect = 1.447e-28
Identity = 62/167 (37.13%), Postives = 96/167 (57.49%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGF-DSSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
            F+H H ++HRDLKP N+L+N+ G  +K+TDFGLAR  G  + + T  VVT WYR+PE+L   RSY    D+WS GCIIAE++   P+F G++++ Q+ KI   LG    + WP    + +  +     +  +L      A Q  + L+  +  FDP  R+   ++ +
Sbjct:  120 FLHVHWILHRDLKPNNLLMNKMGR-VKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQ 285          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Celegans
Match: cdk-7 (Cyclin-dependent kinase 7 [Source:UniProtKB/Swiss-Prot;Acc:G5EFV5])

HSP 1 Score: 117.857 bits (294), Expect = 1.447e-28
Identity = 62/167 (37.13%), Postives = 96/167 (57.49%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGF-DSSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
            F+H H ++HRDLKP N+L+N+ G  +K+TDFGLAR  G  + + T  VVT WYR+PE+L   RSY    D+WS GCIIAE++   P+F G++++ Q+ KI   LG    + WP    + +  +     +  +L      A Q  + L+  +  FDP  R+   ++ +
Sbjct:  120 FLHVHWILHRDLKPNNLLMNKMGR-VKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQ 285          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Celegans
Match: cdk-7 (Cyclin-dependent kinase 7 [Source:UniProtKB/Swiss-Prot;Acc:G5EFV5])

HSP 1 Score: 117.857 bits (294), Expect = 1.447e-28
Identity = 62/167 (37.13%), Postives = 96/167 (57.49%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGF-DSSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
            F+H H ++HRDLKP N+L+N+ G  +K+TDFGLAR  G  + + T  VVT WYR+PE+L   RSY    D+WS GCIIAE++   P+F G++++ Q+ KI   LG    + WP    + +  +     +  +L      A Q  + L+  +  FDP  R+   ++ +
Sbjct:  120 FLHVHWILHRDLKPNNLLMNKMGR-VKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQ 285          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0087102)

HSP 1 Score: 121.324 bits (303), Expect = 1.118e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQ 1308
            F+HSH +IHRDLKP N+L++  G  LK+ DFGLA+  G +  LT VVVTLWYR+PE+LL + Y +  D+WSA CII EM   + +F G +E +Q+++I    G      WPQ
Sbjct:  147 FLHSHRIIHRDLKPQNLLVSSQG-HLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQ 257          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0087103)

HSP 1 Score: 121.324 bits (303), Expect = 1.118e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQ 1308
            F+HSH +IHRDLKP N+L++  G  LK+ DFGLA+  G +  LT VVVTLWYR+PE+LL + Y +  D+WSA CII EM   + +F G +E +Q+++I    G      WPQ
Sbjct:  147 FLHSHRIIHRDLKPQNLLVSSQG-HLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQ 257          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0340063)

HSP 1 Score: 121.324 bits (303), Expect = 1.118e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQ 1308
            F+HSH +IHRDLKP N+L++  G  LK+ DFGLA+  G +  LT VVVTLWYR+PE+LL + Y +  D+WSA CII EM   + +F G +E +Q+++I    G      WPQ
Sbjct:  147 FLHSHRIIHRDLKPQNLLVSSQG-HLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQ 257          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0345340)

HSP 1 Score: 121.324 bits (303), Expect = 1.118e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQ 1308
            F+HSH +IHRDLKP N+L++  G  LK+ DFGLA+  G +  LT VVVTLWYR+PE+LL + Y +  D+WSA CII EM   + +F G +E +Q+++I    G      WPQ
Sbjct:  147 FLHSHRIIHRDLKPQNLLVSSQG-HLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQ 257          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Fly
Match: Cdk4 (gene:FBgn0016131 transcript:FBtr0087104)

HSP 1 Score: 121.324 bits (303), Expect = 1.118e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQ 1308
            F+HSH +IHRDLKP N+L++  G  LK+ DFGLA+  G +  LT VVVTLWYR+PE+LL + Y +  D+WSA CII EM   + +F G +E +Q+++I    G      WPQ
Sbjct:  147 FLHSHRIIHRDLKPQNLLVSSQG-HLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQ 257          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Zebrafish
Match: cdk6 (cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GENE-060503-786])

HSP 1 Score: 146.747 bits (369), Expect = 3.209e-38
Identity = 76/177 (42.94%), Postives = 111/177 (62.71%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI-----LSNEAFKKLDALSR 1488
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   +P+F G++++ Q+ KI   +G  + ++WPQ+  +  S+       ++ +E ++   D+    L+   L F+P  RI     LS+  F+ LD+ S+
Sbjct:  132 FLHSHRVVHRDLKPQNILVT-SGGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSPEDWPQEVGLPQSAFSP--RPAQPIENLVPDMDELGKSLLLRFLSFNPSRRISAYDALSHLYFQSLDSTSK 305          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Zebrafish
Match: cdk21 (cyclin-dependent kinase 21 [Source:ZFIN;Acc:ZDB-GENE-131121-149])

HSP 1 Score: 140.969 bits (354), Expect = 1.926e-36
Identity = 69/164 (42.07%), Postives = 109/164 (66.46%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            F+H++ VIHRDLKP N+L++  G ++K+ DFGLARI  +  +LTP VVTLWYR+PE+LLQ SY+++ D+WSAGCI AE+   +P+F G  E+ Q++KI   +G    ++WP ++ +  S   +LV+K  + +++     +    L+ + L F+P  RI + EA 
Sbjct:  133 FLHTNSVIHRDLKPDNVLVSSRG-EVKIADFGLARIYTYRIALTPCVVTLWYRAPEVLLQSSYMSSVDMWSAGCIFAELFLLRPLFRGFTEIQQLQKIFEVIGLPGKEDWPVESPVCYSP--ALVEKKPATQVLASLTPEE-NGLLSQFLAFNPVHRISACEAL 292          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Zebrafish
Match: cdk4 (cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GENE-060929-974])

HSP 1 Score: 140.584 bits (353), Expect = 2.345e-36
Identity = 72/161 (44.72%), Postives = 97/161 (60.25%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI 1446
             + F+H++ V+HRDLKP NIL+   G  +K+ DFGLARI     +LTPVVVTLWYRSPE+LLQ +Y T  D+WS GCI AEM   KP+F GD+E  Q+ KI   +G  A D WP D  +   +        R +   +    +   +L+ ++L FDP  RI
Sbjct:  127 GLAFLHTNRVLHRDLKPENILVTSRG-QVKLADFGLARIYSCHMALTPVVVTLWYRSPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGDSEADQLGKIFAVIGLPAEDQWPTDVTLSHHNFSP--QSPRPITDCVPDITEKGAELLLKMLTFDPLKRI 284          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Zebrafish
Match: cdk6 (cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GENE-060503-786])

HSP 1 Score: 133.265 bits (334), Expect = 8.496e-34
Identity = 61/114 (53.51%), Postives = 82/114 (71.93%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVV-TLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQD 1311
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVV TLWYR+PE+LLQ SY T  D+WS GCI AEM   +P+F G++++ Q+ KI   +G  + ++WPQ+
Sbjct:  132 FLHSHRVVHRDLKPQNILVT-SGGQIKLADFGLARIYSFQMALTSVVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSPEDWPQE 244          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Zebrafish
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 117.087 bits (292), Expect = 2.634e-28
Identity = 71/172 (41.28%), Postives = 97/172 (56.40%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
              + F HSH V+HRDLKP N+LIN  G ++K+ DFGLAR  G    + T  VVTLWYR+PEILL  + Y TA D+WS GCI AEM+  + +F GD+E+ Q+ +I   LG      WP   V      +    K   + L  V+   D+    L+ ++L +DP  RI +  A 
Sbjct:  113 QGLAFCHSHRVLHRDLKPQNLLINAQG-EIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDESIWP--GVTSMPDYKPSFPKWARQDLSKVVPPLDEDGRDLLGQMLTYDPNKRISAKNAL 281          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Xenopus
Match: ccdc151 (coiled-coil domain containing 151 [Source:Xenbase;Acc:XB-GENE-877178])

HSP 1 Score: 141.354 bits (355), Expect = 1.348e-36
Identity = 70/164 (42.68%), Postives = 100/164 (60.98%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            F+H +C++HRDLKP NIL+   G  +K+ DFGLARI     +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G  + + WP D  +  S+        + +E  +   D     L+  +L F P+ RI +++A 
Sbjct:  103 FLHLNCIVHRDLKPENILVT-SGGQVKLADFGLARIYSCQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFKRKPLFCGNSEADQLCKIFDMIGLPSEEEWPADVTLPRSAFSP--RTQQPVEKFVLEIDAIGANLLLAMLTFSPQKRISASDAL 263          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Xenopus
Match: ccdc151 (coiled-coil domain containing 151 [Source:Xenbase;Acc:XB-GENE-877178])

HSP 1 Score: 141.354 bits (355), Expect = 2.716e-36
Identity = 70/164 (42.68%), Postives = 100/164 (60.98%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            F+H +C++HRDLKP NIL+   G  +K+ DFGLARI     +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G  + + WP D  +  S+        + +E  +   D     L+  +L F P+ RI +++A 
Sbjct:  132 FLHLNCIVHRDLKPENILVT-SGGQVKLADFGLARIYSCQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFKRKPLFCGNSEADQLCKIFDMIGLPSEEEWPADVTLPRSAFSP--RTQQPVEKFVLEIDAIGANLLLAMLTFSPQKRISASDAL 292          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Xenopus
Match: eps15 (epidermal growth factor receptor pathway substrate 15 [Source:Xenbase;Acc:XB-GENE-6070905])

HSP 1 Score: 141.354 bits (355), Expect = 3.417e-36
Identity = 72/164 (43.90%), Postives = 101/164 (61.59%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            F+HSH V+HRDLKP NIL+  +G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   KP+F G++++ Q+ KI   +G    + WP D  +  ++      + + +E V+   D+    L+ + L F P  RI +  A 
Sbjct:  137 FLHSHRVVHRDLKPQNILVTSNG-QIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEEEEWPHDVAVPRNAFH--FRQPQPIENVVPGIDEQGKDLLIKCLTFSPANRISAYSAL 297          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:NCBI gene;Acc:493498])

HSP 1 Score: 115.931 bits (289), Expect = 8.795e-28
Identity = 70/172 (40.70%), Postives = 97/172 (56.40%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
              + F HSH V+HRDLKP N+LIN +G  +K+ DFGLAR  G    + T  VVTLWYR+PEILL  + Y TA D+WS GCI AEM+  + +F GD+E+ Q+ +I   LG     +WP   V      +S   K   +    V+   D     L+ ++L++D   RI +  A 
Sbjct:  113 QGLAFCHSHRVLHRDLKPQNLLINSEGA-IKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWP--GVTTMPDYKSTFPKWVRQDFSKVVPPLDDDGRDLLAQMLQYDSNKRISAKAAL 281          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Xenopus
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:Xenbase;Acc:XB-GENE-5915622])

HSP 1 Score: 113.62 bits (283), Expect = 2.310e-26
Identity = 69/172 (40.12%), Postives = 99/172 (57.56%), Query Frame = 1
Query:  976 MHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVD------KSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
            +H + ++HRDLK +N+L++  G  LKV DFGLAR  G      TP+VVTLWYR+PE+LL  + Y TA D+WS GCI  E++  KP+F G +E+ QI KI   LG  +   WP  N + A    +  D      + R   ++   +DQ F +L+ + L + P  RI S +  K
Sbjct:  141 LHDNWILHRDLKTSNLLLSHAGI-LKVGDFGLAREYGSPLKPYTPIVVTLWYRAPELLLGAKEYSTAIDMWSVGCIFGELLTQKPLFPGKSEIDQINKIFKDLGTPSEKIWPGYNELPAVKKMTFTDYPYNNLRKRFGALL---SDQGF-ELMNKFLTYCPAKRINSEDGLK 307          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Mouse
Match: Cdk4 (cyclin-dependent kinase 4 [Source:MGI Symbol;Acc:MGI:88357])

HSP 1 Score: 150.984 bits (380), Expect = 8.105e-40
Identity = 73/168 (43.45%), Postives = 108/168 (64.29%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLD 1476
            F+H++C++HRDLKP NIL+  +GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP++  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L 
Sbjct:  130 FLHANCIVHRDLKPENILVTSNGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAP--RGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRI---SAFRALQ 291          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Mouse
Match: Cdk6 (cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:MGI:1277162])

HSP 1 Score: 142.895 bits (359), Expect = 7.514e-37
Identity = 71/158 (44.94%), Postives = 100/158 (63.29%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI 1446
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   KP+F G +++ Q+ KI+  +G    ++WP+D  +   +  S    ++ +E  +   D+    L+ + L F+P  RI
Sbjct:  135 FLHSHRVVHRDLKPQNILVTSSG-QIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHS--KSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRI 289          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Mouse
Match: Cdk6 (cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:MGI:1277162])

HSP 1 Score: 142.895 bits (359), Expect = 7.514e-37
Identity = 71/158 (44.94%), Postives = 100/158 (63.29%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI 1446
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   KP+F G +++ Q+ KI+  +G    ++WP+D  +   +  S    ++ +E  +   D+    L+ + L F+P  RI
Sbjct:  135 FLHSHRVVHRDLKPQNILVTSSG-QIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHS--KSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRI 289          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Mouse
Match: Cdk4 (cyclin-dependent kinase 4 [Source:MGI Symbol;Acc:MGI:88357])

HSP 1 Score: 139.813 bits (351), Expect = 1.323e-36
Identity = 61/113 (53.98%), Postives = 84/113 (74.34%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQD 1311
            F+H++C++HRDLKP NIL+  +GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP++
Sbjct:  130 FLHANCIVHRDLKPENILVTSNGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRE 241          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Mouse
Match: Cdk4 (cyclin-dependent kinase 4 [Source:MGI Symbol;Acc:MGI:88357])

HSP 1 Score: 140.584 bits (353), Expect = 1.405e-36
Identity = 61/113 (53.98%), Postives = 84/113 (74.34%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQD 1311
            F+H++C++HRDLKP NIL+  +GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP++
Sbjct:  130 FLHANCIVHRDLKPENILVTSNGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRE 241          
BLAST of Cyclin-dependent kinase 6 vs. UniProt/SwissProt
Match: sp|P11802|CDK4_HUMAN (Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.791e-39
Identity = 76/180 (42.22%), Postives = 112/180 (62.22%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEAN 1512
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L     +  ++E N
Sbjct:  130 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPP--RGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRI---SAFRALQ--HSYLHKDEGN 301          
BLAST of Cyclin-dependent kinase 6 vs. UniProt/SwissProt
Match: sp|P79432|CDK4_PIG (Cyclin-dependent kinase 4 OS=Sus scrofa OX=9823 GN=CDK4 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.013e-39
Identity = 74/168 (44.05%), Postives = 107/168 (63.69%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLD 1476
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L 
Sbjct:  130 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFSP--RGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRI---SAFRALQ 291          
BLAST of Cyclin-dependent kinase 6 vs. UniProt/SwissProt
Match: sp|B2MVY4|CDK4_SHEEP (Cyclin-dependent kinase 4 OS=Ovis aries OX=9940 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.865e-39
Identity = 74/168 (44.05%), Postives = 107/168 (63.69%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLD 1476
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L 
Sbjct:  130 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFSP--RGPRPVQSVVPELEESGAQLLLEMLTFNPHKRI---SAFRALQ 291          
BLAST of Cyclin-dependent kinase 6 vs. UniProt/SwissProt
Match: sp|Q32KY4|CDK4_BOVIN (Cyclin-dependent kinase 4 OS=Bos taurus OX=9913 GN=CDK4 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.865e-39
Identity = 74/168 (44.05%), Postives = 107/168 (63.69%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLD 1476
            F+H++C++HRDLKP NIL+   GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP+D  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L 
Sbjct:  130 FLHANCIVHRDLKPENILVTSGGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFSP--RGPRPVQSVVPELEESGAQLLLEMLTFNPHKRI---SAFRALQ 291          
BLAST of Cyclin-dependent kinase 6 vs. UniProt/SwissProt
Match: sp|P30285|CDK4_MOUSE (Cyclin-dependent kinase 4 OS=Mus musculus OX=10090 GN=Cdk4 PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.669e-39
Identity = 73/168 (43.45%), Postives = 108/168 (64.29%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLD 1476
            F+H++C++HRDLKP NIL+  +GT +K+ DFGLARI  +  +LTPVVVTLWYR+PE+LLQ +Y T  D+WS GCI AEM   KP+F G++E  Q+ KI   +G    D+WP++  +   +        R ++ V+   ++   +L+ E+L F+P  RI    AF+ L 
Sbjct:  130 FLHANCIVHRDLKPENILVTSNGT-VKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAP--RGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRI---SAFRALQ 291          
BLAST of Cyclin-dependent kinase 6 vs. TrEMBL
Match: A0A504Z9V9 (Cyclin-dependent kinase 6 OS=Fasciola gigantica OX=46835 GN=FGIG_00449 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.493e-43
Identity = 86/176 (48.86%), Postives = 124/176 (70.45%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSR 1500
            F+HSH ++HRDLKPANILI+RDG  LK+TDFGLAR+LG++++LTPVVVTLWYR+PEIL+Q  YL+ CD+W+AGCIIAE+   KP+F  DNEL+ +  I+  LG+ A  +WP  + +  S  RS V +  SL   +   D   + L++ ++ F+P+ RI +++A     +L  F+ R
Sbjct:  139 FLHSHRIVHRDLKPANILIDRDGRQLKITDFGLARVLGWEAALTPVVVTLWYRAPEILIQSEYLSPCDIWAAGCIIAELFNLKPLFPKDNELAMMVAILQTLGFPADCDWPALSYLKKSDFRS-VGRKTSLRGSVNTTDSAALDLLERMIMFNPKRRITASDAL----SLPYFHPR 309          
BLAST of Cyclin-dependent kinase 6 vs. TrEMBL
Match: A0A4E0R8S1 (Cyclin-dependent kinase 6 OS=Fasciola hepatica OX=6192 GN=D915_005946 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.601e-43
Identity = 86/176 (48.86%), Postives = 124/176 (70.45%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSR 1500
            F+HSH ++HRDLKPANILI+RDG  LK+TDFGLAR+LG++++LTPVVVTLWYR+PEIL+Q  YL+ CD+W+AGCIIAE+   KP+F  DNEL+ +  I+  LG+ A  +WP  + +  S  RS V +  SL   +   D   + L++ ++ F+P+ RI +++A     +L  F+ R
Sbjct:  139 FLHSHRIVHRDLKPANILIDRDGRQLKITDFGLARVLGWEAALTPVVVTLWYRAPEILIQSEYLSPCDIWAAGCIIAELFNLKPLFPKDNELAMMIAILQTLGFPADCDWPALSYLKKSDFRS-VGRKTSLRGSVNTTDSAALDLLERMIMFNPKRRITASDAL----SLPYFHPR 309          
BLAST of Cyclin-dependent kinase 6 vs. TrEMBL
Match: A0A5K3EHJ8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.063e-42
Identity = 83/168 (49.40%), Postives = 117/168 (69.64%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
             I F+HS  ++HRDLKPANILIN  GT LK+TDFGL+R+LG++S LTP+VVTLWYRSPEIL+Q  YL+ CD+W+AGCII E+   K +F+G  EL  ++KI   LG+ +  +WP+ + I+ +  R L +K+  L   +K  D   + LI+ +L F+P  RI + EA +
Sbjct:  140 GIEFLHSQRIVHRDLKPANILINEAGTHLKITDFGLSRVLGWESQLTPIVVTLWYRSPEILIQSEYLSPCDIWAAGCIIVELFNLKAIFSGKTELMVLKKIFDILGFPSSHDWPRVSYILKNDFRQLGEKN-VLRSKVKTTDMAALDLIERMLTFNPHKRISATEALR 306          
BLAST of Cyclin-dependent kinase 6 vs. TrEMBL
Match: A0A2H1CAS2 (Kinase domain protein OS=Fasciola hepatica OX=6192 GN=D915_09025 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.634e-41
Identity = 74/128 (57.81%), Postives = 100/128 (78.12%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKS 1356
            F+HSH ++HRDLKPANILI+RDG  LK+TDFGLAR+LG++++LTPVVVTLWYR+PEIL+Q  YL+ CD+W+AGCIIAE+   KP+F  DNEL+ +  I+  LG+ A  +WP  + +  S  RS+  K+
Sbjct:  181 FLHSHRIVHRDLKPANILIDRDGRQLKITDFGLARVLGWEAALTPVVVTLWYRAPEILIQSEYLSPCDIWAAGCIIAELFNLKPLFPKDNELAMMIAILQTLGFPADCDWPALSYLKKSDFRSVGRKT 308          
BLAST of Cyclin-dependent kinase 6 vs. TrEMBL
Match: A0A5J4NT65 (Cyclin-dependent kinase 6 OS=Paragonimus westermani OX=34504 GN=DEA37_0007312 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.277e-41
Identity = 82/176 (46.59%), Postives = 122/176 (69.32%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSR 1500
            F+HSH +IHRDLKPAN+LI+R+G  LK+TDFGL+R+LG++S+LTP VVTLWYR+PEILLQ  YL+ CD+W+AGCIIAE+     +F  D EL  +  I  +LG+  +++WP  + +  S  R +  K  SL   +K +D   + L+++++RF+P+ RI + +A     +L  F+ R
Sbjct:  140 FLHSHRIIHRDLKPANLLIDREGRQLKITDFGLSRVLGWESTLTPTVVTLWYRAPEILLQSEYLSPCDIWAAGCIIAELFNCSALFCADTELELLGLIFNKLGFPDVEDWPVHSHLKRSDFR-VSQKKSSLRSSIKTSDAAALDLLEKMIRFNPKKRITACDAL----SLPYFHPR 310          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Cavefish
Match: cdk6 (cyclin dependent kinase 6 [Source:NCBI gene;Acc:103047757])

HSP 1 Score: 149.058 bits (375), Expect = 3.811e-39
Identity = 76/177 (42.94%), Postives = 112/177 (63.28%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI-----LSNEAFKKLDALSR 1488
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   +P+F G++++ Q+ KI   +G  ++++WPQ+  +  S+        + +E ++   D+    L+ + L F+P  RI     LS+  F+ LD+ S+
Sbjct:  132 FLHSHRVVHRDLKPQNILVT-SGGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSVEDWPQEVGLPQSAFTP--RHPQPIEDLVPDMDELGKSLLLQFLAFNPARRISAYEALSHPYFQSLDSTSK 305          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Cavefish
Match: cdk4 (cyclin dependent kinase 4 [Source:NCBI gene;Acc:103034254])

HSP 1 Score: 141.354 bits (355), Expect = 1.152e-36
Identity = 78/189 (41.27%), Postives = 111/189 (58.73%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLR--FDPEIRILSNEAFKKLDALS----RFYSRNEAN 1512
             + F+HS+ V+HRDLKP NIL+   G  +K+ DFGLARI     +LTPVVVTLWYRSPE+LLQ +Y T  D+WS GCI AEM   KP+F G++E+ Q+ KI + +G  + + WP D   V  S R+   +S           QP    + EL     D  +++L+ +  +++ AL     RF+S +  N
Sbjct:  129 GLSFLHSNRVLHRDLKPENILVTSRG-QVKLADFGLARIYSCHMALTPVVVTLWYRSPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGESEVDQLTKIFSVIGLPSEEEWPTD---VTLSRRNFSPQS----------PQPITDYVPELREDGADLLLKMLTFDPLRRISALKAQEHRFFSEHTGN 303          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Cavefish
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:103028318])

HSP 1 Score: 116.316 bits (290), Expect = 4.803e-28
Identity = 71/172 (41.28%), Postives = 97/172 (56.40%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
              + F HSH V+HRDLKP N+LIN  G ++K+ DFGLAR  G    + T  VVTLWYR+PEILL  + Y TA D+WS GCI AEM+  + +F GD+E+ Q+ +I   LG      WP   V      +    K   + L  V+   D+    L+ ++L +DP  RI +  A 
Sbjct:  116 QGLAFCHSHRVLHRDLKPQNLLINAQG-EIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETVWP--GVTSMPDYKPSFPKWALQDLAKVVPPLDEDGRDLLGQMLNYDPNKRISAKNAL 284          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Cavefish
Match: cdk7 (cyclin dependent kinase 7 [Source:NCBI gene;Acc:103042052])

HSP 1 Score: 115.546 bits (288), Expect = 9.592e-28
Identity = 70/189 (37.04%), Postives = 102/189 (53.97%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSL-TPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVD----KSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPN 1521
            +MHSH V+HRDLKP N+L++ +G  LK+ DFGLA+  G  + + T  VVT WYR+PE+L   R Y    D+W+ GCI+AE++   P  AGD++L Q+ KI   LG    D WP       +SL   V         LE +   A    + L++ L  F+P  R  + +A K     S+++S+     P 
Sbjct:   93 YMHSHWVLHRDLKPNNLLLDENGV-LKLADFGLAKAFGSPNRVYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLAGDSDLDQLTKIFEALGTPTEDIWPG-----MTSLPDFVSFKPFPGTPLEHIFSAASDDLLDLLQGLFTFNPCTRFTATKALK-----SQYFSKKPGPTPG 270          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Cavefish
Match: cdk7 (cyclin dependent kinase 7 [Source:NCBI gene;Acc:103042052])

HSP 1 Score: 115.546 bits (288), Expect = 1.895e-27
Identity = 70/189 (37.04%), Postives = 102/189 (53.97%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSL-TPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVD----KSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPN 1521
            +MHSH V+HRDLKP N+L++ +G  LK+ DFGLA+  G  + + T  VVT WYR+PE+L   R Y    D+W+ GCI+AE++   P  AGD++L Q+ KI   LG    D WP       +SL   V         LE +   A    + L++ L  F+P  R  + +A K     S+++S+     P 
Sbjct:  127 YMHSHWVLHRDLKPNNLLLDENGV-LKLADFGLAKAFGSPNRVYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLAGDSDLDQLTKIFEALGTPTEDIWPG-----MTSLPDFVSFKPFPGTPLEHIFSAASDDLLDLLQGLFTFNPCTRFTATKALK-----SQYFSKKPGPTPG 304          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Sea Lamprey
Match: cdk4 (cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GENE-060929-974])

HSP 1 Score: 141.739 bits (356), Expect = 2.843e-37
Identity = 65/121 (53.72%), Postives = 83/121 (68.60%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSL 1335
            F+H+H V+HRDLKP NIL+  DG  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   +P+F G ++  Q+ KI   LG    D+WPQD  +  +S 
Sbjct:  137 FLHTHRVVHRDLKPQNILVTSDG-QVKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATTVDLWSVGCIFAEMFRRRPLFCGSSDFDQLTKIFDLLGLPNRDDWPQDVSLPYTSF 256          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Sea Lamprey
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 115.931 bits (289), Expect = 1.058e-28
Identity = 73/189 (38.62%), Postives = 106/189 (56.08%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSL-TPVVVTLWYRSPEILLQRS-YLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANG 1515
             A+ F HS  V+HRDLKP N+LI+R G  +K+ DFGLAR  G    + T  VVTLWYR+PE+LL    Y T  D+WS G I+AEMV  +P+F GD+E+ Q+ +I   LG    + WP  +V+     +    K     L   +   +Q  + L++++L +DP  RI +        AL+  Y +NE + 
Sbjct:  104 QAVVFCHSRRVLHRDLKPQNLLIDRHG-HIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGTPRYSTPVDMWSVGTILAEMVNKRPLFHGDSEIDQLFRIFRILGTPTTEVWP--DVVTLPDYKPSFPKWVPSGLVAHVPGLNQDGIDLLEKMLTYDPARRISAKR------ALTHPYFQNEESA 283          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 115.161 bits (287), Expect = 2.315e-28
Identity = 70/172 (40.70%), Postives = 99/172 (57.56%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGF-DSSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
              I F HSH ++HRDLKP N+LIN +G  +K+ DFGLAR  G    + T  VVTLWYR+PEILL  + Y T+ DVWS GCI AEM+  + +F GD+E+ Q+ +I   LG      WP   V      +S   +  ++ L  V+   +     L+  +L++DP  R+ +N A 
Sbjct:  113 QGIAFCHSHRILHRDLKPQNLLINAEGA-IKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDEVVWP--GVSQLPDYKSTFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTANMAL 281          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 115.546 bits (288), Expect = 3.831e-27
Identity = 72/181 (39.78%), Postives = 103/181 (56.91%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGT-DLKVTDFGLARILG------FDSSLTPVVVTLWYRSPEILLQRS-YLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIV------ASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            A  ++HS  VIHRD KP+N+L+  DG   +K+ DFGLAR L        D +LT  V T WYR+PEILL    Y    D+WS GCI+ EM+ GK +F G + L+QIE+I++      I    +++V+        S L  +  + +SLE +L  A    + L+K LL F+PE R+ + EA 
Sbjct:  125 ATKYIHSGNVIHRDQKPSNVLL--DGECFVKLCDFGLARSLKQIRDEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMS-----VIPQPSKEDVLAIKSEYGGSVLEKMGRQRQSLESLLPNAPPNALDLLKRLLVFNPEKRLTAEEAL 298          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 115.546 bits (288), Expect = 6.067e-27
Identity = 72/181 (39.78%), Postives = 103/181 (56.91%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGT-DLKVTDFGLARILG------FDSSLTPVVVTLWYRSPEILLQRS-YLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIV------ASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            A  ++HS  VIHRD KP+N+L+  DG   +K+ DFGLAR L        D +LT  V T WYR+PEILL    Y    D+WS GCI+ EM+ GK +F G + L+QIE+I++      I    +++V+        S L  +  + +SLE +L  A    + L+K LL F+PE R+ + EA 
Sbjct:  126 ATKYIHSGNVIHRDQKPSNVLL--DGECFVKLCDFGLARSLKQIRDEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMS-----VIPQPSKEDVLAIKSEYGGSVLEKMGRQRQSLESLLPNAPPNALDLLKRLLVFNPEKRLTAEEAL 299          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 124.02 bits (310), Expect = 1.238e-31
Identity = 75/169 (44.38%), Postives = 100/169 (59.17%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVD-KSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEA 1461
             I + HSH ++HRDLKP N+LIN+DG +LK+ DFGLAR  G    + T  +VTLWYR+PE+LL  + Y T  D WS GCI AEM   KP+F+GD+E+ QI KI   LG      WP D V +     S    + + L  V+   D   + L+ +LL +DP  RI +  A
Sbjct:  123 GIAYCHSHRILHRDLKPQNLLINKDG-NLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWP-DIVYLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRA 289          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 116.701 bits (291), Expect = 3.906e-29
Identity = 64/175 (36.57%), Postives = 101/175 (57.71%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLK-RADQP----FVKLIKELLRFDPEIRILSNEAF 1464
              + F H + ++HRDLKP N+LIN+ G  LK+ DFGLAR  G   ++ +  VVTLWYR+P++L+  R+Y T+ D+WS GCI+AEM+ GKP+F G N+  Q++ I   +G      WP    +   +        R L  VL+    +P     +  +  LL+ +P++R+ + +A 
Sbjct:  119 QGLAFCHENKILHRDLKPQNLLINKRG-QLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQAL 292          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 115.546 bits (288), Expect = 1.854e-27
Identity = 69/184 (37.50%), Postives = 104/184 (56.52%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSS-------LTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLK--------RADQPFVKLIKELLRFDPEIRILSNEAFK 1467
             + ++HS  V+HRDLKP N+L+N D   LK+ DFGLAR  G+  +       LT  V T WYR+PEI+L  + Y  A DVWSAGCI+AE + GKP+F G + ++Q+ +I+  LG       P D  +     +++ D    L  + K         A+   + L++++L FDP+ RI  +EA +
Sbjct:  140 GLKYIHSADVLHRDLKPGNLLVNAD-CQLKICDFGLAR--GYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLG------TPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALE 314          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 112.079 bits (279), Expect = 1.591e-26
Identity = 74/183 (40.44%), Postives = 103/183 (56.28%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQD--NVIVASSLRSLVDKSRSLEIV-----LKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYS 1497
            ++HS  VIHRDLKP+NILIN +  DLK+ DFGLARI   D  +T  V T +YR+PEI+L  + Y    D+WSAGCI AEM+ GKP+F G + + Q   I   LG     + P+D  N I + +    V      + +      K  +   V L++++L FDP+ RI +       DAL+  YS
Sbjct:  134 YVHSAGVIHRDLKPSNILINEN-CDLKICDFGLARIQ--DPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLG-----SPPKDVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAA------DALAHPYS 302          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 109.768 bits (273), Expect = 2.933e-26
Identity = 71/181 (39.23%), Postives = 104/181 (57.46%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSS--------LTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSL--EIVLKRAD--QPFVKLIKELLRFDPEIRILSNEAFK 1467
            A+  +HS  VIHRD+KP+N+L+N +  DLKV DFGLAR L   S         +T  V T WYR+PEI+L  + Y TA D+WS GCI+AEMV GKP+F G +   Q+  I+  LG  + +++ Q     A    + +     L  E V  + D     + L+ ++L+F+P+ RI + EA +
Sbjct:  130 ALKSIHSAQVIHRDIKPSNLLLNSN-CDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALR 309          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Nematostella
Match: EDO37567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE6])

HSP 1 Score: 142.895 bits (359), Expect = 1.760e-37
Identity = 68/164 (41.46%), Postives = 106/164 (64.63%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
            F+H+H ++HRD+KP NIL+ +DG  +K+ DFGLAR+     +LT VVVTLWYR+PE+LLQ SY T+ D+WS  CI+AE+   +P+F G N++ Q++KI + +G  + D WPQ+  +  +S       + S + ++         L+KE+L+F P  R  ++EA 
Sbjct:  128 FLHTHRIVHRDIKPQNILVTKDG-QVKIADFGLARVYKDAMALTSVVVTLWYRAPEVLLQSSYATSVDIWSVACILAELFNRRPLFEGKNDVDQLDKIFSIIGSPSQDEWPQNVSLPWTSFSRYT--TGSFQALVPEMCTEGTTLLKEMLQFLPRSRPSASEAM 288          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 120.553 bits (301), Expect = 4.935e-30
Identity = 73/175 (41.71%), Postives = 100/175 (57.14%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI-----LSNEAFK 1467
             + + HSH V+HRDLKP N+LI+++G  +K+ DFGLAR  G    S T  VVTLWYR+PEILL  R Y T  DVWS GCI AEM   + +F GD+E+ Q+ +I   LG      WP  + +            +S+  VL   D   + L++++L + P  RI     LS+E FK
Sbjct:  114 GVAYCHSHRVLHRDLKPQNLLIDKNGA-IKLADFGLARAFGVPVRSYTHEVVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGTPDDKVWPGVSELPDYKTSFPKWPVQSIRHVLPTLDNTAIDLLQKMLTYQPNARISAKAALSHEFFK 287          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Nematostella
Match: EDO49420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF7])

HSP 1 Score: 118.627 bits (296), Expect = 2.160e-29
Identity = 69/171 (40.35%), Postives = 101/171 (59.06%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMV-YGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
             + F HSH V+HRDLKP N+LIN+DG +LK+ DFGLAR  G      +  VVTLWYR P++L+  + Y T+ D+WSAGCI AEM   G+P+F G++   Q+ +I   LG    ++WP  + +           S SL +V+ +       L+++LL  +P  RI + +A K
Sbjct:  113 GLAFCHSHNVLHRDLKPQNLLINKDG-ELKLADFGLARAFGIPVRCFSAEVVTLWYRPPDVLMGAKLYSTSIDMWSAGCIFAEMANGGRPLFPGNDVDDQLRRIFKILGTPTEESWPNVSKLPDYKEFPPQGPSVSLGMVVPKLSSTGRDLLQKLLVSNPAHRISAEDAMK 282          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Nematostella
Match: EDO29995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T226])

HSP 1 Score: 118.627 bits (296), Expect = 1.292e-28
Identity = 64/168 (38.10%), Postives = 99/168 (58.93%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKS-RSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
            ++H H ++HRDLK +N+L+   G  LK+ DFGLAR  G+    +TPVVVTLWYRSPE+LL  + + TA D+W+ GCI  E++  KP+ AG +E++Q++ IV  LG      WP  + +      SL  +   +L+       Q  + L+  +L +DP  R  + E+ +
Sbjct:  150 YLHEHFIVHRDLKVSNLLLTGKGV-LKIADFGLARTFGYPYKPMTPVVVTLWYRSPELLLGAKVHTTAVDMWAVGCIFGELLGNKPLLAGKSEINQLQLIVDLLGTPNDHIWPGYSSLPGVKSISLKHQPYNNLKHKFSWVSQAGLSLLNYMLMYDPCKRATAAESLQ 316          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 115.161 bits (287), Expect = 1.026e-27
Identity = 73/174 (41.95%), Postives = 100/174 (57.47%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD----SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWP-QDNVIVASSLRSLVDKSRSLEI-VLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
             + ++HS  V+HRDLKP+N+L+N    DLK+ DFGLARI   D      LT  V T WYR+PEI+L  + Y  A D+WS GCI+AEM+  +P+F G + L Q+  I+  LG    D+     N    S L+SL  K ++  I +   AD   + LI+ LL F+P  RI   EA 
Sbjct:  132 GLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIADDLLCIKNEKARSYLQSLPYKPKTPFIKLFSNADAKALDLIENLLAFNPNKRITVEEAL 304          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Medaka
Match: cdk6 (cyclin dependent kinase 6 [Source:NCBI gene;Acc:101168879])

HSP 1 Score: 150.984 bits (380), Expect = 8.263e-40
Identity = 77/177 (43.50%), Postives = 111/177 (62.71%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRI-----LSNEAFKKLDALSR 1488
            F+HSH V+HRDLKP NIL+   G  +K+ DFGLARI  F  +LT VVVTLWYR+PE+LLQ SY T  D+WS GCI AEM   +P+F G++++ Q+ KI   +G  + ++WPQ+  +  S+        + +E ++   D+    L+ + L F+P  RI     LS+  F+ LD+ SR
Sbjct:  132 FLHSHRVVHRDLKPQNILVT-SGGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSAEDWPQEVALPQSAFTP--RPPKPIEDLVPDIDEQGQALLMQFLAFNPSRRISAFTALSHPYFQSLDSHSR 305          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Medaka
Match: cdk4 (cyclin dependent kinase 4 [Source:NCBI gene;Acc:101172808])

HSP 1 Score: 142.895 bits (359), Expect = 5.242e-37
Identity = 72/168 (42.86%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
             + F+HS+ V+HRDLKP NIL+   G  +K+ DFGLARI     +LTPVVVTLWYR PE+LLQ SY T  D+WS GCI AEM   KP+F G++E+ Q+ KI   LG    + WP D  +   +   L   +R +   +   ++   +L+ ++L FDP  R+ + +A +
Sbjct:  127 GLSFLHSNRVMHRDLKPENILVTSQG-QVKLADFGLARIYSCHMALTPVVVTLWYRPPEVLLQSSYATPVDIWSTGCIFAEMFRRKPLFCGESEMDQLGKIFEVLGLPPEEEWPTDVTVSRKNFPLL--HARPITDFVPEINEEGAQLLLQMLTFDPLKRVSAVKALE 291          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Medaka
Match: cdk4 (cyclin dependent kinase 4 [Source:NCBI gene;Acc:101172808])

HSP 1 Score: 142.895 bits (359), Expect = 5.686e-37
Identity = 72/169 (42.60%), Postives = 103/169 (60.95%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
              + F+HS+ V+HRDLKP NIL+   G  +K+ DFGLARI     +LTPVVVTLWYR PE+LLQ SY T  D+WS GCI AEM   KP+F G++E+ Q+ KI   LG    + WP D  +   +   L   +R +   +   ++   +L+ ++L FDP  R+ + +A +
Sbjct:  136 SGLSFLHSNRVMHRDLKPENILVTSQG-QVKLADFGLARIYSCHMALTPVVVTLWYRPPEVLLQSSYATPVDIWSTGCIFAEMFRRKPLFCGESEMDQLGKIFEVLGLPPEEEWPTDVTVSRKNFPLL--HARPITDFVPEINEEGAQLLLQMLTFDPLKRVSAVKALE 301          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Medaka
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:101161880])

HSP 1 Score: 120.939 bits (302), Expect = 6.328e-30
Identity = 76/188 (40.43%), Postives = 104/188 (55.32%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPNC 1524
            F HSH V+HRDLKP N+LIN  G ++K+ DFGLAR  G    + T  VVTLWYR+PEILL  + Y TA DVWS GCI AEM+  + +F GD+E+ Q+ +I   LG      WP   V      +    K   + L  V+   D+   +L+ E+L++DP  R+ +  A      + RF+       PN 
Sbjct:   91 FCHSHRVLHRDLKPQNLLINAQG-EIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETAWP--GVTSMPDYKPSFPKWARQDLSKVVPLLDEDGRELLGEMLKYDPNKRLSAKNAL-----VHRFFRDVTMPVPNL 270          
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Medaka
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:101161880])

HSP 1 Score: 121.324 bits (303), Expect = 8.787e-30
Identity = 76/192 (39.58%), Postives = 105/192 (54.69%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILLQ-RSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDK--SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPNC 1524
              + F HSH V+HRDLKP N+LIN  G ++K+ DFGLAR  G    + T  VVTLWYR+PEILL  + Y TA DVWS GCI AEM+  + +F GD+E+ Q+ +I   LG      WP   V      +    K   + L  V+   D+   +L+ E+L++DP  R+ +  A      + RF+       PN 
Sbjct:  113 QGLAFCHSHRVLHRDLKPQNLLINAQG-EIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETAWP--GVTSMPDYKPSFPKWARQDLSKVVPLLDEDGRELLGEMLKYDPNKRLSAKNAL-----VHRFFRDVTMPVPNL 296          
BLAST of Cyclin-dependent kinase 6 vs. Planmine SMEST
Match: SMESG000072644.1 (SMESG000072644.1)

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 567/579 (97.93%), Postives = 570/579 (98.45%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPNCXXXXXXXXXXDANYNGKDWGEIECENDLIVKSVVRNVLDXXXXXXXXXXXLWIPGIDYNEPINCYPHEEIEIENRDDESSLEDEIGTNXXXXXXXXXXXXXXXXXQEGNPDAKELDERGNSFSSYRSCQNNCXXXXXXXXXXXXVDTTSDDERTECRYSHEIAECKDKFNDTVIHDDRLPDSVVGPIAIXXXXXXXXXXXXXXXXXXXXXXXXXXXRLHTQSQQSVDKSLPFLMTRHNSDRIYSTPFKELNDSDRLLRSCSIPPKDQFVRKRLLHSEDTSDSENEFANVSPIPSVEFKPNLFRQKSLRRRVSMLGPHLAGENKLKSSLMRSESVRIKPISENDEVRDMSFGERSLTRELESIKSETANKLSFQLSDRPKIVVRRRSTIIRK 2697
            DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPNCSSSSNISTSSDANYNGKDWGEIECENDLIVKSVVRNVLDEEQGEPEEQEELWIPGIDYNEPINCYPHEEIEIENRD ESSLEDEIGTNSCSETESCEETVSVPEEQEGNPDAK+LDERGNSFSSYRSCQNNCSFSSQAPSSPAAVDTTSDDERTECRYSHEIAECKDKFNDTVIHDDRLPDSVVGPIAI  +  D+D    EEEEETCSASEPSPSRLHTQSQQSVDKSLPFLMTRHNSDRIYSTPFKELNDSDRLLRSCSIPPKDQFVRKRLLHSEDTSDSENEFANVSPIPSVEFKPNLFRQKSLRRRVSMLGPHLAGENKLKSSLMRSESVRIKPISENDEVRDMSFGERSLTRELESIKSETANKLSFQLSDRPKIVVRRRSTIIRK
Sbjct:  136 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLWYRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFYSRNEANGPNCSSSSNISTSSDANYNGKDWGEIECENDLIVKSVVRNVLDEEQGEPEEQEELWIPGIDYNEPINCYPHEEIEIENRDVESSLEDEIGTNSCSETESCEETVSVPEEQEGNPDAKQLDERGNSFSSYRSCQNNCSFSSQAPSSPAAVDTTSDDERTECRYSHEIAECKDKFNDTVIHDDRLPDSVVGPIAI--TSSDEDDDTSEEEEETCSASEPSPSRLHTQSQQSVDKSLPFLMTRHNSDRIYSTPFKELNDSDRLLRSCSIPPKDQFVRKRLLHSEDTSDSENEFANVSPIPSVEFKPNLFRQKSLRRRVSMLGPHLAGENKLKSSLMRSESVRIKPISENDEVRDMSFGERSLTRELESIKSETANKLSFQLSDRPKIVVRRRSTIIRK 712          
BLAST of Cyclin-dependent kinase 6 vs. Planmine SMEST
Match: SMESG000052421.1 (SMESG000052421.1)

HSP 1 Score: 123.635 bits (309), Expect = 2.530e-30
Identity = 73/170 (42.94%), Postives = 98/170 (57.65%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWPQDNVIVA-SSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAF 1464
             + F H   VIHRDLKP N+L++  GT +K+ DFGLAR  G    +LT  VVTLWYR+PEIL+  + Y  A DVWS  CI AEM   KP+F GD+E+ QI KI   LG    ++WP  + + + +S+  L   SR             + LI E+L ++P  RI S +A 
Sbjct:  124 GLLFCHLRRVIHRDLKPQNLLVDATGTIIKLADFGLARTFGVPVKALTHEVVTLWYRAPEILMGSKRYSCAVDVWSVACIFAEMATTKPLFRGDSEIDQIFKIFHLLGTPTENHWPGVSHLSSWNSMLPLWTTSRLCSHFKDFMSPDGLDLISEMLLYNPPDRINSRDAL 293          
BLAST of Cyclin-dependent kinase 6 vs. Planmine SMEST
Match: SMESG000032743.1 (SMESG000032743.1)

HSP 1 Score: 117.472 bits (293), Expect = 3.754e-28
Identity = 71/186 (38.17%), Postives = 106/186 (56.99%), Query Frame = 1
Query:  973 FMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARI----LGFDSSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGY--EAIDNWPQDNVIVASSLRSLVDK-----SRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFKKLDALSRFY 1494
            ++HS  VIHRDLKP+N+L+N +  DLK+ DFGL+R+          LT  V T WYR+PEI+L  + Y  A D+WS GCI+AEM+ GKP+F G + + Q+  I+T LGY  E    W     IV    R  V+K         + +   AD+  + +++ LL F+P  R+   +A   +  L+++Y
Sbjct:  135 YIHSANVIHRDLKPSNLLVNSN-CDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAW-----IVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQAL-AMPYLNQYY 313          
BLAST of Cyclin-dependent kinase 6 vs. Planmine SMEST
Match: SMESG000055046.1 (SMESG000055046.1)

HSP 1 Score: 115.546 bits (288), Expect = 1.041e-26
Identity = 68/173 (39.31%), Postives = 101/173 (58.38%), Query Frame = 1
Query:  961 DAIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFD-SSLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTRLGYEAIDNWP--QDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLRFDPEIRILSNEAFK 1467
            +AI  +H + +IHRDLK +N+L++ +G  LKV DFGLAR  G    S T +VVTLWYR+PE+LL Q+ Y T  D+WS GCI  E++  + +FAG +E+ QI+ +   LG    + WP   +  ++      L +K R+ + +  R       +  +LL F PE R  + EA K
Sbjct:  273 EAIAHLHDNWIIHRDLKTSNLLLSHNGI-LKVADFGLAREYGSPLKSYTNLVVTLWYRAPELLLGQKMYSTNIDMWSVGCIFGELLLNRALFAGKSEMEQIQILFRELGVPTEETWPGVSELPMMKKVNFKLKEKPRNEKRLSNRLSLGGKYVFNKLLTFCPEKRFTAEEAKK 444          
BLAST of Cyclin-dependent kinase 6 vs. Planmine SMEST
Match: SMESG000074437.1 (SMESG000074437.1)

HSP 1 Score: 109.768 bits (273), Expect = 1.131e-26
Identity = 51/103 (49.51%), Postives = 71/103 (68.93%), Query Frame = 1
Query:  964 AIWFMHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDS-SLTPVVVTLWYRSPEILL-QRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKI 1266
             + + H   VIHRDLKP NIL+N+ GT +K+ DFGL RI G  S  +T  ++T WYR+PEI+L  ++Y  + D+WS GCI AE+  G P+F GD+E+ Q+ KI
Sbjct:   29 GLLYCHKRRVIHRDLKPQNILVNKTGTLVKLADFGLGRIYGIPSKKMTTEIITQWYRAPEIILGAKTYNCSVDMWSVGCIFAELALGAPLFNGDSEIGQLFKI 131          
The following BLAST results are available for this feature:
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDK45.812e-4042.22cyclin dependent kinase 4 [Source:HGNC Symbol;Acc:... [more]
CDK41.841e-3944.52cyclin dependent kinase 4 [Source:HGNC Symbol;Acc:... [more]
CDK41.382e-3754.87cyclin dependent kinase 4 [Source:HGNC Symbol;Acc:... [more]
CDK66.065e-3743.35cyclin dependent kinase 6 [Source:HGNC Symbol;Acc:... [more]
CDK66.065e-3743.35cyclin dependent kinase 6 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk-45.877e-3337.72Cyclin-dependent kinase 4 homolog [Source:UniProt... [more]
cdk-45.407e-3237.72Cyclin-dependent kinase 4 homolog [Source:UniProt... [more]
cdk-71.447e-2837.13Cyclin-dependent kinase 7 [Source:UniProtKB/Swiss... [more]
cdk-71.447e-2837.13Cyclin-dependent kinase 7 [Source:UniProtKB/Swiss... [more]
cdk-71.447e-2837.13Cyclin-dependent kinase 7 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdk41.118e-2949.11gene:FBgn0016131 transcript:FBtr0087102[more]
Cdk41.118e-2949.11gene:FBgn0016131 transcript:FBtr0087103[more]
Cdk41.118e-2949.11gene:FBgn0016131 transcript:FBtr0340063[more]
Cdk41.118e-2949.11gene:FBgn0016131 transcript:FBtr0345340[more]
Cdk41.118e-2949.11gene:FBgn0016131 transcript:FBtr0087104[more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk63.209e-3842.94cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk211.926e-3642.07cyclin-dependent kinase 21 [Source:ZFIN;Acc:ZDB-GE... [more]
cdk42.345e-3644.72cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk68.496e-3453.51cyclin-dependent kinase 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk22.634e-2841.28cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc1511.348e-3642.68coiled-coil domain containing 151 [Source:Xenbase;... [more]
ccdc1512.716e-3642.68coiled-coil domain containing 151 [Source:Xenbase;... [more]
eps153.417e-3643.90epidermal growth factor receptor pathway substrate... [more]
cdk28.795e-2840.70cyclin-dependent kinase 2 [Source:NCBI gene;Acc:49... [more]
hspa1b2.310e-2640.12heat shock protein family A (Hsp70) member 1B [Sou... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdk48.105e-4043.45cyclin-dependent kinase 4 [Source:MGI Symbol;Acc:M... [more]
Cdk67.514e-3744.94cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:M... [more]
Cdk67.514e-3744.94cyclin-dependent kinase 6 [Source:MGI Symbol;Acc:M... [more]
Cdk41.323e-3653.98cyclin-dependent kinase 4 [Source:MGI Symbol;Acc:M... [more]
Cdk41.405e-3653.98cyclin-dependent kinase 4 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11802|CDK4_HUMAN2.791e-3942.22Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 ... [more]
sp|P79432|CDK4_PIG3.013e-3944.05Cyclin-dependent kinase 4 OS=Sus scrofa OX=9823 GN... [more]
sp|B2MVY4|CDK4_SHEEP3.865e-3944.05Cyclin-dependent kinase 4 OS=Ovis aries OX=9940 PE... [more]
sp|Q32KY4|CDK4_BOVIN3.865e-3944.05Cyclin-dependent kinase 4 OS=Bos taurus OX=9913 GN... [more]
sp|P30285|CDK4_MOUSE5.669e-3943.45Cyclin-dependent kinase 4 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z9V92.493e-4348.86Cyclin-dependent kinase 6 OS=Fasciola gigantica OX... [more]
A0A4E0R8S13.601e-4348.86Cyclin-dependent kinase 6 OS=Fasciola hepatica OX=... [more]
A0A5K3EHJ85.063e-4249.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A2H1CAS21.634e-4157.81Kinase domain protein OS=Fasciola hepatica OX=6192... [more]
A0A5J4NT654.277e-4146.59Cyclin-dependent kinase 6 OS=Paragonimus westerman... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk63.811e-3942.94cyclin dependent kinase 6 [Source:NCBI gene;Acc:10... [more]
cdk41.152e-3641.27cyclin dependent kinase 4 [Source:NCBI gene;Acc:10... [more]
cdk24.803e-2841.28cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
cdk79.592e-2837.04cyclin dependent kinase 7 [Source:NCBI gene;Acc:10... [more]
cdk71.895e-2737.04cyclin dependent kinase 7 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk42.843e-3753.72cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk11.058e-2838.62cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk22.315e-2840.70cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mapk153.831e-2739.78mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
mapk156.067e-2739.78mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC281.238e-3144.38Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
PHO853.906e-2936.57Cyclin-dependent kinase; has ten cyclin partners; ... [more]
SLT21.854e-2737.50Serine/threonine MAP kinase; coordinates expressio... [more]
HOG11.591e-2640.44Mitogen-activated protein kinase involved in osmor... [more]
KSS12.933e-2639.23Mitogen-activated protein kinase (MAPK); involved ... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375671.760e-3741.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414034.935e-3041.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494202.160e-2940.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299951.292e-2838.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374351.026e-2741.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk68.263e-4043.50cyclin dependent kinase 6 [Source:NCBI gene;Acc:10... [more]
cdk45.242e-3742.86cyclin dependent kinase 4 [Source:NCBI gene;Acc:10... [more]
cdk45.686e-3742.60cyclin dependent kinase 4 [Source:NCBI gene;Acc:10... [more]
cdk26.328e-3040.43cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
cdk28.787e-3039.58cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cyclin-dependent kinase 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072644.10.000e+097.93SMESG000072644.1[more]
SMESG000052421.12.530e-3042.94SMESG000052421.1[more]
SMESG000032743.13.754e-2838.17SMESG000032743.1[more]
SMESG000055046.11.041e-2639.31SMESG000055046.1[more]
SMESG000074437.11.131e-2649.51SMESG000074437.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024759 ID=SMED30024759|Name=Cyclin-dependent kinase 6|organism=Schmidtea mediterranea sexual|type=transcript|length=2904bp
TAATTCATTTGGTGAGATGCCATTAGCTAAAATAATTGTAAGATATTTCA
AATATTTCATAAAATGAACACTTTTTCAATAATTTTATCCTTTTTTCCAA
TATAGAAATGTTTATAATTGTTATCATTTTACAAAATTTCTAAGTAGGAT
TCAAATTTTCATTGAATTTTCATTGGATAAATTTCATAAATGAATTTGCC
CGGAATTTTTAGCATCTCAAATCAGTAAGCTTATAAATTAATCAAAAGTT
CAATTGCAAATGATCCATATAAGGAGGGGAGAGACAGTAAATAGTTTGTT
TAAGAGCTCTAATTATCCATTTTCATGACAATTGTTATTAGTTTTGTATT
TCTCATGTTTTACTCGAAAAAAACTTGATAACAATCGTAAAACCTTCAAT
CGGAACGAATGGTGAAACATTTGATAGCAAACACAAATTTTGTATTTATA
TTAAAATTTATAATCAAGGATTCATTTTATGTTGCTTTTCGTTCTTTATT
CTTCATTCTACTCGCATTTGATTCCTTTAATATCGGTTCATTCATTGGCT
TTCGTGTCATGAGTAACGGACCAATGAAATCACTCGCATGCAAATTCACA
TATAAACCGTAATAGTTTTTATATTTTCATTAATTCAACAAGTCTATTAT
CGCATTAAATACTTGCTTTTTTCTTTATACACACTACGATGTTTCTCAAC
CCGATCGAAACCGACGGGGAACCCGGGAACCGAGGAAACGGTGGCCAATA
CATGTAAATTTCCAACTGATATGAGCATTACTAGTCTCCTTCGTTATTCT
TTCTCCACTTTAACGCCTGATTATCTCTAGACTCTCATTTGACTCCTCTG
TTTCGTGTTGCACATTTATCGACCAATGAAATTGCTCCCTACTCGATTTG
TCGATATTTTGACCCAATTCATAATGATTACTCGTGTAGAATCTATCGAA
ACAACTGCTCGATGCTATCTGGTTTATGCATTCCCATTGCGTTATCCACC
GGGATTTAAAACCCGCAAATATCCTCATCAACCGAGACGGAACCGATTTG
AAAGTCACAGATTTTGGACTGGCAAGAATTCTCGGTTTCGACTCGAGCTT
GACGCCAGTCGTAGTGACGCTGTGGTACCGATCGCCGGAAATCCTGTTGC
AACGCAGCTATCTGACCGCATGCGACGTCTGGTCAGCCGGCTGTATCATT
GCGGAAATGGTTTACGGGAAACCGGTATTTGCCGGTGACAATGAGCTCTC
ACAAATCGAGAAAATCGTCACTCGGCTTGGATACGAAGCCATTGATAACT
GGCCGCAAGATAACGTTATCGTTGCGTCATCTCTCAGATCGCTCGTTGAT
AAATCTCGCAGTTTAGAAATCGTCTTGAAACGCGCTGATCAGCCGTTTGT
TAAATTGATAAAGGAGTTGTTACGCTTCGATCCGGAAATTCGCATCTTGT
CGAACGAGGCGTTCAAGAAACTGGACGCGCTGAGTCGATTTTATTCGCGG
AATGAGGCCAACGGGCCGAATTGCAGCTCCTCGTCGAATATTTCCACATC
GTCCGATGCCAATTATAATGGCAAGGATTGGGGGGAAATCGAATGTGAGA
ATGATTTGATTGTGAAATCGGTAGTGAGGAATGTCCTGGACGAGGAACAA
GGGGAACCGGAGGAACAGGAAGAACTCTGGATCCCGGGGATCGATTATAA
TGAACCGATCAATTGTTACCCTCATGAAGAAATAGAAATCGAGAATCGGG
ACGACGAATCGAGTCTCGAGGATGAGATTGGTACGAATTCCTGCTCCGAG
ACGGAATCGTGCGAGGAAACCGTTTCCGTTCCAGAGGAACAAGAGGGCAA
TCCCGATGCTAAGGAGCTTGATGAGCGAGGAAATAGTTTCAGCAGTTACC
GGAGCTGCCAGAACAATTGCTCATTCAGTTCGCAAGCGCCTTCGTCACCG
GCAGCGGTAGACACGACGAGTGATGACGAGCGTACCGAATGCAGATATTC
ACATGAGATTGCTGAATGCAAGGATAAGTTCAATGACACGGTGATACACG
ATGACCGATTGCCGGATTCCGTGGTGGGCCCGATCGCGATTACCAGTTCA
GACGAGGATGACGACACCAGTGAGGAGGAGGAGGAGGAGGAGACTTGCAG
CGCTTCTGAGCCCTCTCCGTCGCGATTGCACACTCAGTCTCAGCAATCAG
TTGACAAATCACTACCGTTCCTCATGACGCGACACAATTCAGATAGAATT
TATTCGACTCCATTCAAAGAACTCAATGACAGTGACCGCCTGTTGCGTTC
CTGCTCAATCCCACCGAAAGATCAATTCGTCCGGAAGCGTCTCCTCCACT
CGGAGGACACGAGCGATTCAGAAAACGAATTTGCGAATGTTTCACCGATT
CCAAGCGTAGAATTCAAACCGAATCTTTTCCGACAGAAATCTCTGCGCCG
CCGAGTCTCGATGCTCGGTCCGCATTTGGCCGGGGAAAACAAACTCAAAA
GCTCGCTGATGCGCAGTGAAAGCGTCCGGATCAAACCAATTTCGGAAAAT
GATGAGGTGCGCGACATGAGTTTTGGTGAGCGCAGTTTAACCCGGGAATT
GGAATCAATCAAATCAGAAACTGCAAATAAGTTGAGCTTCCAATTATCCG
ACAGACCGAAGATCGTTGTCCGTCGGCGAAGTACAATTATCAGGAAATGA
CTTATTCGTATATATTCTCCTTACTTCAGCATTTAAATATTCCTCGGCTT
CCTGCATTTTTGATGCTAATATTTTTTTAATATATTTTATGTATAACTAT
TTGAATTTCTGATTAATATTTTACCGTTTCCAATTGGTATCTTTATATTG
TGTTTGAGCTTGGATTTATAAATATATACATTAGGAAATGTTAAGATCGG
AAGA
back to top

protein sequence of SMED30024759-orf-1

>SMED30024759-orf-1 ID=SMED30024759-orf-1|Name=SMED30024759-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=575bp
MHSHCVIHRDLKPANILINRDGTDLKVTDFGLARILGFDSSLTPVVVTLW
YRSPEILLQRSYLTACDVWSAGCIIAEMVYGKPVFAGDNELSQIEKIVTR
LGYEAIDNWPQDNVIVASSLRSLVDKSRSLEIVLKRADQPFVKLIKELLR
FDPEIRILSNEAFKKLDALSRFYSRNEANGPNCSSSSNISTSSDANYNGK
DWGEIECENDLIVKSVVRNVLDEEQGEPEEQEELWIPGIDYNEPINCYPH
EEIEIENRDDESSLEDEIGTNSCSETESCEETVSVPEEQEGNPDAKELDE
RGNSFSSYRSCQNNCSFSSQAPSSPAAVDTTSDDERTECRYSHEIAECKD
KFNDTVIHDDRLPDSVVGPIAITSSDEDDDTSEEEEEEETCSASEPSPSR
LHTQSQQSVDKSLPFLMTRHNSDRIYSTPFKELNDSDRLLRSCSIPPKDQ
FVRKRLLHSEDTSDSENEFANVSPIPSVEFKPNLFRQKSLRRRVSMLGPH
LAGENKLKSSLMRSESVRIKPISENDEVRDMSFGERSLTRELESIKSETA
NKLSFQLSDRPKIVVRRRSTIIRK*
back to top

protein sequence of SMED30024759-orf-2

>SMED30024759-orf-2 ID=SMED30024759-orf-2|Name=SMED30024759-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MKLLPTRFVDILTQFIMITRVESIETTARCYLVYAFPLRYPPGFKTRKYP
HQPRRNRFESHRFWTGKNSRFRLELDASRSDAVVPIAGNPVATQLSDRMR
RLVSRLYHCGNGLRETGICR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 1..173
e-value: 1.3E-9
score: 2.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 1..164
e-value: 2.2E-37
score: 128.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..173
score: 27.905
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 1..165
e-value: 1.2E-47
score: 164.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 376..390
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 363..407
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 392..407
NoneNo IPR availablePANTHERPTHR24056CELL DIVISION PROTEIN KINASEcoord: 1..410
NoneNo IPR availablePANTHERPTHR24056:SF414CYCLIN-DEPENDENT KINASE 9coord: 1..410
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 6..18
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 1..164