GCR477

Overview
NameGCR477
Smed IDSMED30024757
Length (bp)970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR477 (SMED30024757) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR477 (SMED30024757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024757h1SMcG0018336 dd_Smed_v4_61048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024757h1SMcG0018336 dd_Smed_v4_61048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR477 vs. Ensembl Human
Match: QRFPR (pyroglutamylated RFamide peptide receptor [Source:HGNC Symbol;Acc:HGNC:15565])

HSP 1 Score: 121.324 bits (303), Expect = 1.290e-30
Identity = 87/307 (28.34%), Postives = 163/307 (53.09%), Query Frame = 1
Query:    1 YAFKLAMIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSK-------LIENDTI-CKETW-SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQR------IKSKEKLLKMVITISFLYTLSQLPRHIIYLC-SITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            Y  +L    +L ++ T V  +IF LA+ GN +V  V++    + +VTNIF+ +L LSDL++    IPV ++  N S+ W+ G+F+C+M+PF+Q T V     T   ++ +R   + +P K++   + + A  ++  VW +A+   SP+    +       L E + I C E W SP+  +IYT  +L+  + +P+  M+I YS I Y++W +   G  S  + I         + K++ + M++T+  L+ +   P H++++    +N          ++++  V ++  S+S  NPI+Y +MN  +
Sbjct:   36 YTPELPGRAKLALVLTGV--LIFALALFGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQ-NISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENF 339          
BLAST of GCR477 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 115.931 bits (289), Expect = 5.245e-29
Identity = 85/293 (29.01%), Postives = 151/293 (51.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTS-KLIE-----NDTICKETW----SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            +IE+ ++  + YC I +L V+GN +VI V+  F ++ +VTN F+ NL ++DL++    +P  +      E W  G  LC ++P+ QG  V +   T  +++ DR   + Y L+ +ISK+ +  II   W I+   +SPL IF    LIE         C E W      I   +Y++S L+  Y +P+G +   Y+ I  K+     PG  +     +R    +K  KM++ +  ++ +S LP H   L ++  +S  L  +  ++++    +++  S+  NP++Y WMN+ Y
Sbjct:   46 LIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGE-WKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRR----QKTTKMLVCVVVVFAVSWLPLHAFQL-AVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNY 332          
BLAST of GCR477 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 115.931 bits (289), Expect = 5.245e-29
Identity = 85/293 (29.01%), Postives = 151/293 (51.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTS-KLIE-----NDTICKETW----SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            +IE+ ++  + YC I +L V+GN +VI V+  F ++ +VTN F+ NL ++DL++    +P  +      E W  G  LC ++P+ QG  V +   T  +++ DR   + Y L+ +ISK+ +  II   W I+   +SPL IF    LIE         C E W      I   +Y++S L+  Y +P+G +   Y+ I  K+     PG  +     +R    +K  KM++ +  ++ +S LP H   L ++  +S  L  +  ++++    +++  S+  NP++Y WMN+ Y
Sbjct:   46 LIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGE-WKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRR----QKTTKMLVCVVVVFAVSWLPLHAFQL-AVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNY 332          
BLAST of GCR477 vs. Ensembl Human
Match: TACR2 (tachykinin receptor 2 [Source:HGNC Symbol;Acc:HGNC:11527])

HSP 1 Score: 112.079 bits (279), Expect = 2.087e-27
Identity = 75/281 (26.69%), Postives = 140/281 (49.82%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIF--TSKLIENDTICKETWSPIKNQ----IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNES--SNLFWQNKRILWICVILLSASSSCYNPIIYFWMN 855
            L+   Y  + ++AV GN +VI +I ++    +VTN F++NL L+DL +A  N   N V  +    W FG   C        T + +  ++   ++ DR++ + +P + R+S     A+I+ +W +AL  +SP  F  T  + +  T C   W          +Y + ++   YF+P+  M + YS I   +W R VPG  +    ++ +++ +K +K ++ +   + +  LP H+ ++     E    + F Q    +++ +  L+ SS+ YNPIIY  +N
Sbjct:   35 LWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYAS-HNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQ---VYLALFWLAMSSTMYNPIIYCCLN 311          
BLAST of GCR477 vs. Ensembl Human
Match: GALR2 (galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4133])

HSP 1 Score: 108.612 bits (270), Expect = 3.360e-26
Identity = 77/280 (27.50%), Postives = 143/280 (51.07%), Query Frame = 1
Query:   37 ILFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLI--FTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLC------SITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            ++  +++ +IF++  VGN +V+ V+      VS TN+F++NL ++DL   +  +P         + WVFGS LC+ + F+    +   +FT   +S DR++ + YPL  R   + + A+A I  +W ++L  S P +  +    + N T+C   WS  + +   I   +F Y +PV  + + Y+  +  +W R V  + +        ++K K+ +M++ ++ L+ L  +P H + LC       +T  +  L     RIL     L+S ++SC NPI+Y
Sbjct:   26 VIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTL-DGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLW-RAVDPVAAGSGA---RRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYAL-----RIL---SHLVSYANSCVNPIVY 292          
BLAST of GCR477 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 134.42 bits (337), Expect = 6.629e-36
Identity = 96/299 (32.11%), Postives = 169/299 (56.52%), Query Frame = 1
Query:   31 LNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVN----IVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPL--KVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIEN-DTI--CKETWSPIKN------QIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIY---SQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNE--SSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            + +L  + Y I+ +  V GNV+VI VI YF  + + TNI ++NL ++DL++++  IP +    ++ D+  + W+FGS +C ++ F+Q   V L A+T V++S DR++ + + L   +RI+++ A+ +++  W  ++  + PL+FT++  E+ D +  C E W+   +      ++Y+  +LI QY +P   +II Y+ I  KMW   VPG+    +++  + R +S +KL+ MVI IS L+ L  LP  ++ L ++  E       W     LW     L+ S S  NPIIYF  N  +
Sbjct:   49 MKMLCILFYSILCVCCVYGNVLVILVIVYFKRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDD--QRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFEDQDGLPNCGENWTYFGDSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLP--LLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARF 343          
BLAST of GCR477 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 134.035 bits (336), Expect = 1.089e-35
Identity = 95/300 (31.67%), Postives = 167/300 (55.67%), Query Frame = 1
Query:   28 ELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVN----IVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPL--KVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTI---CKETWSPIKN------QIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIY---SQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNE--SSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             + +L  + Y I+ +  V GNV+VI VI YF  + + TNI ++NL ++DL++++  IP +    ++ D+  + W+FGS +C ++ F+Q   V L A+T V++S DR++ + + L   +RI+++ A+ +++  W  ++  + PL+FT++  E+      C E W+   +      ++Y+  +LI QY +P   +II Y+ I  KMW   VPG+    +++  + R +S +KL+ MVI IS L+ L  LP  ++ L ++  E       W     LW     L+ S S  NPIIYF  N  +
Sbjct:   48 SMKMLCILFYSILCVCCVYGNVLVILVIVYFKRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDD--QRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFEDQDGLPNCGENWTYFGDSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLP--LLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARF 343          
BLAST of GCR477 vs. Ensembl Celegans
Match: npr-6 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q20275])

HSP 1 Score: 92.4337 bits (228), Expect = 8.062e-21
Identity = 77/289 (26.64%), Postives = 149/289 (51.56%), Query Frame = 1
Query:   43 FTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFY-----PLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKL--IEND---TICKETWSPIK-NQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQR---IKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            F  +YC +F++A  GN +V+  V++     ++TNIF+ NL +SD+++  T++ +     +    W+FG  LC  +P  QGT + +  +T   ++ DR++V+ +      +  R+S +  ++ I  +W  +L   +P     KL  I       IC E WS  +   I+ I ++I Q+ +P   + I Y     K+W      + S+Q   +R   IK K++LL+M+I +  ++ +   P +++  C    +  N        +++ V L+S +++ +NPI+Y +MN T+
Sbjct:   40 FISMYCAVFLVASSGNFLVVYVVMTNKRMQTITNIFITNLAVSDIMVNFTSLWLTPTYTSIGH-WIFGGGLCHGLPLFQGTSIFISTWTLTAIAIDRYIVIVHNSSNININDRMSMRSCLSFIVLIWLCSLLLVTPYAINMKLNYIHEPCDFLICSEDWSNAEFRSIFGIVVMILQFILPFVLIAISY----IKIWL----FLNSRQSMTERKSDIKRKKRLLRMLIVMVVIFAICWFPFNLLN-CLRDLKLDNFMRGYFSFVFLSVHLMSMTATAWNPILYAFMNETF 318          
BLAST of GCR477 vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 91.2781 bits (225), Expect = 1.183e-20
Identity = 83/299 (27.76%), Postives = 148/299 (49.50%), Query Frame = 1
Query:   25 IELNILFTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE----NDTICKETWSPIK--NQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLL-----KMVITISFLYTLSQLP-------RHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            I + IL TI Y II ++ V GN++V+ +V+ + +  SV N+F+++L +SD+ +AI +  V  +   +S+ W+FG  LC ++P +QGT +S    T   ++ DR++++ +P K  I K  A+ +IS    I++  S PL    +L++        C E W P      +Y   + I Q+  P+  +   Y+ I  K+  R V    SQ++ +   + +         +M+I ++  + LS LP       R    L  I +    LF     I++ C+   S +S   NP +Y + N  +
Sbjct:   26 IPIAILATI-YTIIVVVGVTGNLLVVMSVMRFKVLQSVRNMFIVSLSVSDIFVAIVSGSVTPIT-AFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPIRKDQALKMISFNSAISVGLSVPLFMKQELMQFRNYCGEYCSENWGPDAYLRSVYGTVVFIIQFVFPLITITFCYASISIKLR-RGVFVRGSQKELMSEARRQLTQRRLRTNRMLIIMTVTFALSWLPSVGFNFLRDYSALPGIIDSQDYLFG----IIFHCI---SMTSVIVNPFLYGYCNEHF 314          
BLAST of GCR477 vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 91.2781 bits (225), Expect = 1.439e-20
Identity = 83/299 (27.76%), Postives = 148/299 (49.50%), Query Frame = 1
Query:   25 IELNILFTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE----NDTICKETWSPIK--NQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLL-----KMVITISFLYTLSQLP-------RHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            I + IL TI Y II ++ V GN++V+ +V+ + +  SV N+F+++L +SD+ +AI +  V  +   +S+ W+FG  LC ++P +QGT +S    T   ++ DR++++ +P K  I K  A+ +IS    I++  S PL    +L++        C E W P      +Y   + I Q+  P+  +   Y+ I  K+  R V    SQ++ +   + +         +M+I ++  + LS LP       R    L  I +    LF     I++ C+   S +S   NP +Y + N  +
Sbjct:   26 IPIAILATI-YTIIVVVGVTGNLLVVMSVMRFKVLQSVRNMFIVSLSVSDIFVAIVSGSVTPIT-AFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPIRKDQALKMISFNSAISVGLSVPLFMKQELMQFRNYCGEYCSENWGPDAYLRSVYGTVVFIIQFVFPLITITFCYASISIKLR-RGVFVRGSQKELMSEARRQLTQRRLRTNRMLIIMTVTFALSWLPSVGFNFLRDYSALPGIIDSQDYLFG----IIFHCI---SMTSVIVNPFLYGYCNEHF 314          
BLAST of GCR477 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0345268)

HSP 1 Score: 147.132 bits (370), Expect = 3.675e-40
Identity = 91/288 (31.60%), Postives = 155/288 (53.82%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE---------NDTICKETW-SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             I+  ++Y  IFI A++GN  V  ++ S     +VTN F+ +L + D++++   +P + ++      W FG  LC  + + Q   V + A+T V +S DR++ + +PLK RI+K++A  II+ VWFIAL ++ P+   S L              IC+E W S  +   YT+SL   Q+ +P+G +I  Y+ I  ++W +  PG     +  +  +SK K++KM++T+  ++T   LP +I+ L  + N+     W     +W     L+ S  CYNPIIY +MN  +
Sbjct:  105 KIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQL--LLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARF 390          
BLAST of GCR477 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0085100)

HSP 1 Score: 146.362 bits (368), Expect = 6.175e-40
Identity = 92/289 (31.83%), Postives = 156/289 (53.98%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE---------NDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             I+  ++Y  IFI A++GN  V  ++ S     +VTN F+ +L + D++++   +P + ++      W FG  LC  + + Q   V + A+T V +S DR++ + +PLK RI+K++A  II+ VWFIAL ++ P+   S L              IC+E W P + Q   YT+SL   Q+ +P+G +I  Y+ I  ++W +  PG     +  +  +SK K++KM++T+  ++T   LP +I+ L  + N+     W     +W     L+ S  CYNPIIY +MN  +
Sbjct:  105 KIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMW-PSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQL--LLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARF 390          
BLAST of GCR477 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0345267)

HSP 1 Score: 145.591 bits (366), Expect = 2.348e-39
Identity = 92/289 (31.83%), Postives = 156/289 (53.98%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE---------NDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             I+  ++Y  IFI A++GN  V  ++ S     +VTN F+ +L + D++++   +P + ++      W FG  LC  + + Q   V + A+T V +S DR++ + +PLK RI+K++A  II+ VWFIAL ++ P+   S L              IC+E W P + Q   YT+SL   Q+ +P+G +I  Y+ I  ++W +  PG     +  +  +SK K++KM++T+  ++T   LP +I+ L  + N+     W     +W     L+ S  CYNPIIY +MN  +
Sbjct:  105 KIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMW-PSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQL--LLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARF 390          
BLAST of GCR477 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0301656)

HSP 1 Score: 117.857 bits (294), Expect = 2.613e-29
Identity = 86/299 (28.76%), Postives = 161/299 (53.85%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVN---IVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE-------NDTICKETW--SPIKN----QIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRH---IIYLC--SITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             +L++I++  + I+A  GN++V+  V++     +VTN F++NL ++D +++  N+  N   +++ +W     FG F C++  FI    +    FT + +S DR+V +  PL+ R+SK+  +AI + +W  +   S P++   +  E       N T+C   W   P  +     +Y I ++I  YF+P+  M + YS +  ++W     G  + +Q ++ ++SK +++KM+I +  ++ +  LP H   II  C  +IT      F Q    L++ +  L+ S+S YNPIIY WMN+ +
Sbjct:  101 QVLWSILFGGMVIVATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWP----FGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSKTIGECTPRQ-VENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAP---FIQE---LYLAIYWLAMSNSMYNPIIYCWMNSRF 388          
BLAST of GCR477 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0085507)

HSP 1 Score: 117.857 bits (294), Expect = 2.839e-29
Identity = 86/299 (28.76%), Postives = 161/299 (53.85%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVN---IVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE-------NDTICKETW--SPIKN----QIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRH---IIYLC--SITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             +L++I++  + I+A  GN++V+  V++     +VTN F++NL ++D +++  N+  N   +++ +W     FG F C++  FI    +    FT + +S DR+V +  PL+ R+SK+  +AI + +W  +   S P++   +  E       N T+C   W   P  +     +Y I ++I  YF+P+  M + YS +  ++W     G  + +Q ++ ++SK +++KM+I +  ++ +  LP H   II  C  +IT      F Q    L++ +  L+ S+S YNPIIY WMN+ +
Sbjct:  101 QVLWSILFGGMVIVATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWP----FGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSKTIGECTPRQ-VENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAP---FIQE---LYLAIYWLAMSNSMYNPIIYCWMNSRF 388          
BLAST of GCR477 vs. Ensembl Zebrafish
Match: CABZ01084347.1 (pyroglutamylated RFamide peptide receptor b [Source:NCBI gene;Acc:101886159])

HSP 1 Score: 121.709 bits (304), Expect = 6.650e-31
Identity = 84/298 (28.19%), Postives = 154/298 (51.68%), Query Frame = 1
Query:   43 FTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSKL-------------------IENDTICKETW-SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVI-LLSASSSCYNPIIYFWMNTTY 864
            F ++Y IIF+LA+VGN +V+ V+     + + TNIF+ +L +SDL++    IP  ++  N S  W+ G  +C+ +PF+Q T +     T   ++ +R+  + YPLK++   + K A  ++  VW  A+   SP++F  +L                     +   C+E W S ++ Q+YT  +++  + +P+  M+  YS I  ++W R   G  S    +  +  +E  +KM+ITI  L+T+   P HI+++    N+    + +    + I V+  +  S+S  NPI+Y +MN  +
Sbjct:   49 FVVMYVIIFVLALVGNSLVVYVVVRKRAIRTATNIFICSLAVSDLLITFFCIPFTLL-QNISSEWLGGVLVCKTVPFVQTTAIVTGILTMTCIAIERYQGIVYPLKMKRQYTPKRAYRMLGLVWIAAVMVGSPMLFVQQLEVMYISMALQYQSPYDFLYDHHHVCCQERWHSLLQRQLYTTFIMVALFLLPLAAMLFLYSRIGVELWIRKRVGDAS---VLSTMNHREITVKMMITIVLLFTVCWAPFHIVHMLFEYNDLEKKYNEVTVNMIIAVVQAIGFSNSFNNPIVYAFMNENF 342          
BLAST of GCR477 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 119.013 bits (297), Expect = 1.829e-30
Identity = 83/276 (30.07%), Postives = 144/276 (52.17%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI--SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISK--KFAIAIISCVWFIALCSSSPLI--FTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            +++ ++++ +IF++  VGN +V+ V+  +  M    TN+F++NL L+DL   +  +P+        E WVFG+F+C+ + FI    +    FT   +S DR++ + YPL+ R ++  + A+  IS VW ++L  SSP +  +    ++  T+C   WS    Q   I   IF Y IPV  + I Y+  +  +W    P     Q   +  K+K K+ KM+I ++ L+ L  LP H++ LC               +L I   L++ ++SC NPI+Y
Sbjct:   17 SVIISLIFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDE-WVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTFIFGYLIPVLILGITYARTIRYLWTSVDP----MQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFP--LNHTTYVLRILSHLVAYANSCLNPIVY 285          
BLAST of GCR477 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 119.013 bits (297), Expect = 2.102e-30
Identity = 83/276 (30.07%), Postives = 144/276 (52.17%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI--SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISK--KFAIAIISCVWFIALCSSSPLI--FTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            +++ ++++ +IF++  VGN +V+ V+  +  M    TN+F++NL L+DL   +  +P+        E WVFG+F+C+ + FI    +    FT   +S DR++ + YPL+ R ++  + A+  IS VW ++L  SSP +  +    ++  T+C   WS    Q   I   IF Y IPV  + I Y+  +  +W    P     Q   +  K+K K+ KM+I ++ L+ L  LP H++ LC               +L I   L++ ++SC NPI+Y
Sbjct:   18 SVIISLIFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDE-WVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTFIFGYLIPVLILGITYARTIRYLWTSVDP----MQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFP--LNHTTYVLRILSHLVAYANSCLNPIVY 286          
BLAST of GCR477 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 119.013 bits (297), Expect = 2.102e-30
Identity = 83/276 (30.07%), Postives = 144/276 (52.17%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI--SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISK--KFAIAIISCVWFIALCSSSPLI--FTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            +++ ++++ +IF++  VGN +V+ V+  +  M    TN+F++NL L+DL   +  +P+        E WVFG+F+C+ + FI    +    FT   +S DR++ + YPL+ R ++  + A+  IS VW ++L  SSP +  +    ++  T+C   WS    Q   I   IF Y IPV  + I Y+  +  +W    P     Q   +  K+K K+ KM+I ++ L+ L  LP H++ LC               +L I   L++ ++SC NPI+Y
Sbjct:   18 SVIISLIFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDE-WVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTFIFGYLIPVLILGITYARTIRYLWTSVDP----MQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFP--LNHTTYVLRILSHLVAYANSCLNPIVY 286          
BLAST of GCR477 vs. Ensembl Zebrafish
Match: npy2rl (neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:ZDB-GENE-111115-4])

HSP 1 Score: 115.931 bits (289), Expect = 3.345e-29
Identity = 86/291 (29.55%), Postives = 149/291 (51.20%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTS----KLIENDTI--CKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++  + Y  I +L VVGN +VI V+  F T+ +VTN F+ NL ++DL++    +P  +      E W FG  LC  +P+ QG  V +   T  +++ DR   + Y L  R+SK     +I+  W ++   +SPL IF       L  +++I  C E W  S   + +Y+IS L+ QY +P+  +I F    ++     HV  +        R   + K  KM++T+  ++ +S LP H   L +I  + S L  ++ R+L+    +++  S+  NP++Y WMN  Y
Sbjct:   40 LLGVQVVLILAYSTIILLGVVGNSLVIYVVYKFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLRE-WKFGQVLCFTLPYAQGLAVHVSTITLNVIALDRHRCIVYHLDTRMSKDTCFLVIAITWVVSAVLASPLAIFREYGIVDLSPDNSIEVCGEKWPDSSTDSTLYSISTLLLQYVLPLA-IISFAYIRIWSKLRNHVSPVGRN----DRHHRRRKTTKMLVTMVVVFAVSWLPFHAFQL-AIDIDHSVLDMKDFRLLYTVFHIVAMCSTFANPLLYGWMNRNY 323          
BLAST of GCR477 vs. Ensembl Xenopus
Match: taf1b (TATA-box binding protein associated factor, RNA polymerase I, B [Source:Xenbase;Acc:XB-GENE-992275])

HSP 1 Score: 119.013 bits (297), Expect = 3.216e-30
Identity = 88/295 (29.83%), Postives = 152/295 (51.53%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIEND--------TICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVY-KMWFR---HV-PGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++    Y +I +L +VGN +VI  ++ Y    +VTN F+ NL ++DL++    +P  +V     E W FGS LC + P+ Q   V++   T ++++ DR+  + + L  RISK  +  IIS  W  A   + PL    +    D         +C E W+   + IY++S+LI QY +P+  +     C  Y ++WF+   H+ P   S+ Q  QR K+  K+L M++ +   + +  LP HI  L +I  E +    +NK +L+    +++  S+  NP +Y WMN  Y
Sbjct:   35 LVGVQVILIAAYSLIILLGLVGNSLVIYMIVKYKNMRTVTNFFIANLAIADLMVDSFCLPFTLVYTLMDE-WKFGSVLCHLFPYAQAMSVNVSTLTLIVIALDRYWCIVFHLNSRISKNLSFLIISITWITAAILAIPLAVFREFRYEDLPPFNLKIAVCAENWTNRDSTIYSLSMLILQYALPLAVI-----CYAYLRIWFKLKNHISPTTRSESQ--QRRKNTTKMLVMMVVV---FAVCWLPFHIFQL-AIDLEWTVAIHENK-LLYTIFHVVAMCSTFVNPFLYGWMNKNY 316          
BLAST of GCR477 vs. Ensembl Xenopus
Match: ENSXETT00000055164.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:94597725:94599032:-1 gene:ENSXETG00000019952.1 transcript:ENSXETT00000055164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 9.333e-28
Identity = 85/294 (28.91%), Postives = 153/294 (52.04%), Query Frame = 1
Query:   13 LAMIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLI-NLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDT------ICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNK-RILWICVILLSASSSCYNPIIYFWMNTTY 864
            L ++ +L  LF  +Y ++  +A +GN  +I +I++   +  T  FLI NL L+DL++ I  +P+       +  W+FG F+C  +  +Q   V +   +   ++ DR+VVV YP++ RI  +  I I+S VW +++  S P  F +  ++  +      IC+E W   + Q  +Y+ SLL+  Y +P+  + I Y  I Y +  R+VPG  S  Q  +  K K+K  +M+      + +  LP  I+ L    +E   +  +N   ++ +   L++ SS+CYNP IY  ++  +
Sbjct:   17 LDLLFDLKPLFIPIYALLVTVACLGNCALILLIAFTKKLHNTTNFLIGNLALADLVMCIFCVPLTASYAFENRGWLFGEFMCHFVTLMQAATVCVSVLSLTAIAVDRYVVVVYPIRRRIGCRSCIYIVSLVWLVSIGISMPTFFHTHYLDLKSAGHDMIICEEFWRNQEKQRLLYSCSLLLLYYMLPLSAITISYCAIAYHLRKRNVPGATSHNQ-DKWSKKKQKTFRMLSISVMAFGICWLPLQILNLIRDIDEEFAILDKNYINVIQVTCHLIAMSSACYNPFIYASLHDKF 309          
BLAST of GCR477 vs. Ensembl Xenopus
Match: ENSXETT00000044281.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:115219157:115249407:-1 gene:ENSXETG00000019365.1 transcript:ENSXETT00000044281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 4.206e-26
Identity = 79/285 (27.72%), Postives = 137/285 (48.07%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLI----ENDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVIL---LSASSSCYNPIIYFWMNTTY 864
            LF   Y ++ ++ + GN +++ VI     + +VTN F+ NL  SD+++  T +P  +      + WVFG F+C  +  +Q   V +  FT   ++ DR+    +PLK RIS    I ++  +W ++     P I  +  +    E  TIC+E W   + +   Y  S LI  Y +P+  + + Y CI  K+  R VPG  +Q Q       K K+ ++++ +   + +  LP H+  +  I +   NL   NK       +     + SSSC NP +Y W++  +
Sbjct:   36 LFIPCYTLVVLIGIFGNYLLLYVICRTRKMHNVTNFFIGNLAFSDMLMCATCVPFTLAYAFNPQGWVFGKFMCYFVFLMQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISVTTCIYVLMGIWLLSCALVGPAIAHTYHVEFQQEGFTICEEFWMGKETERLAYAYSTLIITYILPLSAVSLSYICITVKLKNRVVPGHPTQSQAEFDRLRKRKIFRLIVLVVTAFGICWLPIHVFNI--IRDIDINLI--NKHYFLHIQLFCHWFAMSSSCCNPFLYAWLHDRF 316          
BLAST of GCR477 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 107.071 bits (266), Expect = 7.555e-26
Identity = 78/289 (26.99%), Postives = 149/289 (51.56%), Query Frame = 1
Query:   10 KLAMIIELNILFTIVYCIIFILAVVGNVMVITVI--SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKF--AIAIISCVWFIALCSSSPLIFTSKLI--ENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSIT-----NESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
             L++    +I+  +++ +IF+L  VGN +V+ V+  S   T + TN+F++NL ++D+   I  +P      +  E WVFG+F+C+ + F     +   +FT   +S DR++ + YPL+ R  +    AIA ++ +W +++  + P +    L+  E+  IC   W     +I      I  Y IPV  + + Y+  +  +W      +   +   +  K+K K+ KM+I ++ L+ L  LP H++ +C +      N+++  F    R+L  C   ++ ++SC NPI+Y
Sbjct:   18 DLSLFSPASIVVPVIFSLIFLLGTVGNSLVLAVLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSL-EDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYLSYYDLMDYESSHICMPGWKERTRKIMDTGTFIVGYVIPVLIVSLSYTRTIKYLW----TAVDPLEDMSESKKAKRKVTKMIIIVTVLFCLCWLPHHVVVMCYLYGDFPFNQATYAF----RLLSHC---MAYANSCLNPIVY 294          
BLAST of GCR477 vs. Ensembl Xenopus
Match: slc11a2 (solute carrier family 11 member 2 [Source:Xenbase;Acc:XB-GENE-487563])

HSP 1 Score: 107.842 bits (268), Expect = 1.003e-25
Identity = 84/299 (28.09%), Postives = 158/299 (52.84%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSKL-IENDTI-------CKETW-SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQR------IKSKEKLLKMVITISFLYTLSQLPRHIIYL----CSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             I F  +  +IF+LA+ GN +V+ V++    + +VTNIF+ +L LSDL++A   IP  ++  N S  W+ G+F C+M+PF+Q T +     T   ++ +R   + +PLK++   + + A  ++  VW IA     P+    +L ++ D +       C E W S +  +IYT  +L+  + +P+  M++ YS I Y++W +   G  S  Q I         + K++ + M+IT+  L+ +   P H++++     +  NE  ++     +I++  V ++   +S  NPI+Y +MN  +
Sbjct:   79 KIAFVTICVLIFVLALFGNSLVLYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPFTML-QNISSNWLGGAFACKMVPFVQSTAIVTEILTMTCIAVERHQGIVHPLKMKWQYTNRRAFTMLGIVWLIAAVVGIPMWHAQRLEVKYDFLYEKQYVCCLEAWNSQVHQKIYTTFILVILFLLPLTVMLLLYSKIGYELWIKKRVGDASVLQTIHGSEMSKIARKKKRAIIMMITVVVLFAVCWAPFHVVHMMIEYSNFENEYDDV---TIKIIFAIVQIIGFFNSICNPIVYAFMNENF 373          
BLAST of GCR477 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 118.242 bits (295), Expect = 5.228e-30
Identity = 85/293 (29.01%), Postives = 151/293 (51.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTS-KLIE-----NDTICKETW----SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++E+ ++  + YC I +L VVGN +VI V+  F ++ +VTN F+ NL ++DL++    +P  +      E W  G  LC ++P+ QG  V +   T  +++ DR   + Y L+ +ISK+ +  II   W I+   +SPL IF    LIE         C E W      +   +Y++S L+  Y +P+G +   Y+ I  K+     PG  S     +R     K+ KM++ +  ++ +S LP H   L ++  +S  L  +  ++++    +++  S+  NP++Y WMN+ Y
Sbjct:   46 LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGE-WKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRR----HKMTKMLVCVVVVFAVSWLPLHAFQL-AVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNY 332          
BLAST of GCR477 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 118.242 bits (295), Expect = 5.228e-30
Identity = 85/293 (29.01%), Postives = 151/293 (51.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTS-KLIE-----NDTICKETW----SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++E+ ++  + YC I +L VVGN +VI V+  F ++ +VTN F+ NL ++DL++    +P  +      E W  G  LC ++P+ QG  V +   T  +++ DR   + Y L+ +ISK+ +  II   W I+   +SPL IF    LIE         C E W      +   +Y++S L+  Y +P+G +   Y+ I  K+     PG  S     +R     K+ KM++ +  ++ +S LP H   L ++  +S  L  +  ++++    +++  S+  NP++Y WMN+ Y
Sbjct:   46 LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGE-WKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRR----HKMTKMLVCVVVVFAVSWLPLHAFQL-AVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNY 332          
BLAST of GCR477 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 118.242 bits (295), Expect = 5.228e-30
Identity = 85/293 (29.01%), Postives = 151/293 (51.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTS-KLIE-----NDTICKETW----SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++E+ ++  + YC I +L VVGN +VI V+  F ++ +VTN F+ NL ++DL++    +P  +      E W  G  LC ++P+ QG  V +   T  +++ DR   + Y L+ +ISK+ +  II   W I+   +SPL IF    LIE         C E W      +   +Y++S L+  Y +P+G +   Y+ I  K+     PG  S     +R     K+ KM++ +  ++ +S LP H   L ++  +S  L  +  ++++    +++  S+  NP++Y WMN+ Y
Sbjct:   46 LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGE-WKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRR----HKMTKMLVCVVVVFAVSWLPLHAFQL-AVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNY 332          
BLAST of GCR477 vs. Ensembl Mouse
Match: Galr2 (galanin receptor 2 [Source:MGI Symbol;Acc:MGI:1337018])

HSP 1 Score: 113.62 bits (283), Expect = 2.360e-28
Identity = 80/283 (28.27%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   37 ILFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLI--FTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVP---GIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLC------SITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            +L  + + +IF++  VGN +V+ V+      VS TN+F++NL ++DL   +  +P         + WVFGS LC+ + F+    +   +FT   +S DR++ + YPL  R   + + A+A I  +W +AL  S P +  ++   + N T+C   WS  + +   +   +F Y +PV  + + Y+  ++ +W    P   G  SQ       ++K K+ +M++ ++ L+ L  +P H + LC       +T  +  L     RIL     L+S ++SC NPI+Y
Sbjct:   25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDD-WVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQ-------RAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYAL-----RIL---SHLVSYANSCVNPIVY 291          
BLAST of GCR477 vs. Ensembl Mouse
Match: Tacr2 (tachykinin receptor 2 [Source:MGI Symbol;Acc:MGI:98477])

HSP 1 Score: 110.538 bits (275), Expect = 4.324e-27
Identity = 76/284 (26.76%), Postives = 145/284 (51.06%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLI--ENDTICKETWSPIKNQ-----IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQN-KRILWICVILLSASSSCYNPIIYFWMNTTY 864
            L+   Y  + ++AV GN  VI +I ++    +VTN F+INL L+DL +A  N   N +  +    W FGS  C        T + +  ++   ++ DR++ + +P + R+S     A+I+ +W +AL  +SP  F S +   +  T C   W P  N      +Y + + +  YF+P+  M   YS I   +W R VP   +    ++ +++K+K +K ++ +   + +  LP H+ ++     E  +++++   + +++ +  L+ SS+ YNPIIY  +N  +
Sbjct:   35 LWATAYLALVLVAVTGNATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFNFIYAS-HNIWYFGSTFCYFQNLFPVTAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATKCVVAW-PNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLRHLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQE--DIYYRKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRF 314          
BLAST of GCR477 vs. UniProt/SwissProt
Match: sp|P25931|RYAR_DROME (RYamide receptor OS=Drosophila melanogaster OX=7227 GN=RYa-R PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 6.190e-39
Identity = 92/289 (31.83%), Postives = 156/289 (53.98%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE---------NDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             I+  ++Y  IFI A++GN  V  ++ S     +VTN F+ +L + D++++   +P + ++      W FG  LC  + + Q   V + A+T V +S DR++ + +PLK RI+K++A  II+ VWFIAL ++ P+   S L              IC+E W P + Q   YT+SL   Q+ +P+G +I  Y+ I  ++W +  PG     +  +  +SK K++KM++T+  ++T   LP +I+ L  + N+     W     +W     L+ S  CYNPIIY +MN  +
Sbjct:  105 KIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMW-PSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQL--LLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARF 390          
BLAST of GCR477 vs. UniProt/SwissProt
Match: sp|Q59E83|NPR22_CAEEL (Neuropeptide receptor 22 OS=Caenorhabditis elegans OX=6239 GN=npr-22 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.385e-34
Identity = 95/300 (31.67%), Postives = 167/300 (55.67%), Query Frame = 1
Query:   28 ELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVN----IVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPL--KVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTI---CKETWSPIKN------QIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIY---SQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNE--SSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             + +L  + Y I+ +  V GNV+VI VI YF  + + TNI ++NL ++DL++++  IP +    ++ D+  + W+FGS +C ++ F+Q   V L A+T V++S DR++ + + L   +RI+++ A+ +++  W  ++  + PL+FT++  E+      C E W+   +      ++Y+  +LI QY +P   +II Y+ I  KMW   VPG+    +++  + R +S +KL+ MVI IS L+ L  LP  ++ L ++  E       W     LW     L+ S S  NPIIYF  N  +
Sbjct:   48 SMKMLCILFYSILCVCCVYGNVLVILVIVYFKRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDD--QRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFEDQDGLPNCGENWTYFGDSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLP--LLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARF 343          
BLAST of GCR477 vs. UniProt/SwissProt
Match: sp|G4WMX4|RYAR_TRICA (RYamide receptor OS=Tribolium castaneum OX=7070 GN=RYa-R PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 3.501e-33
Identity = 91/289 (31.49%), Postives = 158/289 (54.67%), Query Frame = 1
Query:   52 VYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDT-------------ICKETWSPIKNQ---IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRI-KSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            +Y IIF++A++GN  V   V+S     +VTN F++NL + D+++ +  +P   V+    + W FG  LC ++ + Q   V + A+T V +S D+++++ +PLK RISK+FA  II+ VW IA  +  P    + LI ++              IC E +S +  +   +YT  L+  QY IP   ++  Y+ I   +W   +PG  ++    QRI K+K K++KM++T+  +YT+  LP +++ +       S + +     L+  +  L+ S +CYNPIIY +MN  +
Sbjct:   36 MYAIIFVVALIGNSFVCYIVLSSPPMRTVTNFFILNLAIGDVLITLLCVPFTSVSL-LMQYWPFGGILCPVVNYSQALSVFVSAYTLVAISIDKYMIIMWPLKPRISKRFATYIIALVWLIAGITVLPSATFTTLINDENILGTSAYEQCDKYICAEEYSKVGQEYGDLYTKVLMFLQYVIPSLVLLFTYTSIGVVIWCHRIPG-EAENSRDQRIAKNKTKMIKMMVTVVCVYTICWLPYNVLMIFKEHISGSVMVY-----LYFPLHGLAMSHACYNPIIYCYMNARF 317          
BLAST of GCR477 vs. UniProt/SwissProt
Match: sp|Q96P65|QRFPR_HUMAN (Pyroglutamylated RF-amide peptide receptor OS=Homo sapiens OX=9606 GN=QRFPR PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 6.193e-30
Identity = 87/307 (28.34%), Postives = 163/307 (53.09%), Query Frame = 1
Query:    1 YAFKLAMIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSK-------LIENDTI-CKETW-SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQR------IKSKEKLLKMVITISFLYTLSQLPRHIIYLC-SITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            Y  +L    +L ++ T V  +IF LA+ GN +V  V++    + +VTNIF+ +L LSDL++    IPV ++  N S+ W+ G+F+C+M+PF+Q T V     T   ++ +R   + +P K++   + + A  ++  VW +A+   SP+    +       L E + I C E W SP+  +IYT  +L+  + +P+  M+I YS I Y++W +   G  S  + I         + K++ + M++T+  L+ +   P H++++    +N          ++++  V ++  S+S  NPI+Y +MN  +
Sbjct:   36 YTPELPGRAKLALVLTGV--LIFALALFGNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQ-NISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSNFEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENF 339          
BLAST of GCR477 vs. UniProt/SwissProt
Match: sp|F1R332|GAL2A_DANRE (Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr2a PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.587e-29
Identity = 83/276 (30.07%), Postives = 144/276 (52.17%), Query Frame = 1
Query:   34 NILFTIVYCIIFILAVVGNVMVITVI--SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISK--KFAIAIISCVWFIALCSSSPLI--FTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            +++ ++++ +IF++  VGN +V+ V+  +  M    TN+F++NL L+DL   +  +P+        E WVFG+F+C+ + FI    +    FT   +S DR++ + YPL+ R ++  + A+  IS VW ++L  SSP +  +    ++  T+C   WS    Q   I   IF Y IPV  + I Y+  +  +W    P     Q   +  K+K K+ KM+I ++ L+ L  LP H++ LC               +L I   L++ ++SC NPI+Y
Sbjct:   18 SVIISLIFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDE-WVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTFIFGYLIPVLILGITYARTIRYLWTSVDP----MQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFP--LNHTTYVLRILSHLVAYANSCLNPIVY 286          
BLAST of GCR477 vs. TrEMBL
Match: A0A193KUH2 (GCR477 OS=Schmidtea mediterranea OX=79327 GN=gcr477 PE=2 SV=1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 317/317 (100.00%), Postives = 317/317 (100.00%), Query Frame = 1
Query:   19 MIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTYXXXXXXXXXXXXXXYVNTVNRFDISQYRSDANMSF 969
            MIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTYRKLLRRIFRLRGLRYVNTVNRFDISQYRSDANMSF
Sbjct:    1 MIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTYRKLLRRIFRLRGLRYVNTVNRFDISQYRSDANMSF 317          
BLAST of GCR477 vs. TrEMBL
Match: A0A193KUC0 (GCR097 OS=Schmidtea mediterranea OX=79327 GN=gcr097 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.153e-100
Identity = 147/278 (52.88%), Postives = 210/278 (75.54%), Query Frame = 1
Query:   31 LNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            L+I  T +  ++  LA+ GN++VI ++  F  ++VTNIFL+NL +SD+I+A+T+IP NI+ DNW+  W+FG  LC+++ FIQGTG+SL+AFTQV++S DRF++VFYPL+ R+ +++A+ +I  VW +++ S+SPLI+ S L  N+T+C+E+WS   N +Y+I +L  QYF+PV CMI+ Y  IV K+W +  PGI+S+QQ   R +SKEKLLK VITIS LYTL+QLPRH++YLCS++     LFW NKR LW+ V  LS S+SCYNPIIYF +N  Y
Sbjct:    8 LSITMTSLNTLVLALAIPGNILVILILVRFQRLTVTNIFLLNLSVSDMIIALTSIPFNIIIDNWTPVWIFGKVLCKLLGFIQGTGISLVAFTQVVISIDRFIIVFYPLRPRMKQRWALTVIIIVWLLSMSSNSPLIYISTL-YNNTLCRESWSDKTNTLYSILMLFVQYFLPVCCMIVSYVMIVIKIWCKINPGIFSRQQLQLRARSKEKLLKTVITISLLYTLAQLPRHVMYLCSLSYTDKRLFWSNKRTLWLAVSCLSTSASCYNPIIYFCINPKY 284          
BLAST of GCR477 vs. TrEMBL
Match: A0A068Y1G9 (Neuropeptide Y receptor OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 9.583e-62
Identity = 113/282 (40.07%), Postives = 177/282 (62.77%), Query Frame = 1
Query:   31 LNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSKLIEN-DTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYL-CSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            + +  ++ Y  + I+A++GN +V  VI  ++  SVTNIFL NL ++D++  +  IP+  + D W   W FG+ +C+++PFIQ   V+L AFT V++S DRF++VF PL+ R  ++ + A  II  +W  A   ++PL     L E  +  C+E+W   ++Q+YT +L++ QYFIP+  +I  YS I +K+    V G  S  +    ++SK K++KM+I +S LY +SQLPRH+IYL  ++ N  S    ++  I W  V+LLS+S+SCYNP IY WMN TY
Sbjct:    1 MKLGMSLPYIPLMIIALIGNSLVCYVIHRYLQNSVTNIFLFNLSVTDILSTLAVIPMTAIADIWLNHWPFGATMCKLVPFIQCLTVTLTAFTHVLISCDRFLIVFRPLQRRRLLTPRRAKFIIILLWLTACIQATPLAVVGYLPEGANARCEESWDAHRSQVYTTTLMVMQYFIPLILLICSYSVICWKLNSTQVGGAISASRSRMAVRSKRKMVKMMIAVSALYAISQLPRHVIYLYGTVVNWGS----RDLAIAWTFVVLLSSSASCYNPFIYAWMNQTY 278          
BLAST of GCR477 vs. TrEMBL
Match: A0A0R3VXA2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS2047 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 9.625e-62
Identity = 112/284 (39.44%), Postives = 178/284 (62.68%), Query Frame = 1
Query:   25 IELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSKLIEN-DTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYL-CSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            + + +  ++ Y  + I+A++GN +V  VI  ++  SVTNIFL NL ++D++  +  IP+  + D W   W FG+ +C+++PFIQ   V+L AFT V++S DRF++VF PL+ R  ++ + A  +I  +W  A   ++PL     L E  +  C+E+W   ++Q YT +L++ QYFIP+  +I  YS I +K+    V G  S  +    ++SK K++KM+I +S LY +SQLPRH+IYL  ++ N +S    ++  I W  V+LLS+S+SCYNP IY WMN TY
Sbjct:   27 LGMKLGMSLPYIPLMIIALIGNSLVCYVIHRYLQHSVTNIFLFNLSVTDILTTLAVIPMTAIADIWLNHWPFGATMCKLVPFIQCLTVTLTAFTHVLISCDRFLIVFRPLQRRRLLTPRRAKFLIILLWMTACIQATPLAVVGYLPEGANARCEESWDAHRSQAYTTTLMVMQYFIPLTLLICSYSVICWKLNSTQVGGAISASRSRMAVRSKRKMVKMMIAVSALYAISQLPRHVIYLYGTVVNWAS----RDLAIAWTFVVLLSSSASCYNPFIYAWMNQTY 306          
BLAST of GCR477 vs. TrEMBL
Match: A0A068WKU9 (Neuropeptide Y receptor OS=Echinococcus granulosus OX=6210 GN=EgrG_000598600 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.772e-61
Identity = 113/282 (40.07%), Postives = 177/282 (62.77%), Query Frame = 1
Query:   31 LNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR--ISKKFAIAIISCVWFIALCSSSPLIFTSKLIEN-DTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYL-CSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            + +  ++ Y  + I+A++GN +V  VI  ++  SVTNIFL NL ++D++  +  IP+  + D W   W FG+ +C+++PFIQ   V+L AFT V++S DRF++VF PL+ R  ++ + A  II  +W  A   ++PL     L E  +  C+E+W   ++Q+YT +L++ QYFIP+  +I  YS I +K+    V G  S  +    ++SK K++KM+I +S LY +SQLPRH+IYL  ++ N  S    ++  I W  V+LLS+S+SCYNP IY WMN TY
Sbjct:    1 MKLGMSLPYIPLMIIALIGNSLVCYVIHRYLQNSVTNIFLFNLSVTDILSTLAVIPMTAIADIWLNHWPFGATMCKLVPFIQCLTVTLTAFTHVLISCDRFLIVFRPLQRRRLLTPRRAKFIIILLWLTACIQATPLAVVGYLPEGANARCEESWDAHRSQVYTTTLMVMQYFIPLILLICSYSVICWKLNSTQVGGAISVSRSRMAVRSKRKMVKMMIAVSALYAISQLPRHVIYLYGTVVNWGS----RDLAIAWTFVVLLSSSASCYNPFIYAWMNQTY 278          
BLAST of GCR477 vs. Ensembl Cavefish
Match: prlh2r (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103044274])

HSP 1 Score: 119.783 bits (299), Expect = 1.324e-30
Identity = 77/297 (25.93%), Postives = 144/297 (48.48%), Query Frame = 1
Query:   10 KLAMIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLI-NLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFT------SKLIENDTICKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRI--KSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNK-RILWICVILLSASSSCYNPIIYFWMNTTY 864
             L +++EL  LF  +Y I+ ++A  GN+ ++ +IS    +  T  FLI NL L+DL++ +  +P+ +        WVFG F+CR +  +Q   V     +   ++ DR+VVV YP++ R  + F   ++  +W  AL  S+P          S    +  +C+E W    +   IY+   L+  YF+P+  + I Y  I + +  R  PG+ +     Q    + + K  ++++     +  S LP  ++ L    +    +  +N   ++ +   LL+ SS+C+NP IY  ++  +
Sbjct:   28 GLDLLMELKPLFVPLYAILVLVACSGNLFLLFLISVNRKMHSTTNFLIGNLALADLVMCLFCVPLTVFYAFDERGWVFGHFMCRFVTLMQTATVFAAVLSLTAIAVDRYVVVAYPIRRRGGRHFCAGLVLGIWLCALVMSTPAALHTVYLDLSATGHHMAVCEEFWQGQELGRLIYSCFFLLLSYFVPLAAVTISYCAISHHLRRRAGPGLMAAIPSNQEKWGRKRRKTFRLLLVSVLCFAFSWLPLQVVNLIRDLDTDFIILSKNHINVIQVSCHLLAMSSACFNPFIYASLHDKF 324          
BLAST of GCR477 vs. Ensembl Cavefish
Match: npy2rl (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103047056])

HSP 1 Score: 118.242 bits (295), Expect = 4.779e-30
Identity = 90/291 (30.93%), Postives = 151/291 (51.89%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTSKLI------ENDTICKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++  + Y  I +L VVGN +VI V+  F T+ +VTN F+ NL ++DL++    +P  +      E W FG  LC  +P+ QG  V +   T  +++ DR   + Y L+ R+SK     II+  W I+   +SPL IF    +      E+  +C E W  S     +Y+IS+L+ QY +P+  +   Y  I  K+   HV       +   R + + K  KM++T+  ++ +S LP H   L +I  +SS L  ++ R+L+    +++  S+  NPI+Y WMN  Y
Sbjct:   40 LLGVQVILILAYSTIILLGVVGNSVVIYVVCRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLGE-WKFGQVLCFTLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMSKDTCFLIIAITWVISAVLASPLAIFREYGMVELSPGESIEVCGEKWPGSSTDGTLYSISMLLLQYVLPLAVISFAYIRIWSKLR-NHV----GPAERNDRHRRRRKTTKMLVTMVVVFAVSWLPFHAFQL-AIDIDSSVLVMRDFRLLYTVFHIVAMCSTFANPILYGWMNRNY 323          
BLAST of GCR477 vs. Ensembl Cavefish
Match: npy2rl (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103047056])

HSP 1 Score: 118.242 bits (295), Expect = 4.779e-30
Identity = 90/291 (30.93%), Postives = 151/291 (51.89%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTSKLI------ENDTICKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++  + Y  I +L VVGN +VI V+  F T+ +VTN F+ NL ++DL++    +P  +      E W FG  LC  +P+ QG  V +   T  +++ DR   + Y L+ R+SK     II+  W I+   +SPL IF    +      E+  +C E W  S     +Y+IS+L+ QY +P+  +   Y  I  K+   HV       +   R + + K  KM++T+  ++ +S LP H   L +I  +SS L  ++ R+L+    +++  S+  NPI+Y WMN  Y
Sbjct:   40 LLGVQVILILAYSTIILLGVVGNSVVIYVVCRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLGE-WKFGQVLCFTLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMSKDTCFLIIAITWVISAVLASPLAIFREYGMVELSPGESIEVCGEKWPGSSTDGTLYSISMLLLQYVLPLAVISFAYIRIWSKLR-NHV----GPAERNDRHRRRRKTTKMLVTMVVVFAVSWLPFHAFQL-AIDIDSSVLVMRDFRLLYTVFHIVAMCSTFANPILYGWMNRNY 323          
BLAST of GCR477 vs. Ensembl Cavefish
Match: npy2rl (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103047056])

HSP 1 Score: 117.857 bits (294), Expect = 5.714e-30
Identity = 90/291 (30.93%), Postives = 151/291 (51.89%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IFTSKLI------ENDTICKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++  + Y  I +L VVGN +VI V+  F T+ +VTN F+ NL ++DL++    +P  +      E W FG  LC  +P+ QG  V +   T  +++ DR   + Y L+ R+SK     II+  W I+   +SPL IF    +      E+  +C E W  S     +Y+IS+L+ QY +P+  +   Y  I  K+   HV       +   R + + K  KM++T+  ++ +S LP H   L +I  +SS L  ++ R+L+    +++  S+  NPI+Y WMN  Y
Sbjct:   43 LLGVQVILILAYSTIILLGVVGNSVVIYVVCRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLGE-WKFGQVLCFTLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMSKDTCFLIIAITWVISAVLASPLAIFREYGMVELSPGESIEVCGEKWPGSSTDGTLYSISMLLLQYVLPLAVISFAYIRIWSKL-RNHV----GPAERNDRHRRRRKTTKMLVTMVVVFAVSWLPFHAFQL-AIDIDSSVLVMRDFRLLYTVFHIVAMCSTFANPILYGWMNRNY 326          
BLAST of GCR477 vs. Ensembl Cavefish
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 115.546 bits (288), Expect = 5.251e-29
Identity = 81/291 (27.84%), Postives = 150/291 (51.55%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPL-IF----TSKLIENDTI--CKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            +I + ++  + Y  I +  V GN +VI V+  F  + +VTN F++NL ++DL++    +P  ++   + E W FG  +C ++P+ QG  V++   T  I++ DR+  + + ++ ++SK     +I+  W  +   +SPL IF    T  L    +I  C E W  S     +Y+IS+   QY +P+  +   Y+ I  K+     PG         R + ++K  KM+  +  ++ +S LP H   L ++  +SS L  ++ ++L+    +++  S+  NPI+Y WMN  Y
Sbjct:   52 LIGVQVILILAYSSIILFGVTGNALVIYVVYKFRNLHTVTNFFIVNLAVADLLVNTLCLPFTLMYTLYGE-WKFGQAMCYLLPYAQGLAVNVSTITLNIIALDRYRSIVHHMETKMSKDVCAVVIAVTWVASAVLASPLAIFREYVTFDLTPEQSIQGCAEKWPGSSTDGTVYSISMFFLQYGLPLSVISFAYARIWTKLRKHISPGGGRS----DRHRRRQKTTKMLAVVVAVFAVSWLPFHAFQL-AVDIDSSVLEMKDYKLLYTVFHIVAMCSAFANPILYGWMNRNY 336          
BLAST of GCR477 vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 120.939 bits (302), Expect = 5.817e-32
Identity = 79/295 (26.78%), Postives = 159/295 (53.90%), Query Frame = 1
Query:   31 LNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPL--KVRISKKFAIAIISCVWFIALCSSSPLIFTSKL--------IENDTICKETWSPIKN-QIYTISLLIFQYFIPVGCMIIFYSCIVYKMWF--RHVPGIYS--QQQCIQRI-KSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            L + F +V  ++F LA+ GN +VI V++    + +V N+F+ +L +SDL++ +  IP+ ++  N+   W+ G  LC+++PFIQ T V+    T   ++ +RF  + +PL  + R +   A +++  VW + LC ++P+ +   +          + T C E WS  ++ Q YT +LL+  + +P+  M   Y+ + +++W   R    +++  Q+  I +I +SK++ +KM++ +  L+ +   P H++    +   +  + +  + I    V L   S+S +NPI+Y  +N  Y
Sbjct:   44 LRLAFAVVGALVFTLALSGNALVIFVVARRKALHTVANVFVCSLAVSDLMITVFCIPITLM-QNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCGVWLVGLCVAAPMFYAHTVQVTYDVLYDVSHTGCSEQWSHAEHRQAYTTTLLLVTFVLPLLTMTALYTRLAHELWVKTRVHDAVFNALQRSEINKITRSKKRAVKMMVIVVILFAVCWAPFHVVN-SLVPKGNLEMSFDMEAITLAMVQLFGFSNSLWNPIVYAALNQNY 336          
BLAST of GCR477 vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 101.679 bits (252), Expect = 4.595e-25
Identity = 75/290 (25.86%), Postives = 145/290 (50.00%), Query Frame = 1
Query:   19 MIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE----NDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHII-YLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            +I  L     + Y  + ++ V+GN +++ VI     + +VTN+ + NL  SDL++    +P+ +     +  WVFGSF+C  +  +Q   V +  FT  +++ DR++V  YPL+ RI+      +++ +W  A   ++P +  +   E      TIC+E W   + +   Y  S L+  Y +P+  + + Y  I  K+  R VPG  +Q Q       + K  ++++ +   +++  LP HI  +L  +     + ++ N  ++ +     + SS+CYNP IY W++  +
Sbjct:   16 LIRTLKPFVVLFYTAVVVVGVLGNFLLVYVICRVKKMHNVTNLLIGNLAFSDLLMCAMCVPLTLAYVFDARGWVFGSFMCYFVFLMQPVSVYVSVFTLTVIAVDRYIVTVYPLRRRITIPTCGYLLAAIWVTACALAAPALAHTYYCEFPEQRMTICEEFWIGTERERLAYAYSTLVLTYGLPLLVISLSYFKISVKLKNRVVPGTVTQNQAEMDRARRRKTFRLLVLVVTAFSVCWLPLHIFNFLRDVDIRLIDKYYFN--LVQLLCHWFAMSSACYNPFIYAWLHDRF 303          
BLAST of GCR477 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008040.1 (pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-1 gene:ENSPMAG00000007251.1 transcript:ENSPMAT00000008040.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 7.284e-25
Identity = 80/289 (27.68%), Postives = 150/289 (51.90%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIV----NDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE--NDTICKETWSPIKNQ-----IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRI--LWICVILLSASSSCYNPIIYFWMNTTY 864
            L+++ Y  I  +A  GN++VI  V+++    +VTN FL+NL ++D  +A  N  +N V    ND     W FG   CR   FI    V    ++   ++ DR++ + +PLK R++ +    +++ +W +A+C S PL   S++ +     +C   W P K       IY + ++   Y  P+  M + Y+ +   +W   +PG  S +   ++++SK K++KM+I +   + +  +P H+ +L      + N  +  K I  +++ +  L+ SS+ YNPIIY  +N+ +
Sbjct:   59 LWSVAYGGIVAVAFFGNMVVIWIVVAHRRMRTVTNYFLVNLAVADSAMAALNTSINFVYAVHND-----WYFGGAYCRFQNFIPVAAVFASIYSMTAIAVDRYMAIRHPLKPRMTAQSTRLVMAGIWALAMCLSLPLSIYSRVEQRFGRFVCLVDW-PGKMGGDSQFIYQLVVMTLVYVFPLLVMAVTYTIVGVTLWGGTIPGD-SSEHFREQLRSKRKVVKMMIVVVVTFAVCWMPYHVYFLL---GRTLNRIYHRKYIQQVYLAIFWLAMSSTMYNPIIYCCLNSRF 337          
BLAST of GCR477 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 99.3673 bits (246), Expect = 4.977e-24
Identity = 88/306 (28.76%), Postives = 148/306 (48.37%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMV-ITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIAL---CSSSPLIFTSKLIE----------NDTI----CKETW-SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKM----------WFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPR-HIIYLCSITNESS-NLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ I Y  IF+L ++GN +V   V+      +VTN+F++NL +SDL++ I  +P+ +V DN    W FG  +C+M   +QGT VS   FT V ++ DRF  + YP K ++    A+  I  +W +AL   C S+ L+ T+++            NDT     C E W  P   + YT  L    Y  P+  +++ Y+ I +++               P            + + K++KM+I ++ L+ LS LP   ++ L    N S  +L + N  +  +   L   +SS  NPI+Y + N  +
Sbjct:   51 VYLIAYLFIFLLCMIGNGLVCYVVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLV-DNLITGWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALALSIMCPSA-LMLTAEVSRGHYMVYSDGSNDTHPLHQCWEAWPDPRMRKAYTTVLFANVYLAPLALILLMYARIGFRLCSLSASAAAAASAAAPSRGGGGGATGVTRRRVKVIKMLIIVAMLFMLSWLPLWTVMMLVDYANLSPWDLAFLNMYVYPVAHWLAFFNSSV-NPIVYGYFNENF 353          
BLAST of GCR477 vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 98.9821 bits (245), Expect = 7.753e-24
Identity = 68/286 (23.78%), Postives = 143/286 (50.00%), Query Frame = 1
Query:   19 MIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLI----ENDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRI--KSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKR--ILWICVILLSASSSCYNPIIY 843
            +++ L  +F  +Y ++ ++ V GN+++I VI+    + + TN  L NL LSDL++ +T +P++         WV+G+ LC ++  +Q   V +   +   ++ DR+VVV YP++ R++ +        +W  +   + P    +  I    E   +C+E W+ +++Q   Y+ +++I  Y +P+  +   Y  I   +  R  PG        +R   + + K  ++++     + L  LP  ++YL  + + +      N+   ++ +C   ++ SS+C+NP IY
Sbjct:   62 VLLSLKQIFIPLYALLTLVGVSGNLLLILVIARTKRLHNATNFLLGNLALSDLLVCLTCVPISAAFAFEPRGWVYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVAVRSCALTAGFIWIASAALACPAALNTVYIDFRTEEPQVCEELWTGLEDQRLAYSCAMMIVSYLLPLLAVSASYCAISLTLRGRVPPGGAHCTVNARRTWHQKRRKTFRLLVMSVGTFALCWLPLQLVYLFRLKDPTCT---PNEHFYVIQLCCHWVAMSSTCWNPFIY 344          
BLAST of GCR477 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 136.346 bits (342), Expect = 4.239e-38
Identity = 87/282 (30.85%), Postives = 145/282 (51.42%), Query Frame = 1
Query:   49 IVYCIIFILAVVGNVMVI-TVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSP-----IKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHII----YLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            + Y  I  L++VGN +VI TV       SVTN+F+ NL  SDL++    +P  I  + ++  W+FG+ LC+++ ++Q   V     T + ++ DRFV + +P + R+S K A  II  +W ++L   +PLI+ +K+  N   C E W+P        + YT+ L +  Y +P+  M + Y+ IV K+W R   G        +   S++K++KM+IT+  L+T S LP H+     +      ++SN        L+   + L   +S  NP +Y   N  Y
Sbjct:    1 LAYATIIALSLVGNTVVIFTVCRNRHMKSVTNLFIANLAASDLLITFLGMPHQI-TELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPFRPRMSFKTAKTIIMLIWSLSLGIMAPLIYATKVHNNQ--CTEDWTPAFDAKTAPRDYTVVLFVMLYAVPMLTMAVLYAIIVRKLWRRRRIGEVIPSASSKNEVSRKKVIKMLITVIMLFTFSWLPLHVFSFISFFAPFCPDTSN------TALYFVSLFLGHGNSAANPYLYALFNQNY 273          
BLAST of GCR477 vs. Ensembl Nematostella
Match: EDO49911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF82])

HSP 1 Score: 123.25 bits (308), Expect = 4.440e-33
Identity = 84/286 (29.37%), Postives = 144/286 (50.35%), Query Frame = 1
Query:   55 YCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIV-----NDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIEN--DTICKETWSPIKNQ-----IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLP---RHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            Y ++ +L+++GN +V+ VI S +   +VTN F+ N+  +DL+  + N+   +       D WS     G  LC+ + F Q   V+   F+   +S DRF  +F PLK  I+ K A  II+ +W  +   SSPLI+  KL  +  D  C E W+P+ +      +YTI+L +  Y +P+  +   Y+ I++++W R  PG  S      + ++ +K+LKM+IT+  ++ L  LP   R  +     +N    L +     L    + L  ++S  NP +Y   N  +
Sbjct:    6 YLLVVVLSLIGNALVVWVIRSAYRMRTVTNYFITNVAFADLLTTVFNMMPTLFWIIERKDPWSVGGTLGEILCKTLQFFQCVSVACSVFSMAAISMDRFFAIFRPLKRIITFKLAKFIIALIWASSCLISSPLIYALKLEGDGEDVNCVEVWAPLFDDYTSPMVYTIALFVLFYALPLTIIAALYAVIMFRLWRRQTPGQNSTSNQSNKERTNKKVLKMLITVVAVFALCWLPLYVRMFLVFLQPSNFPCGLPYH----LDFITLFLGHANSSINPYLYVVFNENF 287          
BLAST of GCR477 vs. Ensembl Nematostella
Match: EDO39181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAU0])

HSP 1 Score: 121.709 bits (304), Expect = 1.404e-32
Identity = 85/288 (29.51%), Postives = 155/288 (53.82%), Query Frame = 1
Query:   49 IVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVN-----DNWSE-TWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE--NDTICKETWSPI----KNQI-YTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSI--TNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            + Y ++FI+A  GN++ I+V+ S     + TN+F++NL +SDL++AI  +P ++ +        SE + +FG+FLC++  F+QG  ++    T   +  DRF+ + YP K  I+   +  I++ VWF ++   SPL++  K  +  N++ C E W P+    K  + YT+ L + QY  P+  + + YS ++  +W       +S ++  +  K  + +LKM++TI   + +  LP H++   SI  T+   N       ++++   L  A S+C NP IYF  N  +
Sbjct:    5 LAYNVVFIVAFFGNILAISVVLSNVHLKTTTNVFILNLAISDLLIAIVCMPSSMHSIVAHSRQTSEVSGIFGAFLCKLHQFLQGISITSSILTVECIGCDRFLAIVYPFKNIITLPISKIIVALVWFTSIACISPLLYALKFHDAGNESYCYEKWEPLFDTHKASVHYTLFLFVVQYAAPLLLITVLYSTLIKDLW--QSSRTHSDRK--RAYKENKAVLKMLVTIILTFAIFWLPMHVVMFVSIYTTDPVINACGPKAAVVFLGWFLGHAHSAC-NPTIYFTFNEKF 287          
BLAST of GCR477 vs. Ensembl Nematostella
Match: EDO49570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN9])

HSP 1 Score: 120.168 bits (300), Expect = 6.072e-32
Identity = 78/279 (27.96%), Postives = 141/279 (50.54%), Query Frame = 1
Query:   52 VYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE-NDTI--CKETWSPIKNQI-----YTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
             Y +I +L++VGN  VI V+      S+T+ F+ NL  SD+++  T +P N++ + +   WVFG  +C+++ ++Q   V+    T + ++ DRF+ + +PL+ RI+   A  I++  W I+L   +PLI   K  +  D +  C E W P  N +     +T+ L +  Y  P+  M + Y  I   +W R  PG    +      +S++++LKM++ ++ L+ +  LP  I     I   S   F    +  +   + L  S+S  NP +Y + N  +
Sbjct:    2 AYVLIIVLSLVGNSTVIYVVLNHRARSMTDTFVANLAASDILITFTGMP-NMITEQYIRHWVFGPIVCKLVVYLQSVSVASSVLTLLAVTIDRFISIVFPLRGRIALSKAKYIVAVTWIISLSIMAPLIDAQKAKQFPDGMYYCIEEWQPPFNPLEAPKSFTVLLFVVMYVAPLLTMAVLYCAICRTLWKRTSPGARITRTETHLQRSRKRVLKMLLAVTLLFAVCWLPLWIFQF--IMFFSPQTFPCFSKPFYFVSLFLGHSNSAINPFLYSFFNANF 277          
BLAST of GCR477 vs. Ensembl Nematostella
Match: EDO44000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB4])

HSP 1 Score: 114.005 bits (284), Expect = 1.520e-29
Identity = 74/281 (26.33%), Postives = 142/281 (50.53%), Query Frame = 1
Query:   49 IVYCIIFILAVVGNVMV-ITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIE---NDTICKETWSPIK-NQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCI-----QRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVI--LLSASSSCYNPIIYFWMN 855
            +++ I+F++  VGN++V + VI    + +  NIF  NL LSDL+  +  +P  +        W FG+F+C++   I    +S    T + ++TDR+  + YP++ R+S K   AI+  +W +++ ++ PL+F ++ +        C E W     +++Y I++ + QY +P+G +      I  K+    +  I      +     QR+K   K+  M+I +  LY +  LP+H++YLC +  +      Q K  +++     +   ++S  NPI Y  +N
Sbjct:   18 LIFIIVFLVGSVGNLVVCMAVIRRKRSRTSNNIFTFNLALSDLLTVLIYVPTQMAAFENDHNWPFGNFVCQLAYVIIPVCLSASIATLLAITTDRYRAIAYPMRPRLSGKHVRAILVAIWTVSIITALPLMFVAREVRPAPRQVYCDEVWPEGPYSRVYWIAIFVIQYILPLGMICALAMLIALKVRRNSLKMIEKSSHVLAAAVRQRMKQTSKITNMLIALVILYAICMLPQHVVYLCMVYGD----LLQFKYRVYVLRFANVFPMANSALNPIAYGTLN 294          
BLAST of GCR477 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 124.02 bits (310), Expect = 2.628e-32
Identity = 89/299 (29.77%), Postives = 155/299 (51.84%), Query Frame = 1
Query:    7 FKLAMIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLI-------FTSKLIENDTICKETW--SPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVP--GIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCS-ITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            F  + ++ L ++  + Y  I +L V+GN +VI VI  F T+ +VTN F+ NL ++DL++    +P  +V     E W FGS LC ++P+ QG  V +   T  +++ DR   + Y L+ R+ K     +I+  W ++   +SPL        FT +      +C E W        IY+IS+LI QYF+P+  +   Y+ I  K+     P  G  +     +R + + K  KM++T+  ++ +S LP H   L + I N+  ++  ++ R+L+    +++  S+  NP++Y WMN  Y
Sbjct:   41 FTSSALVCLKVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGE-WKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDIDNKVLDM--RDFRLLYTIFHVVAMCSTFANPLLYGWMNRNY 336          
BLAST of GCR477 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 123.25 bits (308), Expect = 9.434e-32
Identity = 89/295 (30.17%), Postives = 155/295 (52.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLI-------FTSKLIENDTICKETWSPIK---NQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVP--GIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCS-ITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++  + Y  I +L V+GN +VI VI  F T+ +VTN F+ NL ++DL++    +P  +V     E W FGS LC ++P+ QG  V +   T  +++ DR   + Y L+ R+ K     +I+  W ++   +SPL        FT +      +C E W P K     IY+IS+LI QYF+P+  +   Y+ I  K+     P  G  +     +R + + K  KM++T+  ++ +S LP H   L + I N+  ++  ++ R+L+    +++  S+  NP++Y WMN  Y
Sbjct:   58 LLSVQVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGE-WKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKW-PGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDIDNKVLDM--RDFRLLYTIFHVVAMCSTFANPLLYGWMNRNY 348          
BLAST of GCR477 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 123.25 bits (308), Expect = 9.434e-32
Identity = 89/295 (30.17%), Postives = 155/295 (52.54%), Query Frame = 1
Query:   22 IIELNILFTIVYCIIFILAVVGNVMVITVISYFMTV-SVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLI-------FTSKLIENDTICKETWSPIK---NQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVP--GIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCS-ITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            ++ + ++  + Y  I +L V+GN +VI VI  F T+ +VTN F+ NL ++DL++    +P  +V     E W FGS LC ++P+ QG  V +   T  +++ DR   + Y L+ R+ K     +I+  W ++   +SPL        FT +      +C E W P K     IY+IS+LI QYF+P+  +   Y+ I  K+     P  G  +     +R + + K  KM++T+  ++ +S LP H   L + I N+  ++  ++ R+L+    +++  S+  NP++Y WMN  Y
Sbjct:   58 LLSVQVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGE-WKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKW-PGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDIDNKVLDM--RDFRLLYTIFHVVAMCSTFANPLLYGWMNRNY 348          
BLAST of GCR477 vs. Ensembl Medaka
Match: tacr3 (tachykinin receptor 3 [Source:NCBI gene;Acc:101159167])

HSP 1 Score: 118.242 bits (295), Expect = 4.101e-30
Identity = 85/280 (30.36%), Postives = 153/280 (54.64%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIF--TSKLIENDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            L+++ Y ++  +AV GNV+VI +I ++    +VTN FL+NL  SD  +A  N  +N +     E W FG   C+   F   T V    ++   ++ DR++ + +PLK R+S K    II C+W +A+  + PL +  T+++    TIC   W  + +   +Y I + +  Y +P+  M I Y+ +   +W   +PG  S     Q +++K K++KM+I +   + L  LP HI ++ +  N+  +  W+  + +++ V+ L+ SS+ YNPIIY  +N+ +
Sbjct:   27 LWSVAYSLVLAVAVFGNVIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLINFIYAAHGE-WYFGEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLKPRLSAKATTGIIVCIWSLAIVLAFPLCYFSTTQVRPRRTICYVAWPRMADDSFMYHIIVAVLIYVLPLVVMGITYTIVGLTLWGGEIPGDTSDNYHGQ-LQAKRKVVKMMIIVVVTFALCWLPYHIYFIVTGINKRLSK-WKYIQQVYLSVMWLAMSSTMYNPIIYCCLNSRF 303          
BLAST of GCR477 vs. Ensembl Medaka
Match: tacr3 (tachykinin receptor 3 [Source:NCBI gene;Acc:101159167])

HSP 1 Score: 117.857 bits (294), Expect = 7.514e-30
Identity = 85/280 (30.36%), Postives = 153/280 (54.64%), Query Frame = 1
Query:   40 LFTIVYCIIFILAVVGNVMVITVI-SYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIF--TSKLIENDTICKETWSPIKNQ--IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTY 864
            L+++ Y ++  +AV GNV+VI +I ++    +VTN FL+NL  SD  +A  N  +N +     E W FG   C+   F   T V    ++   ++ DR++ + +PLK R+S K    II C+W +A+  + PL +  T+++    TIC   W  + +   +Y I + +  Y +P+  M I Y+ +   +W   +PG  S     Q +++K K++KM+I +   + L  LP HI ++ +  N+  +  W+  + +++ V+ L+ SS+ YNPIIY  +N+ +
Sbjct:   27 LWSVAYSLVLAVAVFGNVIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLINFIYAAHGE-WYFGEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLKPRLSAKATTGIIVCIWSLAIVLAFPLCYFSTTQVRPRRTICYVAWPRMADDSFMYHIIVAVLIYVLPLVVMGITYTIVGLTLWGGEIPGDTSDNYHGQ-LQAKRKVVKMMIIVVVTFALCWLPYHIYFIVTGINKRLSK-WKYIQQVYLSVMWLAMSSTMYNPIIYCCLNSRF 303          
BLAST of GCR477 vs. Planmine SMEST
Match: SMESG000028774.1 (SMESG000028774.1)

HSP 1 Score: 364.385 bits (934), Expect = 2.049e-128
Identity = 180/182 (98.90%), Postives = 182/182 (100.00%), Query Frame = 1
Query:  121 MTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLL 666
            MTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEK++
Sbjct:    1 MTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKVI 182          
BLAST of GCR477 vs. Planmine SMEST
Match: SMESG000016672.1 (SMESG000016672.1)

HSP 1 Score: 190.274 bits (482), Expect = 3.068e-58
Identity = 107/282 (37.94%), Postives = 171/282 (60.64%), Query Frame = 1
Query:   37 ILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFT---SKLIENDTICKETWSPIKNQ-IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNESSNLFWQNKRI--LWICVILLSASSSCYNPIIYFWMNTTY 864
            +LF+I++ I+FI+ + GN  +  ++   +  + TNIFL NL L+D+++ +   PV +V+D     W FGS LC+++PFIQG  V L   T V++S+DRFVVVF+P+K R+S + +  +I   W I++  S PL+     S + +N  +C+E W    +  IYT  +LI QYF+PV  +   Y  I  K+W R  PG+    +  Q   SK++++KMVI ++  Y+LSQLPRH+++L   +NE   LF+ +K +  L +    LS S++ YN  IY W+N  +
Sbjct:   18 VLFSILFSIVFIVGIGGNYCICWILIKDINRNATNIFLFNLSLADILMCLICSPVTLVSDGLLFYWPFGSLLCKVVPFIQGISVFLSGLTHVVISSDRFVVVFFPMKTRLSNECSWGLIGLTWIISIILSLPLVIVNEISTINQNRDLCEENWKNKDHGLIYTFVVLICQYFLPVAFITSTYIAIAVKLWIRKPPGVSFPGRNEQVNNSKKRMVKMVIIVASFYSLSQLPRHVLFLIGYSNE---LFFSSKHVKELLLFSHFLSISATTYNIFIYLWLNRNF 296          
BLAST of GCR477 vs. Planmine SMEST
Match: SMESG000017198.1 (SMESG000017198.1)

HSP 1 Score: 187.963 bits (476), Expect = 9.110e-57
Identity = 110/287 (38.33%), Postives = 171/287 (59.58%), Query Frame = 1
Query:   31 LNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVR-ISKKFAIAIISCVWFIALCSSSPLIFTS--KLIENDTICKETWSPIKNQ-IYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPG--IYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSI--TNESSNLFWQNKRILWICVILLSASSSC-YNPIIYFWMNTTY 864
            L  ++   Y  IFIL VVGN+ V  +IS  +  S T+IFL+NL L+DL +A+  +PV   +D     W+FG  +C + PF+Q   V L + T   +S DR+ VVF+PL+ +    K A+ ++SC+W  ++  S PLIF +  K I     C E W    N+ +Y++ +++ QYF+P+  +I+ YS I  ++WF   PG  I S+ + I    SK+K++KM I ++  Y+LSQLPRHIIYL S    + S N FW +  +  +    L + S+C YNPI+Y W+N+++
Sbjct:   21 LQYIYGFFYVSIFILGVVGNLAVCYIISCRLRQSATSIFLLNLSLADLKMALFCVPVTFFSDCIFMRWIFGRAMCHVFPFVQALSVFLSSVTHTAISVDRYFVVFHPLRRQNFPIKGAVFVVSCIWIFSISISFPLIFVTEYKTINESDFCSEKWPTENNEMLYSLFVMVLQYFLPIIVIIMTYSAIAIRLWFYQTPGESIRSRDEVIA--TSKKKMIKMFIIVAIFYSLSQLPRHIIYLTSKFSVSTSQNPFWDSTTVTILNFAHLLSMSACFYNPILYVWLNSSF 305          
BLAST of GCR477 vs. Planmine SMEST
Match: SMESG000016225.1 (SMESG000016225.1)

HSP 1 Score: 188.734 bits (478), Expect = 1.861e-56
Identity = 112/292 (38.36%), Postives = 170/292 (58.22%), Query Frame = 1
Query:   49 IVYCIIFILAVVGNVMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVW-FIALCSSS-PLIFTSKLIENDTICKETWS----------------PIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSIT-NESSNLFWQNKRI-LWICVILLSASSSCYNPIIYFWMNTTY 864
            I    + +  V+GN  V  VI   + +SVTN+FL+NL L+D+++AI + P  ++ND     W FG  +C+++P +QG    + AFT V++S DRFVVVF PLK RI +K A+ I+S +W F AL     P+++  +   N+  C E WS                  +N IYTI L++ Q+F+P+  +I  YS I +++W R  PG    ++  +  KSK KLLKMVI ++ LY LS+LPRH ++L S+   E  N  + +  + +W+  IL   SS  +NP+IYFWMN  +
Sbjct:   34 IALSAVIVWGVIGNASVCYVIIKDLKLSVTNLFLLNLSLADILIAIFSGPFVMLNDFIIGHWTFGVAMCKLMPLVQGISSFVSAFTHVVISFDRFVVVFRPLKPRIRQKSAMFILSTIWIFSALVVVPLPIVYDVRFDGNNGYCLEDWSIFVNGNYSPDTIKEKATYRNFIYTILLMVLQFFLPLTVIIGTYSAIAFRIWIRETPGEVDLKRDQRIAKSKRKLLKMVIIVALLYGLSRLPRHALFLASLKYTEMWNAGYSHYVLYVWLFCILAEQSSMGFNPLIYFWMNKLF 325          
BLAST of GCR477 vs. Planmine SMEST
Match: SMESG000023192.1 (SMESG000023192.1)

HSP 1 Score: 117.087 bits (292), Expect = 6.348e-30
Identity = 92/276 (33.33%), Postives = 148/276 (53.62%), Query Frame = 1
Query:   52 VYCIIFILAVVGN-VMVITVISYFMTVSVTNIFLINLCLSDLILAITNIPVNI---VNDNWSETWVFGSFLCRMIPFIQGTGVSLIAFTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSKLI--ENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFRHVPGI--YSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRH----IIYLCSITNESSNLFWQNKRILWICVILLSASSSCYNPIIY 843
            V+ IIF L+V+GN +MV  ++S     + TN FL+NL  +++++A+T+I  N+   +N+ W    +FG  LC++  FI    V++   T + ++ DRF V+ YPL+ R+S K  + II  +W IA+ S       +K++  EN  IC           Y ISLLI QY +P+  + I Y  I  ++W     G    SQ++C   +K+K K++KM+I I  ++ +  LP      II L    N S N+      I++  +  L+ S S  NP+IY
Sbjct:   32 VFSIIFFLSVLGNGIMVWIILSQKSMRNSTNYFLVNLSATNVLMAVTHIFPNVYYSINNKW----IFGLTLCKLSQFITAFSVTVTVLTFIGMAADRFTVIMYPLRTRLSSKVILLIIVVIWLIAIASGLIGAIKAKIVLDENRKICDFLTEDEWKLKYDISLLILQYILPLVVLTITYIPISIRLWKSTTVGELNRSQREC---MKTKRKIVKMLIAIIIIFAVCWLPYQCFFIIIDLNKHLNASPNVL-----IVFFIIYALAMSYSFTNPLIY 295          
The following BLAST results are available for this feature:
BLAST of GCR477 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
QRFPR1.290e-3028.34pyroglutamylated RFamide peptide receptor [Source:... [more]
NPY2R5.245e-2929.01neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
NPY2R5.245e-2929.01neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
TACR22.087e-2726.69tachykinin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
GALR23.360e-2627.50galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:41... [more]
back to top
BLAST of GCR477 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-226.629e-3632.11Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-221.089e-3531.67Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-68.062e-2126.64NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-101.183e-2027.76NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-101.439e-2027.76NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of GCR477 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RYa-R3.675e-4031.60gene:FBgn0004842 transcript:FBtr0345268[more]
RYa-R6.175e-4031.83gene:FBgn0004842 transcript:FBtr0085100[more]
RYa-R2.348e-3931.83gene:FBgn0004842 transcript:FBtr0345267[more]
TkR99D2.613e-2928.76gene:FBgn0004622 transcript:FBtr0301656[more]
TkR99D2.839e-2928.76gene:FBgn0004622 transcript:FBtr0085507[more]
back to top
BLAST of GCR477 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01084347.16.650e-3128.19pyroglutamylated RFamide peptide receptor b [Sourc... [more]
galr2a1.829e-3030.07galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr2a2.102e-3030.07galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr2a2.102e-3030.07galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
npy2rl3.345e-2929.55neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:... [more]
back to top
BLAST of GCR477 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf1b3.216e-3029.83TATA-box binding protein associated factor, RNA po... [more]
ENSXETT00000055164.19.333e-2828.91pep primary_assembly:Xenopus_tropicalis_v9.1:8:945... [more]
ENSXETT00000044281.14.206e-2627.72pep primary_assembly:Xenopus_tropicalis_v9.1:3:115... [more]
sp37.555e-2626.99Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
slc11a21.003e-2528.09solute carrier family 11 member 2 [Source:Xenbase;... [more]
back to top
BLAST of GCR477 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npy2r5.228e-3029.01neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r5.228e-3029.01neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r5.228e-3029.01neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Galr22.360e-2828.27galanin receptor 2 [Source:MGI Symbol;Acc:MGI:1337... [more]
Tacr24.324e-2726.76tachykinin receptor 2 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of GCR477 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25931|RYAR_DROME6.190e-3931.83RYamide receptor OS=Drosophila melanogaster OX=722... [more]
sp|Q59E83|NPR22_CAEEL1.385e-3431.67Neuropeptide receptor 22 OS=Caenorhabditis elegans... [more]
sp|G4WMX4|RYAR_TRICA3.501e-3331.49RYamide receptor OS=Tribolium castaneum OX=7070 GN... [more]
sp|Q96P65|QRFPR_HUMAN6.193e-3028.34Pyroglutamylated RF-amide peptide receptor OS=Homo... [more]
sp|F1R332|GAL2A_DANRE1.587e-2930.07Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr... [more]
back to top
BLAST of GCR477 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUH20.000e+0100.00GCR477 OS=Schmidtea mediterranea OX=79327 GN=gcr47... [more]
A0A193KUC02.153e-10052.88GCR097 OS=Schmidtea mediterranea OX=79327 GN=gcr09... [more]
A0A068Y1G99.583e-6240.07Neuropeptide Y receptor OS=Echinococcus multilocul... [more]
A0A0R3VXA29.625e-6239.44G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A068WKU91.772e-6140.07Neuropeptide Y receptor OS=Echinococcus granulosus... [more]
back to top
BLAST of GCR477 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prlh2r1.324e-3025.93prolactin-releasing peptide receptor-like [Source:... [more]
npy2rl4.779e-3030.93neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npy2rl4.779e-3030.93neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npy2rl5.714e-3030.93neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npy2r5.251e-2927.84neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of GCR477 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qrfpr45.817e-3226.78pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
prlh2r4.595e-2525.86prolactin releasing hormone 2 receptor [Source:ZFI... [more]
ENSPMAT00000008040.17.284e-2527.68pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-... [more]
npffr1l34.977e-2428.76neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
si:dkey-202l22.37.753e-2423.78prolactin releasing hormone receptor [Source:HGNC ... [more]
back to top
BLAST of GCR477 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR477 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444184.239e-3830.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499114.440e-3329.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391811.404e-3229.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495706.072e-3227.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440001.520e-2926.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR477 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2rl2.628e-3229.77neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy2rl9.434e-3230.17neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy2rl9.434e-3230.17neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
tacr34.101e-3030.36tachykinin receptor 3 [Source:NCBI gene;Acc:101159... [more]
tacr37.514e-3030.36tachykinin receptor 3 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of GCR477 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028774.12.049e-12898.90SMESG000028774.1[more]
SMESG000016672.13.068e-5837.94SMESG000016672.1[more]
SMESG000017198.19.110e-5738.33SMESG000017198.1[more]
SMESG000016225.11.861e-5638.36SMESG000016225.1[more]
SMESG000023192.16.348e-3033.33SMESG000023192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024757 ID=SMED30024757|Name=GCR477|organism=Schmidtea mediterranea sexual|type=transcript|length=970bp
TATGCTTTCAAATTAGCCATGATTATAGAATTAAATATTCTTTTCACAAT
TGTTTATTGTATTATTTTTATCCTTGCGGTAGTGGGCAACGTTATGGTGA
TCACAGTGATAAGCTATTTTATGACCGTTTCGGTTACCAATATATTTTTA
ATAAATCTCTGCTTATCAGATCTGATTTTAGCTATTACAAATATTCCCGT
AAATATAGTAAATGACAACTGGAGTGAAACATGGGTATTTGGATCATTTT
TATGTCGAATGATACCATTTATCCAAGGAACAGGCGTTTCTCTAATTGCA
TTTACTCAGGTTATCCTTTCCACAGATCGTTTTGTGGTTGTATTTTATCC
TTTGAAAGTGAGAATATCGAAAAAGTTTGCCATCGCCATTATTTCGTGTG
TTTGGTTTATAGCTCTCTGTAGCAGCTCTCCGTTGATATTCACTTCGAAG
CTTATTGAAAACGACACTATATGCAAAGAGACTTGGAGTCCTATTAAGAA
TCAAATTTATACAATTTCGTTATTAATCTTCCAATATTTTATTCCAGTTG
GGTGCATGATCATATTTTACAGTTGTATTGTCTATAAAATGTGGTTCAGA
CATGTTCCCGGAATTTATTCTCAGCAACAATGTATTCAAAGGATTAAATC
GAAAGAAAAGCTCTTGAAAATGGTAATAACCATATCCTTTCTGTATACGT
TGTCTCAGCTTCCACGGCACATAATTTATTTATGTTCAATTACTAACGAG
TCCTCTAATTTATTTTGGCAAAACAAAAGGATTTTATGGATATGCGTGAT
TCTTTTGTCTGCTTCATCAAGTTGCTACAATCCAATCATATATTTTTGGA
TGAATACTACTTATCGTAAGTTGTTACGAAGGATTTTCAGACTAAGAGGA
CTTAGATACGTTAATACCGTCAATAGATTTGATATAAGTCAATATCGGTC
AGATGCTAACATGTCTTTTT
back to top

protein sequence of SMED30024757-orf-1

>SMED30024757-orf-1 ID=SMED30024757-orf-1|Name=SMED30024757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
YAFKLAMIIELNILFTIVYCIIFILAVVGNVMVITVISYFMTVSVTNIFL
INLCLSDLILAITNIPVNIVNDNWSETWVFGSFLCRMIPFIQGTGVSLIA
FTQVILSTDRFVVVFYPLKVRISKKFAIAIISCVWFIALCSSSPLIFTSK
LIENDTICKETWSPIKNQIYTISLLIFQYFIPVGCMIIFYSCIVYKMWFR
HVPGIYSQQQCIQRIKSKEKLLKMVITISFLYTLSQLPRHIIYLCSITNE
SSNLFWQNKRILWICVILLSASSSCYNPIIYFWMNTTYRKLLRRIFRLRG
LRYVNTVNRFDISQYRSDANMSF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 126..147
score: 25.76
coord: 46..67
score: 33.34
coord: 92..114
score: 19.23
coord: 171..194
score: 22.92
coord: 14..38
score: 26.35
coord: 221..245
score: 18.61
coord: 263..289
score: 29.33
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 29..281
e-value: 4.4E-37
score: 127.8
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 6..321
e-value: 3.0E-68
score: 231.9
NoneNo IPR availablePANTHERPTHR24238:SF29G-PROTEIN COUPLED RECEPTOR 83-RELATEDcoord: 11..301
NoneNo IPR availablePANTHERPTHR24238G-PROTEIN COUPLED RECEPTORcoord: 11..301
NoneNo IPR availableCDDcd153927tmA_PR4-likecoord: 13..289
e-value: 1.12228E-61
score: 196.042
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 9..305
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 84..106
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 29..281
score: 33.571