Transmembrane 9 superfamily member

Overview
NameTransmembrane 9 superfamily member
Smed IDSMED30024756
Length (bp)4385
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane 9 superfamily member (SMED30024756) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane 9 superfamily member (SMED30024756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane 9 superfamily member (SMED30024756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane 9 superfamily member (SMED30024756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30024756SMESG000036610.1 dd_Smed_v4_5328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024756SMESG000036610.1 dd_Smed_v4_5328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30024756SMESG000036610.1 dd_Smed_v4_5328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024756SMESG000036610.1 dd_Smed_v6_5328_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30024756SMESG000036610.1 OX_Smed_1.0.21290ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: AL136295.15 (novel protein)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 294/580 (50.69%), Postives = 401/580 (69.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:  245 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 815          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: AL136295.1 (novel protein)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 294/580 (50.69%), Postives = 401/580 (69.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:  245 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 815          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF1 (transmembrane 9 superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:11864])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 294/580 (50.69%), Postives = 401/580 (69.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF1 (transmembrane 9 superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:11864])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 294/580 (50.69%), Postives = 401/580 (69.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Match: TM9SF1 (transmembrane 9 superfamily member 1 [Source:HGNC Symbol;Acc:HGNC:11864])

HSP 1 Score: 530.02 bits (1364), Expect = 2.180e-172
Identity = 282/580 (48.62%), Postives = 386/580 (66.55%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNE--EQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    +  +Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP                     +I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQP-----------------CAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 589          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: Y41D4A.4 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:U4PRX8])

HSP 1 Score: 329.331 bits (843), Expect = 1.259e-98
Identity = 185/578 (32.01%), Postives = 315/578 (54.50%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCR--PPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQD-EKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +  +EEV+L++N VGPY N  ETY Y++LP C+    E+     T+GE L G  +  S   IKFR N +K  +C  +L  +D K L+ AI++ YY++  +DD+PI G +G ++ + + P  +K  LYTH  ++I YN   ++  N+  T    +++ P       +TFTY V W  S +    R  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY  +   + ++ +   E GWK VH DVFRPP+  L+F S IG G  + T+++   ++A+   F      +++ AA+ +Y+  S + G+    ++  F           +W++ +     L    +  V  L N +++ Y  + A+P T +L +  + L +  PLT+ G ++G+      D   CR   + R IP   W+   ++  L GG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  +YF L  EDYRW W +      +  +V++Y ++++F+++KM G  Q++ YF Y  +   A  L  G + ++ +  F++ +Y+ +K+D
Sbjct:   24 YEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEFSGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEIDNT-VNPPAYK--LYTHKRLDIGYNDKQVVDVNL--TTDGRVDIRPGA----ELTFTYEVQWSKSEVDFTKRFDKYLDPSFF--QHRIHWFSIFNSFMMVVFLVGLVWMILVRTLRKDYARYQKEDSLDDLDADLGDEYGWKQVHGDVFRPPSMPLLFSSCIGAGYHVFTVAVITTILAIVGEFYTERGSLLS-AAIFVYAACSPVNGYAGGSMYARF--------GGRHWIKQMLLGAFLLPSMVCGVAFLINFIAIYYHASRAIPFTIMLAVSAICLFVILPLTLVGTVIGRNMAGSADYP-CRVNAVPRPIPDKKWFVQPWLITLAGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVTIILSIVTVCVTIVCSYFLLNAEDYRWRWTSFACGASTAFYVYMYSMYYFFFKTKMYGLFQTVFYFGYMGIFAAALGLMTGTIGYVGTAKFVRKIYQTVKID 580          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: Y41D4A.4 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:U4PRX8])

HSP 1 Score: 329.331 bits (843), Expect = 1.259e-98
Identity = 185/578 (32.01%), Postives = 315/578 (54.50%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCR--PPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQD-EKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +  +EEV+L++N VGPY N  ETY Y++LP C+    E+     T+GE L G  +  S   IKFR N +K  +C  +L  +D K L+ AI++ YY++  +DD+PI G +G ++ + + P  +K  LYTH  ++I YN   ++  N+  T    +++ P       +TFTY V W  S +    R  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY  +   + ++ +   E GWK VH DVFRPP+  L+F S IG G  + T+++   ++A+   F      +++ AA+ +Y+  S + G+    ++  F           +W++ +     L    +  V  L N +++ Y  + A+P T +L +  + L +  PLT+ G ++G+      D   CR   + R IP   W+   ++  L GG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  +YF L  EDYRW W +      +  +V++Y ++++F+++KM G  Q++ YF Y  +   A  L  G + ++ +  F++ +Y+ +K+D
Sbjct:   24 YEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEFSGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEIDNT-VNPPAYK--LYTHKRLDIGYNDKQVVDVNL--TTDGRVDIRPGA----ELTFTYEVQWSKSEVDFTKRFDKYLDPSFF--QHRIHWFSIFNSFMMVVFLVGLVWMILVRTLRKDYARYQKEDSLDDLDADLGDEYGWKQVHGDVFRPPSMPLLFSSCIGAGYHVFTVAVITTILAIVGEFYTERGSLLS-AAIFVYAACSPVNGYAGGSMYARF--------GGRHWIKQMLLGAFLLPSMVCGVAFLINFIAIYYHASRAIPFTIMLAVSAICLFVILPLTLVGTVIGRNMAGSADYP-CRVNAVPRPIPDKKWFVQPWLITLAGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVTIILSIVTVCVTIVCSYFLLNAEDYRWRWTSFACGASTAFYVYMYSMYYFFFKTKMYGLFQTVFYFGYMGIFAAALGLMTGTIGYVGTAKFVRKIYQTVKID 580          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: Y41D4A.4 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:U4PRX8])

HSP 1 Score: 325.094 bits (832), Expect = 4.684e-97
Identity = 185/581 (31.84%), Postives = 316/581 (54.39%), Query Frame = 2
Query:  155 FSTNEEVILYVN---KVGPYYNPHETYHYYTLPVCR--PPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQD-EKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +  +EEV+L++N   +VGPY N  ETY Y++LP C+    E+     T+GE L G  +  S   IKFR N +K  +C  +L  +D K L+ AI++ YY++  +DD+PI G +G ++ + + P  +K  LYTH  ++I YN   ++  N+  T    +++ P       +TFTY V W  S +    R  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY  +   + ++ +   E GWK VH DVFRPP+  L+F S IG G  + T+++   ++A+   F      +++ AA+ +Y+  S + G+    ++  F           +W++ +     L    +  V  L N +++ Y  + A+P T +L +  + L +  PLT+ G ++G+      D   CR   + R IP   W+   ++  L GG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  +YF L  EDYRW W +      +  +V++Y ++++F+++KM G  Q++ YF Y  +   A  L  G + ++ +  F++ +Y+ +K+D
Sbjct:   24 YEVDEEVVLWMNTKFQVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEFSGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEIDNT-VNPPAYK--LYTHKRLDIGYNDKQVVDVNL--TTDGRVDIRPGA----ELTFTYEVQWSKSEVDFTKRFDKYLDPSFF--QHRIHWFSIFNSFMMVVFLVGLVWMILVRTLRKDYARYQKEDSLDDLDADLGDEYGWKQVHGDVFRPPSMPLLFSSCIGAGYHVFTVAVITTILAIVGEFYTERGSLLS-AAIFVYAACSPVNGYAGGSMYARF--------GGRHWIKQMLLGAFLLPSMVCGVAFLINFIAIYYHASRAIPFTIMLAVSAICLFVILPLTLVGTVIGRNMAGSADYP-CRVNAVPRPIPDKKWFVQPWLITLAGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVTIILSIVTVCVTIVCSYFLLNAEDYRWRWTSFACGASTAFYVYMYSMYYFFFKTKMYGLFQTVFYFGYMGIFAAALGLMTGTIGYVGTAKFVRKIYQTVKID 583          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: Y41D4A.4 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:U4PRX8])

HSP 1 Score: 303.523 bits (776), Expect = 2.163e-89
Identity = 173/535 (32.34%), Postives = 291/535 (54.39%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCR--PPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQD-EKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGF 1750
            +  +EEV+L++N VGPY N  ETY Y++LP C+    E+     T+GE L G  +  S   IKFR N +K  +C  +L  +D K L+ AI++ YY++  +DD+PI G +G ++ + + P  +K  LYTH  ++I YN   ++  N+  T    +++ P       +TFTY V W  S +    R  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY  +   + ++ +   E GWK VH DVFRPP+  L+F S IG G  + T+++   ++A+   F      +++ AA+ +Y+  S + G+    ++  F           +W++ +     L    +  V  L N +++ Y  + A+P T +L +  + L +  PLT+ G ++G+      D   CR   + R IP   W+   ++  L GG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  +YF L  EDYRW W +      +  +V++Y ++++F+++K + F
Sbjct:   24 YEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEFSGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEIDNT-VNPPAYK--LYTHKRLDIGYNDKQVVDVNL--TTDGRVDIRPGA----ELTFTYEVQWSKSEVDFTKRFDKYLDPSFF--QHRIHWFSIFNSFMMVVFLVGLVWMILVRTLRKDYARYQKEDSLDDLDADLGDEYGWKQVHGDVFRPPSMPLLFSSCIGAGYHVFTVAVITTILAIVGEFYTERGSLLS-AAIFVYAACSPVNGYAGGSMYARF--------GGRHWIKQMLLGAFLLPSMVCGVAFLINFIAIYYHASRAIPFTIMLAVSAICLFVILPLTLVGTVIGRNMAGSADYP-CRVNAVPRPIPDKKWFVQPWLITLAGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVTIILSIVTVCVTIVCSYFLLNAEDYRWRWTSFACGASTAFYVYMYSMYYFFFKTKYACF 537          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Match: Y41D4A.4 (Transmembrane 9 superfamily member [Source:UniProtKB/TrEMBL;Acc:U4PRX8])

HSP 1 Score: 303.523 bits (776), Expect = 2.163e-89
Identity = 173/535 (32.34%), Postives = 291/535 (54.39%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCR--PPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQD-EKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGF 1750
            +  +EEV+L++N VGPY N  ETY Y++LP C+    E+     T+GE L G  +  S   IKFR N +K  +C  +L  +D K L+ AI++ YY++  +DD+PI G +G ++ + + P  +K  LYTH  ++I YN   ++  N+  T    +++ P       +TFTY V W  S +    R  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY  +   + ++ +   E GWK VH DVFRPP+  L+F S IG G  + T+++   ++A+   F      +++ AA+ +Y+  S + G+    ++  F           +W++ +     L    +  V  L N +++ Y  + A+P T +L +  + L +  PLT+ G ++G+      D   CR   + R IP   W+   ++  L GG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  +YF L  EDYRW W +      +  +V++Y ++++F+++K + F
Sbjct:   24 YEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEFSGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEIDNT-VNPPAYK--LYTHKRLDIGYNDKQVVDVNL--TTDGRVDIRPGA----ELTFTYEVQWSKSEVDFTKRFDKYLDPSFF--QHRIHWFSIFNSFMMVVFLVGLVWMILVRTLRKDYARYQKEDSLDDLDADLGDEYGWKQVHGDVFRPPSMPLLFSSCIGAGYHVFTVAVITTILAIVGEFYTERGSLLS-AAIFVYAACSPVNGYAGGSMYARF--------GGRHWIKQMLLGAFLLPSMVCGVAFLINFIAIYYHASRAIPFTIMLAVSAICLFVILPLTLVGTVIGRNMAGSADYP-CRVNAVPRPIPDKKWFVQPWLITLAGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVTIILSIVTVCVTIVCSYFLLNAEDYRWRWTSFACGASTAFYVYMYSMYYFFFKTKYACF 537          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF3 (gene:FBgn0035622 transcript:FBtr0077127)

HSP 1 Score: 303.138 bits (775), Expect = 4.511e-89
Identity = 190/580 (32.76%), Postives = 314/580 (54.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAF--VWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++  EEV+L++N VGPY+N  ETY Y++LP C  +   +S    TL E L G  +  S Y+++F+ +  K+ +C + L+    K    A+++ Y+++  ID +PI G +G  +E        K  ++TH   +I YN   I+  +I  T      L P      +I F+Y V+W  S +  K+R  + +  NFF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+   + + M  +  DE GWK VH DVFR P + L+F +++G G QL+++   +++ A+          +++  A+ +Y+ TS I G+    L+               W+R      S F +P+A      L N +++ Y  + A+P  T++ +  + L +  PLT+ G ++G+  D + D   CR   + R IP   WY    I +LLGG LPF SI IE+Y+IF++ W  + Y +YG + ++F IL +VT+CV I  TYF L  EDYRW W +   AG + ++V+ Y  +++F+++KM G  Q+  YF Y  L   A  +  G V ++ +  F++ +Y N+K+D
Sbjct:   38 YNDREEVVLWMNTVGPYHNRQETYAYFSLPFCSGQKSSISHYHETLSEALQGVELEFSGYEMEFKSDAPKSVICMVTLQEESAKAFTYAVKNEYWYQMYIDGLPIWGKVGERDE-----RDGKYYIFTHKKFDIGYNGQQIV--DITLTTEGREELKPGS----HINFSYEVNWKPSKVEFKNRFDKYLDPNFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKDEEIDDMERDLGDEYGWKQVHGDVFRSPPNTLLFSALVGAGYQLISVVFCVIMFAIVGELYTERGSMLS-TAIFVYAATSPINGYFGGSLYARLGGRM--------WIR--QMLVSAFTVPVAVCGTAFLINFIAIGYHASRAIPFGTMVAVTCICLFVILPLTLVGTVVGRNLDGQPDFP-CRVNAVPRPIPEKKWYMEPLIIVLLGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFSILTVVTVCVTIVCTYFLLNAEDYRWQWTSFMAAGSTSIYVYAYSFYYFFFKTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID 592          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF4 (gene:FBgn0028541 transcript:FBtr0080532)

HSP 1 Score: 271.166 bits (692), Expect = 1.388e-77
Identity = 180/603 (29.85%), Postives = 301/603 (49.92%), Query Frame = 2
Query:  224 YHYYTLPVCRPPEVS--FKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCT-----LQLKASDTKRLINAIEDLYYFEFVIDDIPI----------------RGF-IGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLN-----------------ITFTYSVHWISSPILVKDR--IKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLF-GIPLA-------FVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            Y YY+L  C P   +  FKS  LGEVL GDR+  + Y+++  + +    LC      L     D+  +   I+  Y+   ++D++P+                 G+ +G ++   +  + H   + ++H    D  +   + G  + T S     + + G   N                 + FTYSV W  S +    R  I   M++      ++IHW SI NSL++VF L   +  I+ R LRRD ARYN   + E   +  +E GWK+VH DVFRPP +  +F +IIG+G Q+  +++  +  A+  M +  + G +  + + +Y F   IAG+ + RL+K  +  +        W R    T +L+ GI          F+W   +S         A+P TT++ L+L+W  I  PL   G  LG R       +  R   I R++PT  WY +  +  L+ G LPF ++ IEL+++F+ +W  + Y L+G LF++F IL++    ++I +TYFQL  EDYRWWW +  ++G S ++V  Y IF++F + +++ FI ++ Y  Y+ L+   F+L  G++ F ++Y FI  +Y  +K+D
Sbjct:   58 YQYYSLRFCYPKNGTLIFKSENLGEVLRGDRIVNTPYEVRMNQQVNCRLLCNQKDRPLTWSKEDSALVAERIQHEYFVHLLVDNLPVATRIVSVNNPAEVTYEHGYRLGQVDGDNIYINNHLKFILSYHMHSKDKYR---VVGFEVETVSVSHKELKFHGDTCNFPDSARPQLVNPNGETQLYFTYSVEWKESKVSWASRWDIYLGMRD------VQIHWFSIINSLVVVFFLSGILTMIMIRTLRRDIARYNTDDNIE---DTLEETGWKLVHGDVFRPPKNTRLFSAIIGSGIQIFFMALITIFFAMLGMLSPSSRGALMTSGIFMYVFMGTIAGYYAARLYKTMKGRE--------WKRAAFLTATLYPGIVFGTGFFLNFFIWDKSSS--------GAVPFTTMISLLLLWFGISVPLVYLGFYLGYRKQPY--QHPVRTNMIPRQVPTQHWYMNAVLSTLMAGILPFGAVFIELFFVFTAIWQNQFYYLFGFLFLVFCILVVSCAQISIVMTYFQLCGEDYRWWWRSFVVSGGSAVYVLFYSIFYFFTKLEITEFIPTLLYLGYTGLMVLTFWLLTGSIGFFAAYVFILRIYGAVKID 630          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF4 (gene:FBgn0028541 transcript:FBtr0343657)

HSP 1 Score: 271.166 bits (692), Expect = 1.388e-77
Identity = 180/603 (29.85%), Postives = 301/603 (49.92%), Query Frame = 2
Query:  224 YHYYTLPVCRPPEVS--FKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCT-----LQLKASDTKRLINAIEDLYYFEFVIDDIPI----------------RGF-IGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLN-----------------ITFTYSVHWISSPILVKDR--IKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLF-GIPLA-------FVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            Y YY+L  C P   +  FKS  LGEVL GDR+  + Y+++  + +    LC      L     D+  +   I+  Y+   ++D++P+                 G+ +G ++   +  + H   + ++H    D  +   + G  + T S     + + G   N                 + FTYSV W  S +    R  I   M++      ++IHW SI NSL++VF L   +  I+ R LRRD ARYN   + E   +  +E GWK+VH DVFRPP +  +F +IIG+G Q+  +++  +  A+  M +  + G +  + + +Y F   IAG+ + RL+K  +  +        W R    T +L+ GI          F+W   +S         A+P TT++ L+L+W  I  PL   G  LG R       +  R   I R++PT  WY +  +  L+ G LPF ++ IEL+++F+ +W  + Y L+G LF++F IL++    ++I +TYFQL  EDYRWWW +  ++G S ++V  Y IF++F + +++ FI ++ Y  Y+ L+   F+L  G++ F ++Y FI  +Y  +K+D
Sbjct:   58 YQYYSLRFCYPKNGTLIFKSENLGEVLRGDRIVNTPYEVRMNQQVNCRLLCNQKDRPLTWSKEDSALVAERIQHEYFVHLLVDNLPVATRIVSVNNPAEVTYEHGYRLGQVDGDNIYINNHLKFILSYHMHSKDKYR---VVGFEVETVSVSHKELKFHGDTCNFPDSARPQLVNPNGETQLYFTYSVEWKESKVSWASRWDIYLGMRD------VQIHWFSIINSLVVVFFLSGILTMIMIRTLRRDIARYNTDDNIE---DTLEETGWKLVHGDVFRPPKNTRLFSAIIGSGIQIFFMALITIFFAMLGMLSPSSRGALMTSGIFMYVFMGTIAGYYAARLYKTMKGRE--------WKRAAFLTATLYPGIVFGTGFFLNFFIWDKSSS--------GAVPFTTMISLLLLWFGISVPLVYLGFYLGYRKQPY--QHPVRTNMIPRQVPTQHWYMNAVLSTLMAGILPFGAVFIELFFVFTAIWQNQFYYLFGFLFLVFCILVVSCAQISIVMTYFQLCGEDYRWWWRSFVVSGGSAVYVLFYSIFYFFTKLEITEFIPTLLYLGYTGLMVLTFWLLTGSIGFFAAYVFILRIYGAVKID 630          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF2 (gene:FBgn0032880 transcript:FBtr0335149)

HSP 1 Score: 228.794 bits (582), Expect = 6.546e-63
Identity = 181/649 (27.89%), Postives = 303/649 (46.69%), Query Frame = 2
Query:  134 FAKEPKTFST-NEEVILYVNKVGPYYNPHET---YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASD---TKRLI---NAIEDLYYFEFVIDDIPIR--------------GF-IGNLEESK---------------LLPHTHKALLYTHHNIE-----IDYNQNNIIYGNILTTQS--------------DPINLMP---YQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTL---EIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYG--TTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            F K+    ST   E++LYVN++    N  E+   Y Y+    C   E +     LG+V+ G+R+    YKI+F EN + AT C    K  D    +R++     I   Y   +++D++P+               GF +G L  S                  P  H  L  T+H+ +     I +  +  I    +T +S              +P+ +       G+ L I +TYSV ++ +     D IK   + ++   ++    I W SI NSL++V  L   +  I+ R L +D ARYN     E   + Q+E GWK+VH DVFRPP   ++    +G+G Q++ +++  +  A     +  N G +   +++L+      AG+VS R++K F   +         +       SLF     FV  L     VL+G  ++ A+P +T++ L+ +W  +  PLT  G   G R   R   +  R   I R+IP    Y      +++GG LPF  I I+L++I S+LW  + Y ++G LF++F IL+I      I L YF L  EDY WWW +   +G + +++F+YC  ++  +  +     +  YF Y+ ++ + FFL  G + F + ++FI+ +Y  +K+D
Sbjct:   35 FCKKTDVSSTCKSEILLYVNRL----NTEESVIPYEYHHFDFCLGEEQNSPVENLGQVVFGERIRPGPYKIQFLENQQCATTCVKTYKGDDPASNRRMMVLKKGISLNYQHHWIVDNMPVTWCYPLENGKQYCGIGFPMGCLVRSDGEGCPINSIYNQPMHYYPFNHVDLEITYHSGQSEDWGIQFGNSGRIISVKVTPKSIKHTDKENPNCLSTEPLAISENSLKAGEQLEIVYTYSVKFVKN-----DSIKWSSRWDYILESMPHTNIQWFSILNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSGE---DAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGVQVLVMAMITLAFACLGFLSPANRGALMTCSMVLFVSLGTPAGYVSARIYKSFGGLKWKSNVILTSIVCPGVVFSLF-----FVMNL-----VLWGENSSGAVPFSTLIALLALWFGVSVPLTFVGAYFGFR--KRALEHPVRTNQIPRQIPDQSIYTQPIPGIVMGGVLPFGCIFIQLFFILSSLWSSQIYYMFGFLFLVFVILVITCSETTILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYCCHYFVTKLSIKDSASTFLYFGYTAIMVFLFFLLTGTIGFFACFWFIRKIYSVVKVD 659          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Match: TM9SF2 (gene:FBgn0032880 transcript:FBtr0081393)

HSP 1 Score: 228.794 bits (582), Expect = 6.546e-63
Identity = 181/649 (27.89%), Postives = 303/649 (46.69%), Query Frame = 2
Query:  134 FAKEPKTFST-NEEVILYVNKVGPYYNPHET---YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASD---TKRLI---NAIEDLYYFEFVIDDIPIR--------------GF-IGNLEESK---------------LLPHTHKALLYTHHNIE-----IDYNQNNIIYGNILTTQS--------------DPINLMP---YQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTL---EIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYG--TTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            F K+    ST   E++LYVN++    N  E+   Y Y+    C   E +     LG+V+ G+R+    YKI+F EN + AT C    K  D    +R++     I   Y   +++D++P+               GF +G L  S                  P  H  L  T+H+ +     I +  +  I    +T +S              +P+ +       G+ L I +TYSV ++ +     D IK   + ++   ++    I W SI NSL++V  L   +  I+ R L +D ARYN     E   + Q+E GWK+VH DVFRPP   ++    +G+G Q++ +++  +  A     +  N G +   +++L+      AG+VS R++K F   +         +       SLF     FV  L     VL+G  ++ A+P +T++ L+ +W  +  PLT  G   G R   R   +  R   I R+IP    Y      +++GG LPF  I I+L++I S+LW  + Y ++G LF++F IL+I      I L YF L  EDY WWW +   +G + +++F+YC  ++  +  +     +  YF Y+ ++ + FFL  G + F + ++FI+ +Y  +K+D
Sbjct:   35 FCKKTDVSSTCKSEILLYVNRL----NTEESVIPYEYHHFDFCLGEEQNSPVENLGQVVFGERIRPGPYKIQFLENQQCATTCVKTYKGDDPASNRRMMVLKKGISLNYQHHWIVDNMPVTWCYPLENGKQYCGIGFPMGCLVRSDGEGCPINSIYNQPMHYYPFNHVDLEITYHSGQSEDWGIQFGNSGRIISVKVTPKSIKHTDKENPNCLSTEPLAISENSLKAGEQLEIVYTYSVKFVKN-----DSIKWSSRWDYILESMPHTNIQWFSILNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSGE---DAQEEFGWKLVHGDVFRPPRKGMLLSVFLGSGVQVLVMAMITLAFACLGFLSPANRGALMTCSMVLFVSLGTPAGYVSARIYKSFGGLKWKSNVILTSIVCPGVVFSLF-----FVMNL-----VLWGENSSGAVPFSTLIALLALWFGVSVPLTFVGAYFGFR--KRALEHPVRTNQIPRQIPDQSIYTQPIPGIVMGGVLPFGCIFIQLFFILSSLWSSQIYYMFGFLFLVFVILVITCSETTILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYCCHYFVTKLSIKDSASTFLYFGYTAIMVFLFFLLTGTIGFFACFWFIRKIYSVVKVD 659          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf1 (transmembrane 9 superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-64])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 288/584 (49.32%), Postives = 401/584 (68.66%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDP--------INLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++   + V+LYVNKVGPY+NP ETYHYYTLPVCRP EV  K+L+LGEVLDGDRMA+S+Y I+F+EN ++ TLC L L   +  +L  AIE+LYYFEFV+DDIPI GF+G +EES  LPH+HK  L+TH ++ I+YN +++I+ N+      P        I+        L+IT TYSV W  + +    R +R+   +FFP TLEIHW+SI NSL+LV LL+ F++ I+ RVL+ DFARYN + D    + +Q + GWKI+H DVFR P +K + C+++G G Q +T++ GI++MAL  MFNVH HG IN AA++LY+ TS ++G+ SC  +   Q  +        WV  +  T++LF  PL F W + NSV    G+T A+P TT+L L+  W+++G+PLTV GG++GK       +  CR RNIAR+IP   WYK   +++ +GGFLPFS+I +ELYYIF+T WGREHY LYG+L  +F ILL V  C+++ LTYF L  EDYRWWW ++   G +G+F+F+Y +F+Y  RS MSG +QS+E+F YSLL  + F L LG VSF +S  FI+++YR++K+D
Sbjct:   35 SYKQGDPVVLYVNKVGPYHNPQETYHYYTLPVCRPKEVRHKALSLGEVLDGDRMAESLYNIRFKENADRLTLCKLTLSEKEVDQLREAIEELYYFEFVLDDIPIWGFVGYMEESGFLPHSHKVGLWTHLDLNIEYNGDSVIFANVSVKDVKPEPLEEGGAIHGAGVGSGGLSITHTYSVRWFETTLPHSRRAERLRDYSFFPKTLEIHWLSIINSLVLVVLLLGFVIIILMRVLKNDFARYNVEEDGGCDDLDQGDNGWKIIHTDVFRFPPYKSLLCAVLGVGAQFLTLATGIIVMALLGMFNVHRHGAINSAAIVLYALTSCVSGYCSCSFYTQIQGQR--------WVWNIILTSALFSAPLFFTWSVVNSVHWWSGSTQALPATTVLLLLGAWVLVGFPLTVIGGIVGKNRAGNFQAP-CRTRNIARQIPQQPWYKHTAVHMAIGGFLPFSAISVELYYIFATAWGREHYTLYGILLCVFAILLSVGACISVALTYFLLSGEDYRWWWRSVLSTGSTGIFIFVYSLFYYHNRSNMSGLVQSVEFFGYSLLTAFVFSLMLGTVSFWASLAFIRYIYRSLKMD 609          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf1 (transmembrane 9 superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-64])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 288/584 (49.32%), Postives = 401/584 (68.66%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDP--------INLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++   + V+LYVNKVGPY+NP ETYHYYTLPVCRP EV  K+L+LGEVLDGDRMA+S+Y I+F+EN ++ TLC L L   +  +L  AIE+LYYFEFV+DDIPI GF+G +EES  LPH+HK  L+TH ++ I+YN +++I+ N+      P        I+        L+IT TYSV W  + +    R +R+   +FFP TLEIHW+SI NSL+LV LL+ F++ I+ RVL+ DFARYN + D    + +Q + GWKI+H DVFR P +K + C+++G G Q +T++ GI++MAL  MFNVH HG IN AA++LY+ TS ++G+ SC  +   Q  +        WV  +  T++LF  PL F W + NSV    G+T A+P TT+L L+  W+++G+PLTV GG++GK       +  CR RNIAR+IP   WYK   +++ +GGFLPFS+I +ELYYIF+T WGREHY LYG+L  +F ILL V  C+++ LTYF L  EDYRWWW ++   G +G+F+F+Y +F+Y  RS MSG +QS+E+F YSLL  + F L LG VSF +S  FI+++YR++K+D
Sbjct:   35 SYKQGDPVVLYVNKVGPYHNPQETYHYYTLPVCRPKEVRHKALSLGEVLDGDRMAESLYNIRFKENADRLTLCKLTLSEKEVDQLREAIEELYYFEFVLDDIPIWGFVGYMEESGFLPHSHKVGLWTHLDLNIEYNGDSVIFANVSVKDVKPEPLEEGGAIHGAGVGSGGLSITHTYSVRWFETTLPHSRRAERLRDYSFFPKTLEIHWLSIINSLVLVVLLLGFVIIILMRVLKNDFARYNVEEDGGCDDLDQGDNGWKIIHTDVFRFPPYKSLLCAVLGVGAQFLTLATGIIVMALLGMFNVHRHGAINSAAIVLYALTSCVSGYCSCSFYTQIQGQR--------WVWNIILTSALFSAPLFFTWSVVNSVHWWSGSTQALPATTVLLLLGAWVLVGFPLTVIGGIVGKNRAGNFQAP-CRTRNIARQIPQQPWYKHTAVHMAIGGFLPFSAISVELYYIFATAWGREHYTLYGILLCVFAILLSVGACISVALTYFLLSGEDYRWWWRSVLSTGSTGIFIFVYSLFYYHNRSNMSGLVQSVEFFGYSLLTAFVFSLMLGTVSFWASLAFIRYIYRSLKMD 609          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2714])

HSP 1 Score: 317.775 bits (813), Expect = 2.984e-94
Identity = 187/578 (32.35%), Postives = 317/578 (54.84%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++  EEV+L++N VGPY+N  ETY Y++LP C      +S    TLGE L G  +  S   IKF+E + + T C ++L        + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI +N N I+  N+  T    + L+P       I  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H LIF S+IG+GCQ+ ++S+ ++++A+          +++  A+ +Y+ TS + G+        F  +   ++    W++ +     L    +       N +++ Y  + A+P  T++ +  + L +  PL + G +LG+    + +   CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GAV ++ +  F++ +Y N+K+D
Sbjct:   32 YTDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGTKKTISHYHETLGEALQGVELEFSGLDIKFKEEVLQTTYCDIELDKPKRDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDYYLWTYKKLEIGHNGNRIVDVNL--TSEGKVKLVPNT----RIPMSYSVKWKKSDVKFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQIFSVSLIVIILAMIEDLYTERGSMLS-TAIFVYAATSPVNGY--------FGGSLYAKQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICLFVILPLNLVGTILGRNLSGQPNFP-CRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID 586          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2714])

HSP 1 Score: 317.775 bits (813), Expect = 2.984e-94
Identity = 187/578 (32.35%), Postives = 317/578 (54.84%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++  EEV+L++N VGPY+N  ETY Y++LP C      +S    TLGE L G  +  S   IKF+E + + T C ++L        + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI +N N I+  N+  T    + L+P       I  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H LIF S+IG+GCQ+ ++S+ ++++A+          +++  A+ +Y+ TS + G+        F  +   ++    W++ +     L    +       N +++ Y  + A+P  T++ +  + L +  PL + G +LG+    + +   CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GAV ++ +  F++ +Y N+K+D
Sbjct:   32 YTDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGTKKTISHYHETLGEALQGVELEFSGLDIKFKEEVLQTTYCDIELDKPKRDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDYYLWTYKKLEIGHNGNRIVDVNL--TSEGKVKLVPNT----RIPMSYSVKWKKSDVKFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQIFSVSLIVIILAMIEDLYTERGSMLS-TAIFVYAATSPVNGY--------FGGSLYAKQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICLFVILPLNLVGTILGRNLSGQPNFP-CRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID 586          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Match: tm9sf4 (transmembrane 9 superfamily protein member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1575])

HSP 1 Score: 287.73 bits (735), Expect = 6.134e-83
Identity = 184/612 (30.07%), Postives = 305/612 (49.84%), Query Frame = 2
Query:  224 YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCT-----LQLKASDTKRLINAIEDLYYFEFVIDDIPI-----------------------------RGF-IGNLEESKLLPHTHKA-LLYTHHNIEIDYNQNNI----------------IYGNILTTQSDPINLMPYQGKVL-----NITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTH---AMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            Y YY+LP C+P  + +K+  LGEVL GDR+  ++Y +    + +   LC      ++L   ++K L   I++ YY   + D++P+                              G+ +G  E +K   H H + +LY H     D  ++N                 I  +   T + P  + P   ++      NI FTYSVHW  S +    R    +  +     ++IHW SI NS+++VF L   +  II R LR+D A YN + D E   +  +E GWK VH DVFRPP + +I  S++G+G Q+ ++ + ++ +A+  M +  + G +   A  L+ F     G+ + RL++  +  +        W +    T +L+    A V+ +C  ++      H   A+P TT+L L+ +W  I  PL   G   G R       N  R   I R++P   WY +K++ +L+ G LPF ++ IEL++IFS +W  + Y L+G LF++F IL++    ++I + YFQL  EDYRWWW T  ++G S  +V +Y IF++  +  +  FI S+ YF Y+ L+  +F+L  G + F ++Y FI+ +Y  +K+D
Sbjct:   60 YEYYSLPFCKPENIVYKAENLGEVLRGDRIVNTLYTVFMNLDKKCEVLCKKPESPIKLSVEESKLLAERIQEEYYIHLIADNLPVATRLELYPNKEEAIDEEQKKDTLKDVQFEHGYRLGFTENNKFYLHNHLSFILYFHKEKLEDAEEHNYRVVRFEVMPKSVKLEDIKADDRGTCTLPETVAPVPQEIDPSKENNILFTYSVHWQESEVKWASRWDTYLTMS----DVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNREDDIE---DTMEESGWKNVHGDVFRPPQYPMILSSLLGSGIQMFSMVLIVIFVAMLGMLSPSSRGALMTTACFLFMFMGLFGGYFAGRLYRTLKGHR--------WKKGAFCTATLYP---AVVFGICFVLNCFIWGEHSSGAVPFTTMLALLCMWFGISLPLVYLGYYFGFRKQPY--DNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFLVSGGSAFYVLIYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYVFIRKIYAAVKID 651          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: vwa1 (von Willebrand factor A domain containing 1 [Source:Xenbase;Acc:XB-GENE-956807])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 296/586 (50.51%), Postives = 407/586 (69.45%), Query Frame = 2
Query:  137 AKEPKT----FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNE-EQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            A  P T    +   + V++YVNKVGPY+NP ETYHYY LPVC P ++  KSLTLGEVLDGDRMA+S+Y+I FR+N+E+ TLC ++L  S  + L  AIE+LYYFEFV+DDIPIRGF+G +EES  LPHTHK  L+ H +I I+YN + IIY N+      P +L   + + L++T TYS+HW  S +  + R  R+  ++FFP +LEIHW+SI NS++LVFLL+ F++ I+ RVL+ D ARYN   D E  ++ EQ + GWKI+H DVFR P ++ + C+++G G Q + +  GI++M L  +FNVH HG IN AA++LY+ T  ++G+VS   ++        Q     WV  +  TTSLF  P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK +    ++  CR +NIAREIP   WYKS  +++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LFI+F ILL V  C+++ LTYFQL  EDYRWWW ++   G +G F+FLY +F+Y+ RS MSG +Q++E+F YS L  Y FFL LGAVSF +S  FI+++Y N+K+D
Sbjct:   69 APSPATGDNRYKPGDPVMMYVNKVGPYHNPQETYHYYQLPVCAPEQIRHKSLTLGEVLDGDRMAESMYRITFRQNVERQTLCEMKLSLSQVEELRRAIEELYYFEFVLDDIPIRGFLGYMEESGFLPHTHKIGLWAHLDINIEYNDDRIIYSNVSVRDVKPFSLDDVR-ETLSLTHTYSIHWFPSTVTYERRGDRLRDSSFFPKSLEIHWLSIINSMVLVFLLLGFVVIILMRVLKSDLARYN--LDEEGADDMEQGDNGWKIIHTDVFRFPPYRSLLCAVLGVGFQFLALGTGIIVMVLLGLFNVHRHGAINSAAILLYALTCCVSGYVSSNFYR--------QLGGDRWVWNIVLTTSLFSAPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNSAVNFEAP-CRTKNIAREIPRQPWYKSAPVHMAIGGFLPFSAISVELYYIFATVWGREQYTLYGILFIVFAILLSVGACISVALTYFQLSGEDYRWWWRSVLSTGSTGAFIFLYSVFYYWRRSNMSGVVQTVEFFGYSFLTAYVFFLMLGAVSFTASLRFIRYIYINLKMD 642          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: vwa1 (von Willebrand factor A domain containing 1 [Source:Xenbase;Acc:XB-GENE-956807])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 293/576 (50.87%), Postives = 404/576 (70.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNE-EQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + V++YVNKVGPY+NP ETYHYY LPVC P ++  KSLTLGEVLDGDRMA+S+Y+I FR+N+E+ TLC ++L  S  + L  AIE+LYYFEFV+DDIPIRGF+G +EES  LPHTHK  L+ H +I I+YN + IIY N+      P +L   + + L++T TYS+HW  S +  + R  R+  ++FFP +LEIHW+SI NS++LVFLL+ F++ I+ RVL+ D ARYN   D E  ++ EQ + GWKI+H DVFR P ++ + C+++G G Q + +  GI++M L  +FNVH HG IN AA++LY+ T  ++G+VS   ++        Q     WV  +  TTSLF  P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK +    ++  CR +NIAREIP   WYKS  +++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LFI+F ILL V  C+++ LTYFQL  EDYRWWW ++   G +G F+FLY +F+Y+ RS MSG +Q++E+F YS L  Y FFL LGAVSF +S  FI+++Y N+K+D
Sbjct:   36 YKPGDPVMMYVNKVGPYHNPQETYHYYQLPVCAPEQIRHKSLTLGEVLDGDRMAESMYRITFRQNVERQTLCEMKLSLSQVEELRRAIEELYYFEFVLDDIPIRGFLGYMEESGFLPHTHKIGLWAHLDINIEYNDDRIIYSNVSVRDVKPFSLDDVR-ETLSLTHTYSIHWFPSTVTYERRGDRLRDSSFFPKSLEIHWLSIINSMVLVFLLLGFVVIILMRVLKSDLARYN--LDEEGADDMEQGDNGWKIIHTDVFRFPPYRSLLCAVLGVGFQFLALGTGIIVMVLLGLFNVHRHGAINSAAILLYALTCCVSGYVSSNFYR--------QLGGDRWVWNIVLTTSLFSAPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNSAVNFEAP-CRTKNIAREIPRQPWYKSAPVHMAIGGFLPFSAISVELYYIFATVWGREQYTLYGILFIVFAILLSVGACISVALTYFQLSGEDYRWWWRSVLSTGSTGAFIFLYSVFYYWRRSNMSGVVQTVEFFGYSFLTAYVFFLMLGAVSFTASLRFIRYIYINLKMD 599          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:100491663])

HSP 1 Score: 316.235 bits (809), Expect = 1.297e-93
Identity = 185/579 (31.95%), Postives = 315/579 (54.40%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            T+   EEV+L++N VGPY+N  ETY Y++LP C      +S    TLGE L G  +  S   IKF++++ + + C + L        + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI YN N I+  N+  T    + L+P       +  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H L+F S+IG+GCQ+  +S+ ++++A+          +++  A+ +Y+ TS + G+        F  +   ++    W++ +     L    +       N +++ Y  + A+P  T++ +  +   +  PL + G +LG R  A   +  CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GA+ ++ +  F++ +Y N+K+D
Sbjct:   24 TYDDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMQTSYCEIDLTKGKKDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDYYLWTYKKLEIGYNGNRIVDVNL--TSEGKVKLVPNT----KVQMSYSVKWKKSDVRFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLMFSSLIGSGCQIFAVSLIVIIVAMIEDLYTERGSMLS-TAIFVYAATSPVNGY--------FGGSLYARQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILG-RNLAGQPNFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 579          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:100491663])

HSP 1 Score: 314.309 bits (804), Expect = 7.787e-93
Identity = 184/578 (31.83%), Postives = 314/578 (54.33%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   EEV+L++N VGPY+N  ETY Y++LP C      +S    TLGE L G  +  S   IKF++++ + + C + L        + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI YN N I+  N+  T    + L+P       +  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H L+F S+IG+GCQ+  +S+ ++++A+          +++  A+ +Y+ TS + G+        F  +   ++    W++ +     L    +       N +++ Y  + A+P  T++ +  +   +  PL + G +LG R  A   +  CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GA+ ++ +  F++ +Y N+K+D
Sbjct:   30 YDDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMQTSYCEIDLTKGKKDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDYYLWTYKKLEIGYNGNRIVDVNL--TSEGKVKLVPNT----KVQMSYSVKWKKSDVRFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLMFSSLIGSGCQIFAVSLIVIIVAMIEDLYTERGSMLS-TAIFVYAATSPVNGY--------FGGSLYARQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILG-RNLAGQPNFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 584          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Match: TM9SF3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:100491663])

HSP 1 Score: 313.923 bits (803), Expect = 1.151e-92
Identity = 184/578 (31.83%), Postives = 314/578 (54.33%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   EEV+L++N VGPY+N  ETY Y++LP C      +S    TLGE L G  +  S   IKF++++ + + C + L        + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI YN N I+  N+  T    + L+P       +  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H L+F S+IG+GCQ+  +S+ ++++A+          +++  A+ +Y+ TS + G+    L+         ++    W++ +     L    +       N +++ Y  + A+P  T++ +  +   +  PL + G +LG R  A   +  CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GA+ ++ +  F++ +Y N+K+D
Sbjct:   38 YDDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMQTSYCEIDLTKGKKDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDYYLWTYKKLEIGYNGNRIVDVNL--TSEGKVKLVPNT----KVQMSYSVKWKKSDVRFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLMFSSLIGSGCQIFAVSLIVIIVAMIEDLYTERGSMLS-TAIFVYAATSPVNGYFGGSLYA--------RQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILG-RNLAGQPNFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID 592          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf1 (transmembrane 9 superfamily member 1 [Source:MGI Symbol;Acc:MGI:1921390])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 293/580 (50.52%), Postives = 403/580 (69.48%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   +++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  T+SLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf1 (transmembrane 9 superfamily member 1 [Source:MGI Symbol;Acc:MGI:1921390])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 293/580 (50.52%), Postives = 403/580 (69.48%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   +++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  T+SLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf1 (transmembrane 9 superfamily member 1 [Source:MGI Symbol;Acc:MGI:1921390])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 293/580 (50.52%), Postives = 403/580 (69.48%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   +++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  T+SLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf1 (transmembrane 9 superfamily member 1 [Source:MGI Symbol;Acc:MGI:1921390])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 293/580 (50.52%), Postives = 403/580 (69.48%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   +++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  T+SLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Match: Tm9sf1 (transmembrane 9 superfamily member 1 [Source:MGI Symbol;Acc:MGI:1921390])

HSP 1 Score: 533.102 bits (1372), Expect = 9.571e-174
Identity = 281/580 (48.45%), Postives = 388/580 (66.90%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNE--EQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   ++  +Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  T+SLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP                     +I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQP-----------------CAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 589          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q9DBU0|TM9S1_MOUSE (Transmembrane 9 superfamily member 1 OS=Mus musculus OX=10090 GN=Tm9sf1 PE=2 SV=2)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 293/580 (50.52%), Postives = 403/580 (69.48%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   +++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  T+SLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTSSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q5R8F1|TM9S1_PONAB (Transmembrane 9 superfamily member 1 OS=Pongo abelii OX=9601 GN=TM9SF1 PE=2 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 292/580 (50.34%), Postives = 398/580 (68.62%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  +++  + II+ N+      P +L   +  + L +T  YSV W  + +  +   +      FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFRGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHAYSVRWSETSVERRSDRRHGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|O15321|TM9S1_HUMAN (Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 PE=2 SV=2)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 294/580 (50.69%), Postives = 401/580 (69.14%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  I++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|A4IFE9|TM9S1_BOVIN (Transmembrane 9 superfamily member 1 OS=Bos taurus OX=9913 GN=TM9SF1 PE=2 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 295/591 (49.92%), Postives = 404/591 (68.36%), Query Frame = 2
Query:  137 AKEPKT-----FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQ-GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNEE--QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
             +EP       +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  + L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S    ++  Q + GWKI+H DVFR P ++ + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP   WYKS  +++ +GGFLPFS+I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   25 GREPGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRVLCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETASAGSGDDFDQSDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQPWYKSTLVHMTVGGFLPFSAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGTVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 606          
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Match: sp|Q66HF2|TM9S1_RAT (Transmembrane 9 superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Tm9sf1 PE=2 SV=1)

HSP 1 Score: 532.717 bits (1371), Expect = 8.992e-173
Identity = 282/580 (48.62%), Postives = 388/580 (66.90%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQG-KVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYN--NQTDSELMNE--EQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   + VILYVNKVGPY+NP ETYHYY LPVC P ++  KSL+LGEVLDGDRMA+S+Y+I+FREN+EK  LC +QL ++  ++L  AIE+LYYFEFV+DD+PIRGF+G +EES  LPH+HK  L+TH +  ++++ + II+ N+      P +L   +  ++L +T TYSV W  + +  +   +R     FFP TLEIHW+SI NS++LVFLL+ F+  I+ RVLR D ARYN   +T S   ++  +Q + GWKI+H DVFR P  + + C+++G G Q + +  GI++MAL  MFNVH HG IN AA++LY+ T  I+G+VS   ++        Q     WV  +  TTSLF +P    W + NSV    G+T A+P+TTIL L+ VWL++G+PLTV GG+ GK   +  D+  CR +NIAREIP                     +I +ELYYIF+T+WGRE Y LYG+LF +F ILL V  C++I LTYFQL  EDYRWWW ++   G +GLF+FLY +F+Y  RS MSG +Q++E+F YSLL  Y FFL LG +SF SS  FI+++Y N+K+D
Sbjct:   36 YKPGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRADDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTDVFRFPPCRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCISGYVSSHFYR--------QIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPVTTILLLLTVWLLVGFPLTVIGGIFGKNNASPFDAP-CRTKNIAREIPPQP-----------------CAISVELYYIFATVWGREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNMSGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD 589          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A2T7PGA7 (Transmembrane 9 superfamily member OS=Pomacea canaliculata OX=400727 GN=C0Q70_07824 PE=3 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 311/573 (54.28%), Postives = 413/573 (72.08%), Query Frame = 2
Query:  173 VILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINL----MPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            V++YVNKVGPY+NPHETYHYY LPVCRP +V  KSLTLGEVLDGDRMA S+Y I FR+ + K  LC ++    D + L  AIEDLYYFEFVIDDIP+RGFIG+LEE   LPH HK  L+ H +  I+YN ++IIY N+ T +  PINL     P++     +TFTYSVHW  + +  +DR KR+ +N FFP TLEIHW+SI NS++LVFLL+ F++ I++RVL+ DFARYN   D E    +QD+ GWKI+  DVFR P  K IFC+I+G G Q + ++ GI++MAL  MFNVH HG IN AA++LY+FTS I+G+V+  +++        +    +WV  +N T++LF  P   VW + NSV+  YG T A+P TT++ L+ +W+ IGYPLTV GG+ GK      D+  CR +NIAREIP+V  Y+S   + ++GGFLPFS+I +ELYYIF+TLWGRE Y L+G+LFI++ ILL VT C+++ LTYFQL  EDYRWWW ++  AG +GLFVFLY +F+YF RS MSG +Q+IE+F Y+LL CY FFL LG VSF +S  F++++Y N+K+D
Sbjct:   61 VLVYVNKVGPYFNPHETYHYYQLPVCRPDKVEHKSLTLGEVLDGDRMAVSLYNITFRKEVAKDELCKVKYSEKDLELLRTAIEDLYYFEFVIDDIPVRGFIGHLEEGGFLPHNHKVFLWAHLSFNIEYNGDHIIYANVSTKEQAPINLDGVTTPFE-----VTFTYSVHWFPNELKYEDRGKRMRENYFFPKTLEIHWLSIINSMVLVFLLIGFVVIILTRVLKSDFARYNLGEDDESDELDQDDNGWKIIQTDVFRFPPAKSIFCAILGVGSQFLALATGILMMALLGMFNVHRHGAINAAAIVLYAFTSCISGYVAANMYR--------KMGGESWVWNINLTSALFAGPFFLVWSVINSVAWAYGATQALPWTTVVLLMALWVFIGYPLTVIGGIFGKNWAQGFDAP-CRTKNIAREIPSVPLYRSTLAHCVVGGFLPFSAISVELYYIFATLWGREQYTLFGILFIVYGILLSVTACISVALTYFQLSAEDYRWWWRSIFSAGSTGLFVFLYAMFYYFKRSNMSGMLQTIEFFGYTLLTCYVFFLMLGTVSFFASLKFVRYIYVNLKMD 619          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A2C9JUC3 (Transmembrane 9 superfamily member OS=Biomphalaria glabrata OX=6526 GN=106068646 PE=3 SV=1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 307/577 (53.21%), Postives = 417/577 (72.27%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLE-KATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            T+   E+V++YVNKVGPY+NPHETYHYY LPVCRP ++  KSLTLGEVLDGDRMA S+Y I++R ++  K  LC ++   +D + L +AIEDLYYFEFV+DDIPIRGFIG+LEE   LPHTHK  L+ H +  I+YNQ++IIY N+ T +  PI+L       L + FTY+V W+ + +    R  R+  N+FFP  LEIHW+SI NSL+LVFLL+ F++ I++RVL+ DFARYN + + +  + + D+ GWKI+  DVFR P +K +FC+I+G G Q + ++ GI+LMAL+ MFNVH HG IN AA++LY+FTS I+GFV+  + K        +    NWV  +N T++LF +P  FVW + NSV+  YGTT A+P TT++ L+ +W+ IGYPLTV GG+ GK      D+  CR +NIAREIP+V WY+S   +  +GGFLPFS+I +ELYYIF+TLWGRE Y L+G+LFI++ ILL VT C++I LTYFQL  EDYRWWW ++  AG +GLFVFLY +F+Y+ RS MSG +Q++E+  Y+ L CY FFL L  VSF +S  F++++Y NIK+D
Sbjct:   22 TYKEGEKVLVYVNKVGPYFNPHETYHYYQLPVCRPDKIEHKSLTLGEVLDGDRMALSLYDIQYRMDIPTKTELCKVKYSENDLELLRSAIEDLYYFEFVLDDIPIRGFIGHLEEGGFLPHTHKIYLWVHLHFNIEYNQDHIIYANVTTKEQLPISL-DGASTPLEVAFTYTVKWVQTDLTYDQRGTRLRDNSFFPKNLEIHWLSIINSLVLVFLLIGFVVIIMTRVLKSDFARYNIEDEEDTDDLDSDDNGWKIIRTDVFRFPPNKNLFCAILGVGSQFLALATGILLMALAGMFNVHRHGAINAAAVVLYAFTSSISGFVAANMFK--------KMGGENWVWNINLTSALFAVPFFFVWAVINSVAWAYGTTRALPATTVILLMALWVFIGYPLTVLGGIFGKNYAGTFDAP-CRTKNIAREIPSVPWYRSALAHCAIGGFLPFSAISVELYYIFATLWGREQYTLFGILFIVYGILLSVTACISIALTYFQLSAEDYRWWWRSIFSAGSTGLFVFLYALFYYYKRSNMSGLLQTLEFLGYTALTCYVFFLMLATVSFFASLKFVRYIYVNIKMD 588          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A210Q7G4 (Transmembrane 9 superfamily member OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24036 PE=3 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 303/580 (52.24%), Postives = 417/580 (71.90%), Query Frame = 2
Query:  143 EPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNE-EQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   +   E+V++YVNKVGPY+NPHETYHYY LPVCRP ++  KSLTLGEVLDGDRMA S+Y + F++N +K  LC +     + + L +AIED+YYFEFVIDDIP+RGFIG+LEE   LPHTHK  L+ H NI I+YN + IIY N+ T +  P+ L         + FTYS+ W ++ +  ++R KR+  N+FFP TLEIHW+SI NS++LVFLL+ F++ I++RVL+ DFARYN   D E  ++ + D+ GWKI+H+DVFR P  K +FC+I+G G Q + ++ GIM+MA+  MFNVH HG IN A ++L++FTS IAG+V+  +++        +    NWV  +N T+ LF  P  FVW + NSV+  YGTT A+P TT++ L+ +WL +GYPLTV GG+ GK      D+  CR +NI+REIP V WY+S + + ++GGFLPFS+I +ELYYIF+TLWGRE Y LYG+LFI++ ILL VT C+++ LTYFQL  EDYRWWW ++  AG +G+FVFLY +F+YF RS MSG +Q++E+F Y+ L CY FFL LG VSF +S  F++++Y N+K+D
Sbjct:   17 DATNYKEGEKVLMYVNKVGPYFNPHETYHYYQLPVCRPKKIEHKSLTLGEVLDGDRMALSMYDLAFKKNSDKKELCKVAYTEDELQLLRDAIEDMYYFEFVIDDIPVRGFIGHLEEGGYLPHTHKIYLWAHLNINIEYNGDQIIYANVTTKEQAPVGLDSAVTAPFEVAFTYSIKWHTTEMKYEERGKRVRDNSFFPKTLEIHWLSIINSMVLVFLLIGFVVIILTRVLKSDFARYN--VDEEESDDLDNDDNGWKIIHSDVFRFPAFKSLFCAILGVGTQFLALATGIMMMAMMGMFNVHRHGAINSAGIILFAFTSCIAGYVAANMYR--------KLGGDNWVWNINLTSCLFAAPFFFVWAVVNSVAWGYGTTQALPWTTVVLLMCLWLFVGYPLTVLGGIFGKNWANGFDAP-CRTKNISREIPPVPWYRSSFAHCVVGGFLPFSAISVELYYIFATLWGREQYTLYGILFIVYGILLSVTACISVALTYFQLSAEDYRWWWRSIFSAGSTGIFVFLYAMFYYFKRSNMSGALQTLEFFGYTALSCYVFFLMLGTVSFFASLNFVRYIYVNLKMD 585          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A3M7Q952 (Transmembrane 9 superfamily member (Fragment) OS=Brachionus plicatilis OX=10195 GN=BpHYR1_046575 PE=3 SV=1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 301/581 (51.81%), Postives = 412/581 (70.91%), Query Frame = 2
Query:  137 AKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            + E   +   + V +YVNKVGPY+NPHETYH+Y+LP+CRP ++  +SLTLGEVLDGDRMAKS+Y +KF+++L+ A LCT+ L     ++L  AIEDLYYFEFV+DDIP+RGF+G LEE  L+PHTH   LYTH++    YN++ IIY N+ T Q  P  L      +  +TFTYSV+W  S I  ++R K +    FFP TLEIHW+SI NS+ILVFLL+ F++ I+SRVL+ DF RYN + +  L +E+    GWK++ NDVFR P+HKL+FCSI+G G Q + ++ GI+LMA+  +FNVH HG +N AA +LY+ TS IAGFVS + ++        Q +   WV  +N T  L+ +P    W + N+V+  YG+T A+P TTI+ L LVW+VIGYPLTV GG++GK +    D+  CR +NI REIP + WY+S   ++++GGFLPFS+I +ELYYIFSTLWGR+ Y LYG+L I+F ILL VT C++I+LTYFQL +EDYRWWW ++  +G +GLFV  Y IF +  RS MSG +Q++++F Y+ L CY F L LG V + +S  FI+++Y NIK+D
Sbjct:   29 SSEAIKYKDADHVEVYVNKVGPYWNPHETYHFYSLPLCRPEKIEHRSLTLGEVLDGDRMAKSMYDVKFKQSLDSAQLCTITLNQEQIEQLKLAIEDLYYFEFVVDDIPMRGFVGQLEEGNLIPHTHHTYLYTHYDFYFFYNEDRIIYANVSTKQRAPSKLDDVIAPI-ELTFTYSVYWEKSNITFQNRGKLLRSTGFFPKTLEIHWLSIINSIILVFLLLGFVVIILSRVLKNDFLRYNAEGEESLDDEDY---GWKLISNDVFRFPSHKLLFCSILGVGTQFLVLAFGILLMAMLGLFNVHRHGSLNTAAFLLYALTSGIAGFVSSKNYR--------QMNGEKWVWNINLTACLYTVPFFLTWSIINTVAWAYGSTQALPFTTIVVLGLVWIVIGYPLTVFGGIIGKNSSGSFDAP-CRTKNICREIPPIPWYRSTLSHMMIGGFLPFSAISVELYYIFSTLWGRDQYTLYGILGIVFVILLSVTACISISLTYFQLASEDYRWWWRSILTSGATGLFVLAYAIFFFAKRSNMSGGLQTLQFFGYTFLTCYIFCLMLGTVGYYTSLKFIRYIYFNIKMD 596          
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Match: A0A0B6ZUX6 (Transmembrane 9 superfamily member (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF81313 PE=3 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 301/577 (52.17%), Postives = 415/577 (71.92%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLE-KATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++   ++V++YVNKVGPY+NPHETYHYY LPVCRP ++  KSLTLGEVLDGDRMA S+Y I FR ++  K  LC +    +D + L NAIEDLYYFEFV+DDIP+RGFIG+LEE   LPH HK  L++H +  I+YN++NIIY N+ T    PI+L       L I FTY+V WI + +  + R  RI  ++FFP  LEIHW+SI NSL+LVFLL+ F++ I++RVLR DFARYN + D +  + + D+ GWKI+  DVFR P  + +FC+I+G G Q + ++ GI+LMAL+ MFN+H HG IN AA++LY+FTS I+G+V+  ++K        +    +WV  +N T++LF +P   VW + NSV+  YGTT A+P +T++ L+ +WL IGYPLTV GG+ GK      D+  CR +NI+REIP+V WY+S +++  +GGFLPFS+I +ELYYIF+TLWGRE Y L+G+LF+++ ILL VT C++I LTYFQL  EDYRWWW ++  AG +G+FVFLY +F+Y  RS MSG +Q++E+  Y+ L CY FFL L  VSF +S  F++++Y NIK+D
Sbjct:   43 SYKEGDKVLVYVNKVGPYFNPHETYHYYQLPVCRPDKIEHKSLTLGEVLDGDRMALSLYDITFRTDMTTKKELCKVNFSENDLELLRNAIEDLYYFEFVLDDIPVRGFIGHLEEGSFLPHNHKIFLWSHLHFNIEYNKDNIIYANVTTKDQLPISL-DGTSVPLEIAFTYTVTWIPTELSFEQRATRIRDDSFFPKNLEIHWLSIINSLVLVFLLIGFVVIIMTRVLRSDFARYNIEDDEDTDDLDSDDNGWKIIRTDVFRYPPCRNLFCAILGVGSQFLALATGILLMALAGMFNIHRHGSINAAAVVLYAFTSSISGYVAANMYK--------KMGGDSWVWNINLTSALFALPFFLVWAVINSVAWAYGTTRALPASTVILLMALWLFIGYPLTVLGGIFGKNYAGSFDAP-CRTKNISREIPSVPWYRSVFVHCAIGGFLPFSAISVELYYIFATLWGREQYTLFGILFVVYGILLSVTACISIALTYFQLSAEDYRWWWRSIFSAGSTGVFVFLYALFYYCKRSNMSGLLQTLEFLGYTALTCYVFFLMLATVSFFASLKFVRYIYVNIKMD 609          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf1 (transmembrane 9 superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-64])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 288/586 (49.15%), Postives = 396/586 (67.58%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINL----------MPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            ++   + V LYVNKVGPY+NP ETYHYYTLPVCRP EV  K+L+LGEVLDGDRMA+S+YKI FREN E+ TLC L L   +  +L  AIE+LYYFEFV+DD+PI GF+G +EES  LPH+HK  L+TH +  I+YN +++I+ N+      P+ L               + L +T TYSV W  SP+    R  R+   +FFP TLEIHW+SI NSL+LV LL+ F++ I+ RVL+ DFARYN + D    + +Q + GWKI+H DVFR P +K + C+++G G Q +T++ GI++MAL  MFNVH HG IN AA++LY+ TS ++G+ SC  +      +        WV  +  T+SLF  PL   W + NSV    G+T A+P +T+L L+  W+++G+PLTV GG++GK       +  CR RNI R+IP   WYK   +++ +GGFLPFS+I +ELYYIF+T+WGREHY LYG+L  +F ILL V  C+++ LTYF L  EDYRWWW ++   G +GLF+F+Y +F+Y  RS MSG +QS+E+F YSLL  + F L LG VSF +S  FI+++Y ++K+D
Sbjct:   78 SYKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKEVRHKALSLGEVLDGDRMAESLYKIHFRENTERQTLCQLSLTEKEVDQLREAIEELYYFEFVLDDVPIWGFVGYMEESGFLPHSHKVGLWTHLDFNIEYNGDSVIFANVSVKDVKPVPLEEGGGGAGHGAGGSTEGLTVTHTYSVRWFESPLPHSRRADRLRDYSFFPKTLEIHWLSIINSLVLVVLLLGFVIIILMRVLKNDFARYNVEEDGSCDDLDQGDNGWKIIHTDVFRFPTYKSLLCAVLGVGAQFLTLATGIIIMALLGMFNVHRHGAINSAAIVLYALTSCVSGYCSCSFYTQIHGQR--------WVWNIILTSSLFSAPLFLTWSIVNSVHWWSGSTQALPASTVLLLLGAWVLVGFPLTVIGGIVGKNRAGSFQAP-CRTRNIPRQIPQQPWYKHTAVHMAIGGFLPFSAISVELYYIFATVWGREHYTLYGILLCVFAILLSVGACISVALTYFLLSGEDYRWWWRSVLSTGSTGLFIFVYSLFYYHNRSSMSGLVQSVEFFGYSLLTAFVFSLMLGTVSFWASLAFIRYIYCSLKMD 654          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:103034528])

HSP 1 Score: 317.775 bits (813), Expect = 2.378e-94
Identity = 188/580 (32.41%), Postives = 318/580 (54.83%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVC--RPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMA-LSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            T++  EEV+L++N VGPY+N  ETY Y++LP C      +S    TLGE L G  +  S   IKF++ + + T C + L        + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI +N N I+  N+  T    + L+P       I  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H LIF S+IG+GCQ+ ++S+ ++++A L +++     G +   A+ +Y+ TS + G+        F  +   ++    W++ +     L    +       N +++ Y  + A+P  T++ +  +   +  PL + G +LG+    + +   CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GAV ++ +  F++ +Y N+K+D
Sbjct:   32 TYTDKEEVVLWMNTVGPYHNRQETYKYFSLPFCAGNKKTISHYHETLGEALQGVELEFSGLDIKFKDEVMQTTYCEIDLDKPKKDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDHYLWTYKKLEIGFNGNRIVDVNL--TSEGKVKLVPNT----RIAMSYSVKWKKSDVKFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQIFSVSLIVIIVAMLEDLYT--ERGSMLSTAIFVYAATSPVNGY--------FGGSLYAKQGGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILGRNLSGQPNFP-CRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID 587          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf4 (transmembrane 9 superfamily member 4 [Source:NCBI gene;Acc:103036276])

HSP 1 Score: 284.263 bits (726), Expect = 6.268e-82
Identity = 186/638 (29.15%), Postives = 313/638 (49.06%), Query Frame = 2
Query:  146 PKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLC-----TLQLKASDTKRLINAIEDLYYFEFVIDDIPI----------------------------RGF-IGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIY--------------------GNILTTQSDPINLMPYQ---GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTH---AMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            P  F  N+ V +   K+         Y YY+LP CRP  V +K+  LGEVL GDR+  ++Y++K  ++ +   +C       +L   ++K +   I++ YY   + D++P+                             G+ +G  + +K   H H + +  +H  +++ +Q+   +                    G    T  D     P +    K  ++ FTYSVHW  S +    R    +  +     ++IHW SI NS+++VF L   +  II R LR+D A YN + D E   +  +E GWK VH DVFRPP + +I  S++G+G QL  + + ++ +A+  M +  + G +   A  L+ F     G+ + RL++  +  +        W +    T +L+    A V+ +C  ++      H   A+P TT+L L+ +W  I  PL   G   G R       N  R   I R++P   WY +K++ +L+ G LPF ++ IEL++IFS +W  + Y L+G LF++F IL++    ++I + YFQL  EDYRWWW T  ++G S  +V +Y IF++  +  +  FI S+ YF Y+ L+  +F+L  G + F ++Y FI+ +Y  +K+D
Sbjct:   35 PMDFHQNDPVDIKAVKLTSS-RTQLPYEYYSLPFCRPENVVYKAENLGEVLRGDRIVNTLYQMKMNQDKKCELVCGKPDNPTKLTIVNSKLIAERIQEEYYIHLIADNLPVATRLEFYPNREAGTDEEKKDAMKDVQFEHGYRLGFTDNNKFYLHNHLSFILYYHKEKVE-DQDEPTFRVVRFEVVPQSVKLEDLKPDGTGSCTLPDASGSAPQEIDPTKENSVLFTYSVHWEESQVKWASRWDTYLTMS----DVQIHWFSIVNSVVVVFFLSGILSMIIIRTLRKDIANYNREDDIE---DTMEESGWKNVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGYFAGRLYRTLKGHR--------WKKGAFCTATLYP---AVVFGICFVLNCFIWGEHSSGAVPFTTMLALLCMWFGISMPLVYLGYYFGFRKQPY--DNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFIRKIYAAVKID 650          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf5 (transmembrane 9 superfamily member 2-like [Source:NCBI gene;Acc:103040173])

HSP 1 Score: 231.491 bits (589), Expect = 6.764e-64
Identity = 175/635 (27.56%), Postives = 299/635 (47.09%), Query Frame = 2
Query:  143 EPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLIN------AIEDLYYFEFVIDDIPIR--------------GF-IGNLEESKLLPH------------------THKALLYTHHNIEIDYNQNNIIYG-------------NILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTL---EIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFV-WLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            E K+    +E+ L+VN++    +    Y Y     C+  E    S  LG+VL G+R+  S YK KFR++     +CT     S  +   N       ++  Y   +++D++P+               GF IG L  S+  P                    H  +  T+H+ E +  +   + G             N  + +  P+ +       L +T++YSV + ++     D+IK   + ++  V++    I W SI NSL++V  L   +  I+ R L RD A+YN Q D E   E Q+E GWK VH DVFRPP   ++    +G G Q+  ++   + +A     +  N G +   A++L+      AG+VS RL+K F           NW   V   T+L    + F  + L N +  +  ++ A+P  T++ ++ +W  I  PLT  G   G +    V  +  R   I R+IP   ++      +++GG LPF  I I+L++I +++W  + Y ++G LF++F ILLI      I L YF L  EDY WWW +   +G + +++F+Y I ++F + ++ G   +I Y  Y++++   FFL  G + F + ++F+  +Y  +K+D
Sbjct:   35 EEKSEDCQDEIQLFVNRLDSVESVL-PYEYDMFDFCKDNEEKRPSENLGQVLFGERIETSPYKFKFRKDQPCQKVCTKSYDTSKVEDKTNLEFLKRGMQLNYQHHWIVDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSEGRPKDACVINSEFNKKNTFYVFNHVDITITYHSGENESWKGARLVGARLDPKSIKHSEENSQSCEGPPMEIPGQFSGNLELTYSYSVKFEAT-----DQIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHRDIAKYN-QVDQE---EAQEESGWKQVHGDVFRPPQMGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKSF--------GGENWKTNV-LLTALLCPGMVFADFFLMNLILWVEASSAAIPFGTLVAILGLWFGISVPLTFLGAYFGFKKS--VIEHPVRTNQIPRQIPEQSFFTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFVYAIHYFFSKLQIQGAASTILYLGYTMIMVLIFFLFTGTIGFFACFWFVHKIYSVVKVD 648          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Match: tm9sf5 (transmembrane 9 superfamily member 2-like [Source:NCBI gene;Acc:103040173])

HSP 1 Score: 228.024 bits (580), Expect = 1.511e-62
Identity = 173/645 (26.82%), Postives = 298/645 (46.20%), Query Frame = 2
Query:  143 EPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLIN------AIEDLYYFEFVIDDIPIR--------------GF-IGNLEESKLLPH------------------THKALLYTHHNIEIDYNQNNIIYG-------------NILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTL---EIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMN----------EEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFV-WLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            E K+    +E+ L+VN++    +    Y Y     C+  E    S  LG+VL G+R+  S YK KFR++     +CT     S  +   N       ++  Y   +++D++P+               GF IG L  S+  P                    H  +  T+H+ E +  +   + G             N  + +  P+ +       L +T++YSV + ++     D+IK   + ++  V++    I W SI NSL++V  L   +  I+ R L RD A+YN      L+           E Q+E GWK VH DVFRPP   ++    +G G Q+  ++   + +A     +  N G +   A++L+      AG+VS RL+K F           NW   V   T+L    + F  + L N +  +  ++ A+P  T++ ++ +W  I  PLT  G   G +    V  +  R   I R+IP   ++      +++GG LPF  I I+L++I +++W  + Y ++G LF++F ILLI      I L YF L  EDY WWW +   +G + +++F+Y I ++F + ++ G   +I Y  Y++++   FFL  G + F + ++F+  +Y  +K+D
Sbjct:   35 EEKSEDCQDEIQLFVNRLDSVESVLP-YEYDMFDFCKDNEEKRPSENLGQVLFGERIETSPYKFKFRKDQPCQKVCTKSYDTSKVEDKTNLEFLKRGMQLNYQHHWIVDNMPVTWCYDVEDGQKYCNPGFPIGCLVTSEGRPKDACVINSEFNKKNTFYVFNHVDITITYHSGENESWKGARLVGARLDPKSIKHSEENSQSCEGPPMEIPGQFSGNLELTYSYSVKFEAT-----DQIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHRDIAKYNQVDQGNLLKIHLQTAITYEEAQEESGWKQVHGDVFRPPQMGMLLSVFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKSF--------GGENWKTNV-LLTALLCPGMVFADFFLMNLILWVEASSAAIPFGTLVAILGLWFGISVPLTFLGAYFGFKKS--VIEHPVRTNQIPRQIPEQSFFTKPLPGIVMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFVYAIHYFFSKLQIQGAASTILYLGYTMIMVLIFFLFTGTIGFFACFWFVHKIYSVVKVD 662          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: tm9sf1 (transmembrane 9 superfamily member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-64])

HSP 1 Score: 367.081 bits (941), Expect = 1.584e-115
Identity = 176/352 (50.00%), Postives = 244/352 (69.32%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFREN-LEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLF 1207
            F   E V LYVNKVGPY+NPHETYHYYTLPVCRP  +  KSLTLGEVLDGDRMA+SIY++ FR + L+   LC + L  ++  +L  AIE+LYYFEFV++D+P+RGF+G +EES  LPH+HK  L+TH +  ++YN + +I+ N+ T  + P +L   +   + +T TY+V W  + +  + R +R+   +FFP TLEIHW+SI NS++LVFLL+ F++ I+ RVL+ DFARY N  D    + +Q + GWKI+H DVFR P H+ + C+++G G Q +T++ GI++MAL  MFNVH HG IN AA++LY+FT  IAG+VS   ++  Q         TNWV  +  TTSLF
Sbjct:   33 FKEGEVVTLYVNKVGPYHNPHETYHYYTLPVCRPEHIEHKSLTLGEVLDGDRMARSIYELHFRRDVLQPRKLCDVTLAQAELHQLHEAIEELYYFEFVLEDVPLRGFVGYVEESGFLPHSHKVGLWTHLHFTVEYNGDQVIFANVSTRDAKPYSLDELEPGAV-VTHTYTVKWQPTSVPYERRGERLRDRSFFPKTLEIHWLSIINSMVLVFLLIGFVLIILMRVLKNDFARY-NVGDEAAEDFDQGDNGWKIIHADVFRFPQHRSLLCAVLGVGSQFLTLTTGILVMALMGMFNVHRHGAINSAAILLYAFTCCIAGYVSSGFYRRLQG--------TNWVWNIVLTTSLF 374          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010631.1 (pep scaffold:Pmarinus_7.0:GL476557:59155:81836:-1 gene:ENSPMAG00000009621.1 transcript:ENSPMAT00000010631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 289.271 bits (739), Expect = 2.135e-84
Identity = 181/598 (30.27%), Postives = 306/598 (51.17%), Query Frame = 2
Query:  224 YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTL-----QLKASDTKRLINAIEDLYYFEFVIDDIPI--------------------RGF-IGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTT--------------QSDPINLMPYQ----GKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYI--YLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            Y YY+LP C+P ++ +K+  LGEVL GDR+  + Y+++  E  +   LC +     +L    +K +   I++ YY   + D++P+                     G+ +G ++  K+  H H  L+ ++H    D     + +  I  +              QS  I+ +  Q     K  N+ F+YSV W  S +    R    +  +     ++IHW SI NS+++VF L   +  II R LRRD A YN + D E   +  +E GWK+VH DVFRPP + ++  S++G+G QL  + + ++++A   M +  + G +   +  L+ F     G+ S RL++  +  +        W +    TT+++   +  V  + N       ++ A+P +T++ L+ +W  I  PL   G   G R       N  R   I R+IP   WY +K+I   +L+ G LPF ++ IEL++IFS +W  + Y L+G LF++F IL+I    ++I + YFQL  EDYRWWW T  ++G S  +V +Y +F++F + ++  FI S+ YF Y+ L+   F+L  G + FI++Y FI+ +Y  +K+D
Sbjct:   56 YEYYSLPFCKPQKILYKTENLGEVLRGDRIVNTPYEVRMTEKKDCKVLCDMPNVPVKLTVEQSKLIAERIKEEYYVHLIADNLPVATILSFAEKSGDAEKPEQFEHGYRLGFMDRQKVYLHNHLNLILSYHKETEDAKYKVVRFEVIPQSIKYEALNADDKGDCQSPAISGVEAQEIDPSKENNVLFSYSVKWKESTVKWASRWDTYLTMS----DVQIHWFSIVNSVVVVFFLSGILSMIIIRTLRRDIANYNREDDIE---DTMEESGWKLVHGDVFRPPQYPMLLSSLLGSGIQLFLMVLIVIIVAGLGMLSPSSRGALMTTSCFLFMFMGLFGGYFSGRLYRTLKGQR--------WKKGAFWTTTIYPAVVFGVCFILNFFIWGKHSSGAVPFSTMVALLCMWFGISMPLVFLGYYFGFRKKGY--ENPVRTNQIPRQIPEQRWYMNKFIGAVILMAGILPFGAVFIELFFIFSAIWENQFYYLFGFLFLVFVILVISCSQISIVMVYFQLCAEDYRWWWRTFIVSGGSAFYVLMYAVFYFFNKLEIVEFIPSLLYFGYTGLMIVTFWLLTGTIGFIAAYIFIRKIYAAVKID 636          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2714])

HSP 1 Score: 248.44 bits (633), Expect = 2.284e-72
Identity = 145/472 (30.72%), Postives = 252/472 (53.39%), Query Frame = 2
Query:  467 GFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            G +G  +E     +     L+T+  +EI Y  N I+  N LT++S  + L+P       I  +YSV W  S +  + R  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M  +  DE GWK VH DVFRP  + ++F ++IG+G Q+  +S+ ++++A+          +++  A+ +Y+ TS + G+    L+         Q     W++ +  +  L    +       N +++ Y  + A+P  T++ +  +   +  PL + G +LG+    + +   CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  +  +V++Y I+++F+++KM GF Q+  YF Y  L   A  +  GAV ++ +  F++ +Y N+K+D
Sbjct:    1 GIVGEADE-----NAESQYLWTYKKLEIGYKDNKIVDVN-LTSESK-VKLVPNT----KIPLSYSVKWKKSEVKFESRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEIDDMERDLGDEYGWKQVHGDVFRPATNPVMFTALIGSGSQVFFVSLIVIVVAIFGDLYTERGSMLS-TAIFVYAATSPVNGYFGGSLYSR-------QGGRRKWIKQMFVSAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVACICFFVILPLNLVGTILGRNLSGQPNFP-CRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLAAASTSAYVYMYSIYYFFFKTKMYGFFQTSFYFGYMALFSLALGVMCGAVGYMGTSAFVRKIYTNVKID 450          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Match: tm9sf2 (transmembrane 9 superfamily member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6302])

HSP 1 Score: 162.925 bits (411), Expect = 4.738e-42
Identity = 147/558 (26.34%), Postives = 253/558 (45.34%), Query Frame = 2
Query:  140 KEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQL---KASDTKR----LINAIEDLYYFEFVIDDIPIR--------------GF-IGNL-------------EESKLLPHT-----HKALLYTHHNIEIDYNQNNIIY-------------GNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLE---IHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFV-WLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNE 1642
            +E K+ +    + L+VN++    +    Y Y     C+       S  LG+VL G+R+  S Y I F+       +C  ++   K+++ +     L  A++  Y   ++ID++P+               GF +G L              E+   P+T     H  +   +H+ + +++Q   +              G    T SDP+++     + + IT+TYS+ +  +     D I+   + ++   ++    I W SI NSL++V  L   +  I+ R L RD ARYN    +E   E Q+E GWK+VH DVFRPP   ++    +G+G Q+  ++   +  A     +  N G +   A++L+      AG+V+ R++K     +        W   V   T+     L FV +   N +    G++ A+P  T++ ++ +W  I  PLT  G  +G + +  V     R   I REIPT   Y      +++GG LPF  I I+L++I +++W  + Y ++G LF++F ILLI      I L YF L  E
Sbjct:   50 EESKSDTCPSVIELFVNRLDSVES-VLPYEYNAFDFCQAEGKKRPSENLGQVLFGERIEPSPYAISFKAEKTCEKVCETKVYNVKSTEDQVKLDFLKRAMQLNYQNHWIIDNMPVTWCYEVEGAKKFCNPGFPVGCLVSAEGEQRDACVINEAFNKPNTYYIFNHVDITILYHSGDAEHSQEARLVTAKLEPRSFKHAAGKPDCTSSDPMDIPVAFKEDVKITYTYSITFQKN-----DNIRWASRWDYILESMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHRDIARYNQAESAE---EVQEEYGWKLVHGDVFRPPKASMLLAVFLGSGTQIFIMTFITLFFACMGFLSPANRGALMTCAMVLWVLLGLPAGYVAARMYKSLGGER--------WKTSV-ILTAFLCPSLVFVDFFTMNLILWAEGSSAAIPFGTLVAILALWFCISVPLTFLGAFVGFKKE--VIECPVRTNQIPREIPTQSLYTRPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSETTILLCYFHLCAE 587          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Match: TMN2 (Protein with a role in cellular adhesion and filamentous growth; similar to Tmn3p; member of the evolutionarily conserved Transmembrane Nine family of proteins with nine membrane-spanning segments; TMN2 has a paralog, EMP70, that arose from the whole genome duplication [Source:SGD;Acc:S000002514])

HSP 1 Score: 189.504 bits (480), Expect = 1.457e-50
Identity = 162/669 (24.22%), Postives = 296/669 (44.25%), Query Frame = 2
Query:  143 EPKTFSTNEEVILYVNKVGP-YYNPHE----------------TYHYYT--LPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIR-------------------GF--IGNLEESKLLPHTHKAL-------------------------------LYTHHNIEIDY----NQNNIIYGNIL-------------TTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLA--GCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
             P T+ + +E+ L VN++ P  Y  H+                +Y YY      CRP  V  +  +LG V+ GDR+  S +++   E  E   LC   +   D K +   I+  ++  +++D +P                     GF  +    + K +P T + L                                  H +IE+++    N N  + G I+             +T   P+ L   + K   + FTYSV +++S  +   R  + + + + P   +I W S+ N  ++V LL + +M  + R L+ D ARYN   +  L NE  ++ GWK+ H DVFR P+  ++   ++G+G QL  + +  +  A   + +  + G +     +LY+   ++  + S  ++K F+           W   +  T  L    +  + ++ N   +   ++  +P  ++  ++L+W ++  PL+  G ++  +     D +  +   IAR+IP   WY       L+ G   F SI +ELY+I+S+LW  + + ++G L   F +L + T  V I +TY+ L  E++ W W +  +   GCS ++ F++ I   F + K+ G I  + Y  YSL+I     +  GA+ F SS +FI+ +Y  IK++
Sbjct:   25 SPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILD--EDKDNEVYFTYSVKFVASDTVWATRWDKYL-HIYDP---QIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYN---ELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPY--------WKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHK-QCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCS-IYTFIHSIL--FTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Match: EMP70 (Protein with a role in cellular adhesion and filamentous growth; also endosome-to-vacuole sorting; similar to Tmn3p; member of Transmembrane Nine family of proteins with 9 transmembrane segments; EMP70 has a paralog, TMN2, that arose from the whole genome duplication [Source:SGD;Acc:S000004073])

HSP 1 Score: 181.03 bits (458), Expect = 1.031e-47
Identity = 164/657 (24.96%), Postives = 291/657 (44.29%), Query Frame = 2
Query:  146 PKTFSTNEEVILYVNKVGPYYNPHET-------------------YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIR-------------------GFIG-----------------------------NLEESKLLPH--THKALLYTHHNI-EIDYNQNNIIYGNILTTQSDPIN-------LMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQL--AGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            P T+  N+ + L VN + P  N                       Y+Y     C+P +V  +  +LG V+ GDR+  S +++   +  E  +LC   +   D K +   I++ ++  ++ID +P                     GF+                              N+ ++  LP+   H  ++  +H+  E +Y    +I   +   +S P         LM  +G    + FTYSV +  S      R  + + + + P    I W S+ N  ++V LL + ++  + R L+ DFARYN   +  L ++ Q++ GWK+ H DVFR P+  L    ++G+G QL  +    +  A     +  + G +     +LY+   ++  + S  ++K F N    + +      +V     L  I L F  +  +S  V+       P +T+  +V +W +   PL+  G ++ ++     D +  +   IAR+IP   WY       L+ G  PF SI +ELY+I+++LW  + + ++G LF  F +L + +  V I +TY  L  E+++W W    +  AGC+ L+VF++ I   F + K+ GF   + Y  YS +I     L  G++ FISS  F++ +Y +IK+D
Sbjct:   30 PTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKGAETTDKDVELETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYL-HVYDP---SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYN---ELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFF-NGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVI-------PASTLFFMVFLWFLFSIPLSFAGSLIARKR-CHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCA-LYVFIHSIL--FTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Match: TMN3 (Protein with a role in cellular adhesion and filamentous growth; similar to Emp70p and Tmn2p; member of Transmembrane Nine family with 9 transmembrane segments; localizes to Golgi; induced by 8-methoxypsoralen plus UVA irradiation [Source:SGD;Acc:S000000915])

HSP 1 Score: 115.546 bits (288), Expect = 1.404e-26
Identity = 149/659 (22.61%), Postives = 283/659 (42.94%), Query Frame = 2
Query:  146 PKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSL--TLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDD-IPIRG-FIGNLEESK----------LLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPY-------------------QGKVLNITFTYSVHWISS-PILVKDRIKRIMKNNFFP--VTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNN----------QTDSELMNEEQDEKGWKIVHNDVFRPPNHKL----IFCSIIGTGCQLVTISIGIMLMALSNMFNVHN-HGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNS------------TTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGK-------------RTDARVDSNGC-RARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGRE--HYNLYGVXXXXXXXXXXVTICVAINLTYF--QLVNEDY----RWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRN 1867
            P  +   + + L VNKV         Y YY LP   PP +  K L  +L E++ GDR  +S YK+KF E+    TLC  +      + L   + + Y  +++IDD +P    FI   +  K          + P T K  L+ H  + I ++ ++     I+  +  P ++  Y                   + ++  + FTYSV+W     +    R    +         +++ HW+S+ NS+ +V  +    + I  RV+  D +   +          +T+ +L +++  +     V  D  +     L    +   ++  G Q +   IG + ++ S M  +HN    +   A++ +   +++A FV  RL  M   T+  + +  +  R +               +SL GI +   +LL NS+   + +T A+P  TI+  + ++ ++  PL++ GG++               + ++  D NG    ++ A+  P V      Y  + L G  P   I +E+ Y++ +LW  +   Y  YG LF+   +L ++T+ ++I  +Y   +   ED      W W   ++    G+++ LY +++ F    + GF   +    YSL+      LGLGA+S++++ +FI  +Y  
Sbjct:   54 PNFYRKGDPLELIVNKVESDLT-QLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFIDPDTDKTYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCS-MNKLHNVRNSVLTMAILFFVLGAFMASFVGTRL-SMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLL-NSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPLV------YCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSGGVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIYHQ 702          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO46262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQA7])

HSP 1 Score: 409.453 bits (1051), Expect = 4.509e-130
Identity = 214/447 (47.87%), Postives = 297/447 (66.44%), Query Frame = 2
Query:  569 IIYGNILTTQSDPINL----MPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMN------EEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +I  N+ T   DP+NL    +P++ K      TYSV W  +      R K+     FFP TLEIHW+SI NS +LVFLL+ F++ I+ RVL+ DFARYN  TD E+ +      +   + GWKI+H DVFR P  K + C+I+G G Q + +  GI+ MAL  MFNVH HG +N AA++LY+ T  I+GFVS   ++        +   T WV     TT LF +P   +W + NSV+ +Y +T A+P TTI+ L+ +WL++G+PLTV GG+ GK +    D+  CR +NI REIP V WY+S  +++L+GGFLPFS+I +ELYYIF+TLWGRE Y LYG+L I+F ILL VT C++I LTYFQL +EDY WWW ++  +G +GL+VF Y +F+YF RS MSG +Q+++YF Y+LL C+ FFL LG VSF +S  FI+++Y N+K+D
Sbjct:    1 VISANVTTKDHDPVNLDDVEVPFKLK-----HTYSVTWKQTNKQYTQRSKK-EGGRFFPKTLEIHWLSIINSAVLVFLLLGFVIIILMRVLKNDFARYN-MTDDEVEDLGSYVPKTNYDYGWKIIHTDVFRFPQQKSLLCAILGVGSQFLALCFGIIFMALFGMFNVHRHGSMNTAAVLLYALTCCISGFVSSSFYR--------KIGGTKWVWNNVLTTCLFSVPFFLIWSISNSVAWIYQSTQALPYTTIILLMFIWLIVGFPLTVIGGIFGKNSATSFDAP-CRTKNIPREIPPVPWYRSVSVHMLVGGFLPFSAISVELYYIFATLWGREQYTLYGILLIVFIILLSVTACISIALTYFQLSSEDYHWWWRSVLSSGSTGLYVFCYSLFYYFKRSNMSGVLQTVQYFGYTLLACHVFFLMLGTVSFFASLMFIRYIYVNLKMD 431          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO38637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC5])

HSP 1 Score: 304.679 bits (779), Expect = 4.375e-90
Identity = 189/581 (32.53%), Postives = 314/581 (54.04%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPE--VSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQD---EKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTIS-IGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   EEV+L++N VGPY+N  ETY+YY+LP CR  +  +S    TLGE + G  +  S  +I F+ N+     C L L   + + L+ A+ + Y+++  IDD+P+ G +G++ E+       +  ++TH  IEI ++   I+  N+  T    + L P       I FTY V W  S +  + R ++ +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+   D EL + E+D   E GWK VH DVFRP +H+L+FCS+IGTG  L  ++ + I+   + +++     G I  A + +Y+  +   GF    L+         ++    W+R +     LF   +  +  L N +++ Y  + A+P  T++ +  + + +  PL + G +LG+      ++  CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y ++G + ++FFIL+ VTICV I  TYF L  EDYRW W +   A  +  +V++Y  ++YF+++KM G  Q+  YF Y  L      +  G + +  S  F++ +Y  +K+D
Sbjct:   29 YKDAEEVVLWMNTVGPYHNRQETYNYYSLPFCRGEKRTISHYHETLGENIQGVELEFSGLEISFKVNVPPTKYCELSLTQENYEALVYAVRNHYWYQMYIDDLPLWGIVGDIGETG-----EEYYIWTHKKIEIGHSATQIVDVNL--TSESKVKLSPNA----KIVFTYEVKWKDSAVPFEKRYEKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSK--DDELDDMERDLGDEYGWKQVHGDVFRPASHRLLFCSLIGTGYHLALVACVVILFTIMGDLYT--GRGSILSATIFVYAACAPANGFFGGALYS--------RQGGRMWIRQMVVGAVLFPSLVCGMAFLINFIAIYYHASRAIPFGTMVAVACIVIFVILPLNLVGTVLGRNLSGTPNAP-CRVNTVPRPIPEKKWFMEPAVIVCLGGVLPFGSIFIEMYFIFTSFWAYKIYYVFGFMLLVFFILITVTICVTIVCTYFLLNAEDYRWQWTSFLSAASTAGYVYMYSFYYYFFKTKMYGLFQTTFYFGYMGLFSIGLGILCGTLGYAGSSIFVRKIYSTVKID 583          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO44589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV70])

HSP 1 Score: 261.922 bits (668), Expect = 3.474e-74
Identity = 179/654 (27.37%), Postives = 303/654 (46.33%), Query Frame = 2
Query:  224 YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKL----------LPHTHKALLYTHHNIEIDYNQ-NNIIYGNI------LTTQSDPINLMPYQGKVLN---------------ITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLF-GIPLA-------FVW---------------------LLCNSVS---------VLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFS--------------------------------TLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            Y YYT+P C+P  + +K   LGEVL GDR+  + Y+++   N +   LC +++ A  +K + + I   YY   V+D++P+      +E  +           +    K LL  H  + + Y+  +NI Y  +       +   D I +      +LN               I +TY VHW SS I+   R    +  +     ++IHW +I NS+++V  L   +  I+ R LRRD ARYN + D   M +  +E GWK+VH DVFRPP    +  + IGTG Q+ ++ + I++ A+  M +  + G +  A ++LY F    AG+ + RL+K  +          NW +    T +L+ G   A       F+W                       C ++S         + +G    +P TT+L L+ +W+ I  PL   G   G R       +  R   I R++P  +WY +     L+ G LPF ++ IEL++I S                                 +W  + Y L+G LF++F IL +    +++ + YFQL +EDY WWW +  ++    ++VF Y IF++  +  + GFI ++ YF Y++++ + F+L  G + F ++Y F++ +Y  +K+D
Sbjct:   66 YEYYTMPFCQPKNLEYKPENLGEVLRGDRIVNTPYEVEMNVNKKCVVLCPMKISADMSKVVADRIFKEYYIHMVLDNLPVATKFHMIETGQAQYEHGYKLGYMIGDKKVLLNNHLKLTLKYHTYDNITYRVVGFEVQPKSYAKDAIKVEGSSCSLLNDHPAGLEINPNNENEIYYTYEVHWESSDIVWASRWDTYLAMS----DVQIHWFAIVNSVVIVLFLSGILAMIMIRTLRRDIARYNKEDD---MEDTLEETGWKLVHGDVFRPPQKAWLLTAFIGTGVQIFSMVVIILVFAMLGMLSPASRGSMVQAIILLYVFMGMFAGYFAARLYKTLKG--------QNWKKSAFLTATLYPGFVSAICFFLNFFIWGKHSSGAFEAFFEAFFEVIFEAFCKAISRKLNINRKAMSWGYQRRVPFTTMLALLCLWVGISLPLIFLGYYFGYRKYPY--EHPVRTNQIPRQVPEQMWYMNLIPSNLMAGILPFGAVFIELFFILSDMFFCGYCPNPSFLGCCQLAPLLTHLKCIAFLAIWENQFYYLFGFLFLVFVILAVCVSQISMVMVYFQLCSEDYHWWWRSFFMSSSCAIYVFFYAIFYFVTKLNIVGFIPALMYFGYTIIMVFTFWLLTGTIGFYTTYLFVRHIYAAVKID 702          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Match: EDO38363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD51])

HSP 1 Score: 226.483 bits (576), Expect = 1.707e-62
Identity = 180/627 (28.71%), Postives = 299/627 (47.69%), Query Frame = 2
Query:  164 NEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEV-SFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKAS---DTKRLI---NAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKAL---------------------------LYTHHNIEIDYNQNN---IIYGNILTTQSDPINL----------------MPYQ-GKVLNITFTYSVHWISSPILV-KDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
              ++ LYVN++    +    Y Y +   C   +  S  S  LG+V+ G+R+  S Y + F++ ++  TLCT     S   D K+L    + I   Y   +++D++P+       +E +    T   +                           ++ H +I I Y+       I   +L+ +  P +L                +P +    L IT+TYSV ++ +  L    R   I+ +   P T +I W SI NS I+V  L   +  I+ R L +D ARYN     E   + Q+E GWK+VH DVFR P   ++   ++G+G Q++ ++   ++ A     +  N G +   +L+L+      AG+VS RL+KMF      +   TN   V+ S+  + G      +LL N V    G++ A+P TT+L L+ +W  I  PLT  G  LG +   +      R   I R+IP    Y      +++GG LPF  I I+L++I +++W  + Y ++G LF++  IL++      + L YF L  EDY WWW +    GC+  + FLYCI  ++ +  +SG   ++ YF Y+L++ + FFL  G V F S ++FI+ +Y  +K+D
Sbjct:   47 KAQINLYVNRLDSV-DSVIPYEYSSFDFCLAKDSKSSPSENLGQVVFGERIRPSAYNLSFKKEVKCETLCTKTYDTSKNEDNKKLDFLRSGIALNYQNHWIVDNMPVTWCYDVTDEERKYCSTGFPIGCFVTADGQARDACVTSTKFSTADTHYVFNHVDITITYHSGKGEEWIGARLLSAKLVPRSLKHEKASDCGANQDVLGIPAKLSSTLKITYTYSVTYVENNSLKWASRWDYILDS--MPHT-KIQWFSIMNSFIIVLFLSGMVAMIMLRTLHKDIARYNQMDSGE---DAQEEFGWKLVHGDVFRSPRKGMLLSILLGSGTQILIMTFVTLVFACLGFLSPANRGALMTCSLVLFVCLGSPAGYVSARLYKMFGG----ERWKTN---VILSSFFVPGFVFGIFFLL-NLVLWAEGSSAAIPFTTLLALLALWFCISVPLTFLGAYLGFK--KKPIEQPVRTNQIPRQIPEQSIYTRALPGIIMGGVLPFGCIFIQLFFILNSIWSHQIYYMFGFLFVVCAILVLTVTETTVLLCYFHLCAEDYHWWWRSFLTGGCTAFYFFLYCIHFFYTKLTISGTASTVLYFGYTLIMVWLFFLFTGTVGFFSCFFFIRKIYSIVKVD 656          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf1 (transmembrane 9 superfamily member 1 [Source:NCBI gene;Acc:101158805])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 289/592 (48.82%), Postives = 393/592 (66.39%), Query Frame = 2
Query:  134 FAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITF----------TYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            F+     +   + V LYVNKVGPY+NP ETYHYYTLPVCRP +V  KSL+LGEVLDGDRMA+S+Y I+FREN+EK TLC L L      +L  AIE+LYYFEFV+ +IPI GF+G +EES  LPH+HK  L+TH +  I+YN  ++I+ N+      P+ L    G  +              TYSVHW  S +    R +R+   +FFP TLEIHW+SI NSL+LV LL+ F++ I+ RVL+ DFARYN + D    + +Q + GWKI+H DVFR P  K + C+++G G Q +T++  I++MAL  MFNVH HG IN AA++LY+ TS ++G+VSC  +         Q +   WV  +   +SLF  PL   W + NS+    G+T A+P TT+L L+  W+++G+PLTV GG++GK       +  CR RNI R+IP   WYK   +++ +GGFLPFS+I +ELYYIF+T+WGREHY LYG+L  +F ILL V  C+++ LTYF L  EDYRWWW ++   G +GLF+F+Y +F+Y  RS MSG +QS E+F YSLL    F L LG+VSF SS  FI+++YR++K+D
Sbjct:   12 FSSWAAGYKQGDNVTLYVNKVGPYHNPQETYHYYTLPVCRPEKVHHKSLSLGEVLDGDRMAESLYHIRFRENVEKKTLCQLTLSEKQVDQLREAIEELYYFEFVLAEIPIWGFVGYIEESGFLPHSHKVGLWTHLDFNIEYNGESVIFANVSVKDVKPVPLEEGTGAAVGGVGVGGGTLTVTHTYSVHWYESSLPYSRRAERLRDYSFFPKTLEIHWLSIINSLVLVVLLLGFVIIILMRVLKNDFARYNVEEDGSCDDLDQGDNGWKIIHTDVFRFPPFKSLLCAVLGVGAQFLTLATAIIIMALLGMFNVHRHGAINSAAIVLYALTSCVSGYVSCSFYT--------QINGQRWVWNIILASSLFSAPLFITWSVVNSIHWWCGSTQALPATTVLLLLGAWVLVGFPLTVIGGIVGKNRAGSFQAP-CRTRNIPRQIPPQPWYKHAVVHMAIGGFLPFSAISVELYYIFATVWGREHYTLYGILLCVFAILLSVGACISVALTYFLLSGEDYRWWWRSVLSTGSTGLFIFVYSVFYYRNRSSMSGLVQSTEFFGYSLLTALVFSLMLGSVSFWSSLAFIRYIYRSLKMD 594          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf3 (transmembrane 9 superfamily member 3 [Source:NCBI gene;Acc:101158880])

HSP 1 Score: 322.783 bits (826), Expect = 4.808e-96
Identity = 187/579 (32.30%), Postives = 319/579 (55.09%), Query Frame = 2
Query:  152 TFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPE--VSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            T++  EEV+L++N VGPY+N  ETY Y++LP C   +  +S    TLGE L G  +  S   IKF+E + + T C ++L  +     + AI++ Y+++  IDD+PI G +G  +E     +     L+T+  +EI +N N I+  N+  T    + LMP       I  +YSV W  S +  +DR  + +  +FF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY+ + + + M+ +  DE GWK VH DVFRP +H LIF S+IG+GCQ+ ++S+ ++++A+          +++  A+ +Y+ TS + G+        F  +   ++    W++ +     +    +       N +++ Y  + A+P  T++ +  +   +  PL + G +LG+    + +   CR   + R IP   W+    + + LGG LPF SI IE+Y+IF++ W  + Y +YG + ++  IL IVT+CV I  TYF L  EDYRW W +   A  + ++V++Y  ++YF+++KM G  Q+  YF Y  +   A  +  GAV ++ +  F++ +Y N+K+D
Sbjct:   33 TYADKEEVVLWMNTVGPYHNRQETYKYFSLPFCAGSKKTISHYHETLGEALQGVELEFSGLDIKFKEEVMQTTYCEVELDKAKRDAFVYAIKNHYWYQMYIDDLPIWGIVGEADE-----NGEDHYLWTYKKLEIGFNGNRIVDVNL--TSEGKVKLMPNT----RIAMSYSVKWKKSDVKFEDRFDKYLDPSFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQIFSVSLIVIIVAMVEDLYTERGSMLS-TAIFVYAATSPVNGY--------FGGSLYAKQGGRRWIKQMFIGAFMIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILGRNLSGQPNFP-CRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTAFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID 588          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf4 (transmembrane 9 superfamily member 4 [Source:NCBI gene;Acc:101163659])

HSP 1 Score: 278.1 bits (710), Expect = 8.685e-80
Identity = 187/637 (29.36%), Postives = 310/637 (48.67%), Query Frame = 2
Query:  146 PKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLC-TLQLKASDTKRLINAIEDLYYFEFVIDDIPI----------------------------RGF-IGNLEESKLLPHTHKA-LLYTH---------HNIEI-------------DYNQNNIIYGNILTTQSDPINLMPYQGKVLN-ITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSL-----FGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            P+ F   E V +   K+         Y YY+LP C+P  V +K   LGEVL GDR+  ++Y ++  ++ +   +C + +L   ++K +   I++ YY   + D++P+                             G+ +G ++ +K   H H + +LY H         HN  +             D   +      +L   SD  + M     V N + F+YSVHW  S +    R    +  +     ++IHW SI NS+++VF L   +  II R LR+D A YN + D E   +  +E GWK VH DVFRPP + +I  S++G+G QL  + + ++ +A+  M +  + G +   A  L+ F     G+ + RL++  +  +        W +    T +L     FGI     + +    S     + A+P TT+L L+ +W  I  PL   G   G R       N  R   I R++P   WY +K++ +L+ G LPF ++ IEL++IFS +W  + Y L+G LF++F IL++    ++I + YFQL  EDYRWWW T  ++G S  +V +Y IF++  +  +  FI S+ YF Y+ ++  +F+L  G + F ++Y FI  +Y  +K+D
Sbjct:   31 PRDFHDGEPVDIKAVKLTSS-RTQLPYEYYSLPFCKPDSVVYKGENLGEVLRGDRIVNTLYSVEMNKDKKCEVVCGSKKLSLEESKLVAERIQEEYYVHLIADNLPVATRLEFYPNREAGGEEQSKDVVKDVQFEHGYRLGFVDNNKFYLHNHLSFILYFHREKQEEGEVHNYRVVRFEVVPQSVKAEDLKASATEKTCVLPEASDS-HAMEIDPNVENEVLFSYSVHWEESEVKWASRWDTYLTMS----DVQIHWFSIVNSVVVVFFLSGILSMIIIRTLRKDIANYNREDDIE---DTMEESGWKNVHGDVFRPPQYPMILSSLLGSGIQLFCMFLIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGYFAGRLYRTLKGHR--------WRKGAFCTATLYPGVVFGISFFLNFFIWGEHS-----SGAVPFTTMLALLCMWFGISMPLVYLGYYFGFRKQPY--DNPVRTNQIPRQVPEQRWYMNKFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRTFVVSGGSAFYVLIYAIFYFVNKLDIVEFIPSLLYFGYTAMMVISFWLLTGTIGFYAAYMFIGKIYAAVKID 643          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf5 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:101166562])

HSP 1 Score: 227.639 bits (579), Expect = 1.487e-62
Identity = 174/634 (27.44%), Postives = 306/634 (48.26%), Query Frame = 2
Query:  134 FAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDL-------YYFEFVIDDIPIR--------------GF-IGNL------------------EESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILT----TQSDPINLMPYQGKVLNITFTY----SVHWISSPILVKDR-IKRIMKNNFFPVTL---EIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            F +E        ++ L+VN++    +    Y Y     C+  + +  S  LG+VL G+R+  S YK  F+++++ + +CT ++   D K  +  ++ L       Y   ++ID++P+               GF IG L                  E++      H ++  T+H+ E +  +   + G  L      Q+D  NL    G  + +   +    SV +  S    +D  IK   + ++  V++    I W SI NSL++V  L   +  I+ R L +D ARYN Q D E   + Q+E GWK VH DVFRPP   ++    +G G Q+  ++   + +A     +  N G +   A++L+      AG+VS RL+K F      ++  TN   V+ +     GI  A  +L+ N +  + G++ A+P  T++ ++ +W  I  PLT  G   G +  A       R   I R+IP   ++      +++GG LPF  I I+L++I +++W  + Y ++G LF++F ILLI      I L YF L  EDY WWW +   +G + +++F+Y + ++F + ++ G   +I YF Y++++   FFL  G + F + ++F+  +Y  +K+D
Sbjct:   35 FCEEKDVPECQTQIQLFVNRLDSVESVLP-YEYDVFDFCKDVKETRPSENLGQVLFGERIESSPYKFSFKKDVKCSAVCT-KIYKKDVKEDVAKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTADGRAKDACVINSKFNEKNTYYVFNHVSIKITYHSGESEGWKGARLVGATLEPKSIKQTDEKNLNCEDGSPMEVPVVFDSDVSVLYTYSVTFTEDNSIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYN-QVDQE---DAQEESGWKQVHGDVFRPPRKGMLLSIFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGG----EKWKTN---VLLTALLCPGIVFADFFLM-NLILWVEGSSAAIPFGTLVAILALWFGISVPLTFIGAYFGFKKPAI--EQPVRTNQIPRQIPEQSFFTKPIPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 652          
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Match: tm9sf5 (transmembrane 9 superfamily member 2 [Source:NCBI gene;Acc:101166562])

HSP 1 Score: 223.016 bits (567), Expect = 8.546e-61
Identity = 174/648 (26.85%), Postives = 307/648 (47.38%), Query Frame = 2
Query:  134 FAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDL-------YYFEFVIDDIPIR--------------GF-IGNL------------------EESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILT----TQSDPINLMPYQGKVLNITFTY----SVHWISSPILVKDR-IKRIMKNNFFPVTL---EIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELM--------------NEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            F +E        ++ L+VN++    +    Y Y     C+  + +  S  LG+VL G+R+  S YK  F+++++ + +CT ++   D K  +  ++ L       Y   ++ID++P+               GF IG L                  E++      H ++  T+H+ E +  +   + G  L      Q+D  NL    G  + +   +    SV +  S    +D  IK   + ++  V++    I W SI NSL++V  L   +  I+ R L +D ARYN Q D E +               + Q+E GWK VH DVFRPP   ++    +G G Q+  ++   + +A     +  N G +   A++L+      AG+VS RL+K F      ++  TN   V+ +     GI  A  +L+ N +  + G++ A+P  T++ ++ +W  I  PLT  G   G +  A       R   I R+IP   ++      +++GG LPF  I I+L++I +++W  + Y ++G LF++F ILLI      I L YF L  EDY WWW +   +G + +++F+Y + ++F + ++ G   +I YF Y++++   FFL  G + F + ++F+  +Y  +K+D
Sbjct:   35 FCEEKDVPECQTQIQLFVNRLDSVESVLP-YEYDVFDFCKDVKETRPSENLGQVLFGERIESSPYKFSFKKDVKCSAVCT-KIYKKDVKEDVAKLDFLKMGMQLNYQHHWIIDNMPVTWCYDVEDGQKYCNPGFPIGCLVTADGRAKDACVINSKFNEKNTYYVFNHVSIKITYHSGESEGWKGARLVGATLEPKSIKQTDEKNLNCEDGSPMEVPVVFDSDVSVLYTYSVTFTEDNSIKWASRWDYILVSMPHTNIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYN-QVDQENLIKVPSTRDKSSVTYEDAQEESGWKQVHGDVFRPPRKGMLLSIFLGQGTQIFIMTFITLFLACLGFLSPANRGALMTCAVVLWVLLGTPAGYVSARLYKTFGG----EKWKTN---VLLTALLCPGIVFADFFLM-NLILWVEGSSAAIPFGTLVAILALWFGISVPLTFIGAYFGFKKPAI--EQPVRTNQIPRQIPEQSFFTKPIPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFLVFIILLITCSEATILLCYFHLCAEDYHWWWRSFLTSGFTAVYLFIYAVHYFFSKLQIIGAASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVNKIYSVVKVD 669          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000012184.1 (SMESG000012184.1)

HSP 1 Score: 1179.85 bits (3051), Expect = 0.000e+0
Identity = 583/583 (100.00%), Postives = 583/583 (100.00%), Query Frame = 2
Query:  131 CFAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            CFAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVLFIIFFILLIVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD
Sbjct:   15 CFAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVLFIIFFILLIVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 597          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000016907.1 (SMESG000016907.1)

HSP 1 Score: 324.324 bits (830), Expect = 6.749e-97
Identity = 188/578 (32.53%), Postives = 318/578 (55.02%), Query Frame = 2
Query:  155 FSTNEEVILYVNKVGPYYNPHETYHYYTLPVCRPP--EVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKASDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEE-QDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +   EEV+L++N VGPY+N  ETY Y++LP C  P  E++    TLGE L G  +  S   I ++ ++++   C + L +      + AI+++Y+++  +DD+P+ G +G  E+SK         LYTH  +++ YN+  I+  N+     + + L P     + I FTY V W  S IL ++R  + +  NFF     IHW SI NS ++V  L+  +  I+ R LR+D+ARY    + + + ++  DE GWK VH DVFRPP   + F S+IGTG  ++ ++I +++MAL          +++  ++ +Y+ TS + GF S  L+         + +  NW+R +     +    +     + N +++ Y  + A+P  T+L +  + + +  PL + G ++G+ T  + +   CR   + R IP   W+       LLGG LPF SI IE+Y+IF++ W  + Y ++G  F++  ILL+VT CV I  TYF L  EDYRW W +      +  +V++Y ++++F+++KM GF Q+  YF Y  L C+   L  GA+ ++SS  F++ +Y  +K+D
Sbjct:   24 YEDGEEVVLWMNTVGPYHNRQETYTYFSLPFCAGPKKEINHYHETLGEALQGVELEFSGLDIDYKTDVKRIQYCEITLSSVKYHMFVYAIKNIYWYQMYLDDLPVWGLVG--EQSK----EGDFYLYTHKLLKVGYNKKQIVEVNL--ENGNKVKLKP----DMKIQFTYEVVWKPSNILFENRFDKYLDTNFF--QHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYGRDEEMDSLEKDLGDEYGWKQVHGDVFRPPTSLVFFTSLIGTGGHIIVVTIVVIVMALIGHLYTERGSLLS-TSIFVYAVTSPVNGFFSGSLYS--------RMNGRNWIRQLLIGALMLPTLVCGTAFIINFIAIYYQASRAIPFLTMLAISAIIVFVVLPLNLVGTVIGRNTFGQPNYP-CRINAVPRPIPEKKWFMEPIFITLLGGILPFGSIFIEMYFIFTSFWAYKIYYVFGFTFLVVLILLVVTSCVTIVCTYFLLNAEDYRWQWTSFAAGASTAFYVYMYSVYYFFFKTKMYGFFQTTFYFGYMALFCFGLGLMCGAIGYLSSNVFVRKIYSYVKID 577          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000060705.1 (SMESG000060705.1)

HSP 1 Score: 236.498 bits (602), Expect = 1.124e-65
Identity = 186/640 (29.06%), Postives = 295/640 (46.09%), Query Frame = 2
Query:  140 KEPKTFSTNEEVILYVNKVGPYYNPHET--YHYYTLPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLK---ASDTKRL---INAIEDLYYFEFVIDDIPI-------------RGF-IGNLEESKLLPHTHKALLYTHHNIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKR---------IMKNN-------FFPVTLE----------------------IHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQNTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPITTILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            K+ +     +E+ +YVNK+    +P     Y Y     C PP V   +  LG++L G+R+  S Y + F  +     +CT   K   + D  +L   +N I   Y   +++D++P+              GF IG  ++ K    T         +  ++      ++ +I  T S   +  P Q K   I F   V+ I+S   VKD+ +          I+K N        F V  E                      I W SI NS+I+V  L   +  I+ + L RD  RYN + D+E   E Q+E GWK+VH DVFRPP   +  C  +G+G QL+ ++I  + ++     +  N G      ++ Y      AGF S RL+KM    +     S   +       S+FGI     + + N V    G++ A+P TTIL L+ +W +I  PL   G   G +      S   R   I R+IP    Y      +L+GG LPF  I I+L++I +++W    Y ++G+LF++F IL+I      I L YF L  EDYRWWW +   +GC+ L++F Y I+ +  +  + G   +  YF Y+ +I +  FL  G V F++S++F++ +Y  +K+D
Sbjct:   30 KDSEEVDCQKEIAVYVNKLD---SPQSVLPYEYNKFDFCEPPLVKSPTENLGQILFGERIQSSPYNVPFGVSFNYKEICTRTYKKGVSQDKSKLSFLLNGIALNYKHHWIVDNLPVVSCYKNGEAEICYNGFPIGCYQDPKSKSST------CSKDANVNKPNTYFLFNHITLTISVYSDDPPEQVKSGRIVFV-RVN-IASVAYVKDKAQEKDLATAPPMILKENEDNTFRYTFSVKFETNKDTKWSSRWDYVLKTMPQSNIQWFSILNSVIIVLFLSGMLAMILLKTLHRDIDRYN-KLDTE---EAQEEFGWKLVHGDVFRPPRMGMTLCVFVGSGVQLILMTIITLFISCFGFLSPANRGAFVTCGIVFYVLFGLFAGFNSARLYKMMSGEKW---KSNVLLTAFLCPGSVFGI-----FFVLNIVLWASGSSAAVPFTTILGLLAMWFLISVPLCFVGAYFGFKKPPI--SQPVRTNQIPRQIPYQSLYTRAIPSILMGGVLPFGCIFIQLFFILNSIWSTYVYYMFGLLFLVFLILVITCSETTILLCYFHLCAEDYRWWWRSFLTSGCTALYLFGYSIYFFHAKLDIKGSTSTFLYFGYTAIIIWLAFLVTGTVGFLTSFWFVRKIYSVVKVD 644          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000013662.1 (SMESG000013662.1)

HSP 1 Score: 127.102 bits (318), Expect = 6.436e-33
Identity = 71/196 (36.22%), Postives = 115/196 (58.67%), Query Frame = 2
Query: 1292 ILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVWYKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVXXXXXXXXXXVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSKMSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD 1879
            +L L  +W  +  PL   G   G R  +    +  R   I R +P   WY       L  G LPF ++ IEL+++F+ +W ++ Y L+G LFI+F IL++    VAI + Y QL +EDY WWW T  ++G S  +V  Y +F++  + +++GFI S+ YFSY+L+I ++F+L  G + + +SY F++ +Y  IK+D
Sbjct:    1 MLALFALWFGVSLPLIFIGFFFGYRKKSY--EHPVRTNQIPRAVPEQKWYHHIVFSTLSAGVLPFGAVFIELFFVFTAIWEKQFYYLFGFLFIVFIILIVSVAQVAIVMVYLQLCSEDYHWWWRTFIVSGGSAFYVLGYSVFYFVTKLEITGFIPSLIYFSYTLMIVFSFWLLTGTIGYFASYTFLRKIYGAIKID 194          
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Match: SMESG000013664.1 (SMESG000013664.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.656e-31
Identity = 101/341 (29.62%), Postives = 162/341 (47.51%), Query Frame = 2
Query:  224 YHYYTLPVCRPPE-VSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCT-LQLKASDTKRLINAIEDLYYFEFVIDDIPI-------------RGF-IGNLEESKLLPHTH-KALLYTHHNIEIDYNQNNIIYGNILTTQS------------------DPINLMPYQGKVLNITFTYSVHWISSPILVKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRDFARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLVTISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQN 1141
            Y YY+L  C+P + + + S  LGE+L GDR+  + Y+I+  E    +TLC+ + L A +++     I + Y    +ID++P+              GF +G +   K+  + H K +L  H + EI+YN        + + +S                  D       + K   I FTY V WI S I    R    +  +      +IHW SI NS++++  L   +  I+ R LR+D A+YN   D   M E  +E GWK+VH DVFRPP H     + IG+G QL  + + I+ +A+  M +  + G +  A +  Y+F    AG+ S R++K  + 
Sbjct:   53 YSYYSLKFCKPKDGLVYVSENLGEILRGDRIVNTPYEIRMLEKKPCSTLCSPIILNADESEAFRKRILNSYSVHLLIDNLPVATRYSIGAHIQYEHGFHLGFIRNEKVFINNHLKFILKYHTDDEINYNIVGFEIEPLSSGRSSMKIDKDGTCRVTAIHNGDAGYQQIEEKKENIIDFTYEVMWIKSDIKWVSRWDTYLAMS----DGQIHWFSIINSIVIIIFLSGILTMIMIRTLRKDIAKYNKDED---MEEAFEESGWKLVHGDVFRPPKHPRFLTACIGSGVQLFCVVLIIIFVAMLGMLSPASRGALISATIFTYAFMGMFAGYYSGRIYKTLRG 386          
The following BLAST results are available for this feature:
BLAST of Transmembrane 9 superfamily member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL136295.150.000e+050.69novel protein[more]
AL136295.10.000e+050.69novel protein[more]
TM9SF10.000e+050.69transmembrane 9 superfamily member 1 [Source:HGNC ... [more]
TM9SF10.000e+050.69transmembrane 9 superfamily member 1 [Source:HGNC ... [more]
TM9SF12.180e-17248.62transmembrane 9 superfamily member 1 [Source:HGNC ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y41D4A.41.259e-9832.01Transmembrane 9 superfamily member [Source:UniPro... [more]
Y41D4A.41.259e-9832.01Transmembrane 9 superfamily member [Source:UniPro... [more]
Y41D4A.44.684e-9731.84Transmembrane 9 superfamily member [Source:UniPro... [more]
Y41D4A.42.163e-8932.34Transmembrane 9 superfamily member [Source:UniPro... [more]
Y41D4A.42.163e-8932.34Transmembrane 9 superfamily member [Source:UniPro... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TM9SF34.511e-8932.76gene:FBgn0035622 transcript:FBtr0077127[more]
TM9SF41.388e-7729.85gene:FBgn0028541 transcript:FBtr0080532[more]
TM9SF41.388e-7729.85gene:FBgn0028541 transcript:FBtr0343657[more]
TM9SF26.546e-6327.89gene:FBgn0032880 transcript:FBtr0335149[more]
TM9SF26.546e-6327.89gene:FBgn0032880 transcript:FBtr0081393[more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tm9sf10.000e+049.32transmembrane 9 superfamily member 1 [Source:ZFIN;... [more]
tm9sf10.000e+049.32transmembrane 9 superfamily member 1 [Source:ZFIN;... [more]
tm9sf32.984e-9432.35transmembrane 9 superfamily member 3 [Source:ZFIN;... [more]
tm9sf32.984e-9432.35transmembrane 9 superfamily member 3 [Source:ZFIN;... [more]
tm9sf46.134e-8330.07transmembrane 9 superfamily protein member 4 [Sour... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwa10.000e+050.51von Willebrand factor A domain containing 1 [Sourc... [more]
vwa10.000e+050.87von Willebrand factor A domain containing 1 [Sourc... [more]
TM9SF31.297e-9331.95transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
TM9SF37.787e-9331.83transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
TM9SF31.151e-9231.83transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tm9sf10.000e+050.52transmembrane 9 superfamily member 1 [Source:MGI S... [more]
Tm9sf10.000e+050.52transmembrane 9 superfamily member 1 [Source:MGI S... [more]
Tm9sf10.000e+050.52transmembrane 9 superfamily member 1 [Source:MGI S... [more]
Tm9sf10.000e+050.52transmembrane 9 superfamily member 1 [Source:MGI S... [more]
Tm9sf19.571e-17448.45transmembrane 9 superfamily member 1 [Source:MGI S... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DBU0|TM9S1_MOUSE0.000e+050.52Transmembrane 9 superfamily member 1 OS=Mus muscul... [more]
sp|Q5R8F1|TM9S1_PONAB0.000e+050.34Transmembrane 9 superfamily member 1 OS=Pongo abel... [more]
sp|O15321|TM9S1_HUMAN0.000e+050.69Transmembrane 9 superfamily member 1 OS=Homo sapie... [more]
sp|A4IFE9|TM9S1_BOVIN0.000e+049.92Transmembrane 9 superfamily member 1 OS=Bos taurus... [more]
sp|Q66HF2|TM9S1_RAT8.992e-17348.62Transmembrane 9 superfamily member 1 OS=Rattus nor... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PGA70.000e+054.28Transmembrane 9 superfamily member OS=Pomacea cana... [more]
A0A2C9JUC30.000e+053.21Transmembrane 9 superfamily member OS=Biomphalaria... [more]
A0A210Q7G40.000e+052.24Transmembrane 9 superfamily member OS=Mizuhopecten... [more]
A0A3M7Q9520.000e+051.81Transmembrane 9 superfamily member (Fragment) OS=B... [more]
A0A0B6ZUX60.000e+052.17Transmembrane 9 superfamily member (Fragment) OS=A... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tm9sf10.000e+049.15transmembrane 9 superfamily member 1 [Source:ZFIN;... [more]
tm9sf32.378e-9432.41transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
tm9sf46.268e-8229.15transmembrane 9 superfamily member 4 [Source:NCBI ... [more]
tm9sf56.764e-6427.56transmembrane 9 superfamily member 2-like [Source:... [more]
tm9sf51.511e-6226.82transmembrane 9 superfamily member 2-like [Source:... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tm9sf11.584e-11550.00transmembrane 9 superfamily member 1 [Source:ZFIN;... [more]
ENSPMAT00000010631.12.135e-8430.27pep scaffold:Pmarinus_7.0:GL476557:59155:81836:-1 ... [more]
tm9sf32.284e-7230.72transmembrane 9 superfamily member 3 [Source:ZFIN;... [more]
tm9sf24.738e-4226.34transmembrane 9 superfamily member 2 [Source:ZFIN;... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TMN21.457e-5024.22Protein with a role in cellular adhesion and filam... [more]
EMP701.031e-4724.96Protein with a role in cellular adhesion and filam... [more]
TMN31.404e-2622.61Protein with a role in cellular adhesion and filam... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO462624.509e-13047.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386374.375e-9032.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445893.474e-7427.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383631.707e-6228.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tm9sf10.000e+048.82transmembrane 9 superfamily member 1 [Source:NCBI ... [more]
tm9sf34.808e-9632.30transmembrane 9 superfamily member 3 [Source:NCBI ... [more]
tm9sf48.685e-8029.36transmembrane 9 superfamily member 4 [Source:NCBI ... [more]
tm9sf51.487e-6227.44transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
tm9sf58.546e-6126.85transmembrane 9 superfamily member 2 [Source:NCBI ... [more]
back to top
BLAST of Transmembrane 9 superfamily member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012184.10.000e+0100.00SMESG000012184.1[more]
SMESG000016907.16.749e-9732.53SMESG000016907.1[more]
SMESG000060705.11.124e-6529.06SMESG000060705.1[more]
SMESG000013662.16.436e-3336.22SMESG000013662.1[more]
SMESG000013664.11.656e-3129.62SMESG000013664.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024756 ID=SMED30024756|Name=Transmembrane 9 superfamily member|organism=Schmidtea mediterranea sexual|type=transcript|length=4385bp
TTTTAATTTGAAATAAGCACTTTGTTATTATTATATAATTAAGTAATGGG
ATATATATTAAAGTTTAGTTATTCTTATTAAATTTTAGATGAAATATTTT
ATAATTTATATTGGATTTATTTTCAAACTATGTTTTGCTAAAGAACCCAA
AACTTTTTCAACAAATGAAGAAGTTATACTTTATGTAAATAAAGTTGGAC
CATATTATAATCCTCATGAAACTTATCATTATTACACTCTTCCAGTTTGT
CGGCCACCAGAAGTATCTTTTAAAAGTTTAACTCTTGGAGAAGTGTTAGA
TGGTGATCGAATGGCAAAATCTATATATAAAATAAAATTTCGAGAAAATC
TGGAGAAAGCTACACTTTGCACTCTTCAACTTAAAGCGAGTGACACTAAA
AGGTTAATAAATGCTATTGAAGATTTATATTATTTTGAATTTGTTATTGA
TGATATCCCTATAAGAGGGTTTATCGGAAATTTGGAGGAGAGCAAATTAT
TGCCTCATACTCACAAAGCCCTACTTTATACGCATCACAATATTGAAATA
GATTACAACCAAAATAACATAATATATGGAAATATTTTGACAACACAATC
TGACCCAATAAATCTCATGCCATATCAAGGAAAAGTATTAAATATCACAT
TTACATACTCTGTCCATTGGATTTCATCTCCTATTCTTGTTAAAGATCGA
ATCAAACGAATAATGAAGAATAATTTTTTTCCAGTTACTTTGGAAATTCA
TTGGATCAGCATAACGAATTCACTTATTTTGGTATTTCTATTGATGACAT
TCATCATGTTCATCATTAGCCGAGTTCTTCGTCGGGATTTTGCAAGATAT
AATAATCAAACAGATTCAGAATTAATGAATGAGGAACAAGATGAAAAAGG
TTGGAAAATAGTTCATAATGATGTTTTCCGTCCGCCTAATCACAAATTAA
TCTTCTGCAGCATTATTGGAACCGGCTGCCAATTGGTAACGATTTCTATC
GGCATAATGCTTATGGCGTTATCAAACATGTTCAACGTTCATAATCATGG
CGTTATCAACATTGCCGCTTTGATGCTTTATTCATTCACGTCTTGGATTG
CAGGGTTTGTCAGTTGTAGGCTACATAAAATGTTCCAGAACACCCAATTA
ATGCAAGAGTCGTCTACAAATTGGGTTAGAGTTGTCAATTCTACAACATC
ATTATTCGGAATCCCATTGGCTTTTGTTTGGTTGCTATGCAACAGCGTTT
CAGTATTGTATGGCACAACGCATGCAATGCCAATTACAACAATATTGGAA
CTGGTGCTCGTTTGGCTAGTAATTGGATACCCGTTGACAGTTACTGGTGG
TATGTTGGGAAAGCGCACTGACGCACGTGTAGATTCCAACGGATGTCGGG
CAAGAAATATTGCTCGAGAAATTCCAACAGTAGTTTGGTATAAATCGAAA
TATATCTATTTGCTATTAGGAGGATTTTTGCCCTTCAGTTCGATTTGTAT
TGAATTGTACTATATTTTCTCAACTCTCTGGGGCCGAGAGCATTACAACC
TCTACGGAGTTCTGTTCATTATCTTTTTCATTCTCTTAATTGTGACTATT
TGTGTCGCAATTAATTTAACCTACTTTCAATTGGTCAATGAGGATTATCG
CTGGTGGTGGAACACGCTGCAATTGGCCGGTTGCAGTGGACTTTTCGTGT
TTCTCTACTGCATATTCCATTATTTCTATCGATCGAAAATGAGCGGCTTT
ATTCAGTCGATTGAATACTTTAGTTACAGCCTTCTCATTTGCTATGCTTT
CTTTCTCGGATTAGGTGCAGTCTCATTTATTTCATCGTATTACTTTATCA
AATTTATGTATCGAAACATTAAGTTGGATTGATTTTTCCTATTATTGGTT
GTGCTGCTATTATTATTATTATTATTAACAGTTACAAATTAGAGCTGTTC
AACTCATTTTTGTGATGATTTTGTAAATTTTGTGATTCAACTGTATTATT
CGAGCCGTCAGAATGGAGGCGGGGTGGTAACGGCAGTGTAGTGCCTGTAA
ACCAATTGATGTCAGTGCGTGTGCGTGAATGAGAGTAGCAGTTCATACAT
TCATATATAAATATATATAAATAGGATGATATGATGACTCCTCCATCCTC
CTAGTGTAATCTGTGATTGATTAAATATTGAATGACTTTTCTCTAACATT
GTTTGAGTCAATTTTGTTGTCGTGATTTATAATTTATGTCCGTCTAGTCT
GGGACGGCCATTTACGGGAAAATATTCAAGATTTGATTTATGTGCTTTAT
TAATTGCATATGAGATCCTTTACAATAAATTGCAATATCATACATATTTG
TTTGGTTTCTAATGTAATACTCAAATAATTTGAGGATTACAGTAAATAAT
TAAATATCATTAAATTTAAACATGTATGGAAGTAAGTATTGATAAATTCC
TGGTGTTGTTTTATTAAATGAGCAACTGCCTTAAATCAACAGGTTTGATT
TTATTAATTACAAAGATGAACATCGTGGAATTTTGATTCCAGTAATGCTC
TGGGTAACAATGATGCAGAAACAGTCATCAAATCGCAACTGTTATCTTGA
TTTTTGTGGTTTAGAAGAACAATATCAAGTCATAATGCTGAAATACCTCG
TTAAAAAGAAAAATACTGCTAATCTACGAAGGAATTCCAGAAAAATTTCA
AGGATTCGAGAATAAATTGTGAAAAGCATTCTTAAGACCAGTATCTGTGG
AAATCTACAATTTTGAAAAGGATTCAGAAACGGCAACATTGTTTATCGAA
AAAAGTTGAAAGCTATGGAAAAATATAAATGGGTAAGAAAAATATGAATG
GCTGTGCCTTTCAAAGGGATTCCCATCACATACACGCATAAGAAAATTTT
ACCATTGGGTACTCGTAGATGACGCTGGGAATGTATTCCAGTGGACGTTT
ACCAGTAAAAGGTGAGATATAACTGCTGAAATCACGGTAAACCTCTGGGT
TCACGAGGTACCATAGAAGATTTCGTGCTCATTTTATATTCGGGTCCCTT
TATTTACCAAATGCTAATTGAAAAAATATATATTCAAGAGAAAAATAGAT
TATTTACAATTCATAATTAACAAAAATCATTCCGTGCATATGTTCGTTTT
AGTGATTTAATAGATTTGAGATTATTTTCTTCATCTCTGCTATTAATCTT
GCGGTCTTTAACCTTATTGTCCTCGCTCTTTCGGCTTTTCCTGAACGAGA
TTGTAGAACTTGGGATATTTGATTTGGTCCGGTTTCCATTTGCATACTTC
ACTGGGGCTTTGATTTAGTTCATGAGCATTTGAATATCGTTCTATTCCGG
TCCCGATGTCCAGTTTTAATTTGAATTTCAATATTTTCTACAGAAATCGA
AAGTTTTCTATCTCCTCTACATACTTCCTTCTCAAGATTTCTTTTTGTTG
TACCAGCCTCTTAGCTGCATACGGTCGCGTAAACGTCATTTCCATTCAGT
GGCTTCGTCGAATCACAGGCTCTACATGCCGAGATTGTGTCAATGTCTAA
TAGTCATATCTCCACATTCAATGGAGATTTACATATAATAAAAGCAAATT
AATGCAAACACTAGTTTAGGGTTGATTATTGCTACTTCGGTGATAAGCTT
GCTTCAAATCTTCACGGTGACTTCAATGATGGAATTATTAGTTAAATTAT
GTGTGAGGGTAACCGTCTACCATATTAATCCAAAAACTCAATCAAAAATT
CAATATCCGACTCACAAAGAGTTTAATGCAGTAAGAATCTTGGTCGAAAA
AGTTAATTTCAGTCTATTTTTAGAATGGAATTTCTTGTTACAATACCACT
CCTTGAGATTTCGGTCAAAAAAAATGTTCGTAGATTCTAATTATATATGC
ATAAATAGTTTTTATTATCAAGCTAAATGAATAAGATCCTCTCAAGGGTC
TCGGTTCGCTTGCCTTCCTGAATGGACATAAATACCTAAAGGAATAAAAT
TTCTAAACTTTAGTCTTTTTCCTAAAATGTTTATCATGATGACAAAAAAA
TAAAACAAATATAGAATAGGGCAAAAACAATTTAATAATATCAAAATTAA
AACAAAACTTTCAAATATGGTAAAATTAATAATCATATTAAATAAAAATA
ATAAAAATCGTCGTTACTAATGATCACTGGAAAATATAAGAAAATTTTTA
AATGTCATTTTATTTCTATCGATCTGGCATCGACTTATATAGGGTGGTTT
TCTACATACTTTTTTGATACAGTAAAAAAACGTCTCACATGTTTTTTTCA
AATTTCACCACTTTTCTCCTACTTTTTATTTTTACATTTTTTACTTATTT
TTAAAATTTGCATCGTTTTCCAAAACTTTTCAGCC
back to top

protein sequence of SMED30024756-orf-1

>SMED30024756-orf-1 ID=SMED30024756-orf-1|Name=SMED30024756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=598bp
MKYFIIYIGFIFKLCFAKEPKTFSTNEEVILYVNKVGPYYNPHETYHYYT
LPVCRPPEVSFKSLTLGEVLDGDRMAKSIYKIKFRENLEKATLCTLQLKA
SDTKRLINAIEDLYYFEFVIDDIPIRGFIGNLEESKLLPHTHKALLYTHH
NIEIDYNQNNIIYGNILTTQSDPINLMPYQGKVLNITFTYSVHWISSPIL
VKDRIKRIMKNNFFPVTLEIHWISITNSLILVFLLMTFIMFIISRVLRRD
FARYNNQTDSELMNEEQDEKGWKIVHNDVFRPPNHKLIFCSIIGTGCQLV
TISIGIMLMALSNMFNVHNHGVINIAALMLYSFTSWIAGFVSCRLHKMFQ
NTQLMQESSTNWVRVVNSTTSLFGIPLAFVWLLCNSVSVLYGTTHAMPIT
TILELVLVWLVIGYPLTVTGGMLGKRTDARVDSNGCRARNIAREIPTVVW
YKSKYIYLLLGGFLPFSSICIELYYIFSTLWGREHYNLYGVLFIIFFILL
IVTICVAINLTYFQLVNEDYRWWWNTLQLAGCSGLFVFLYCIFHYFYRSK
MSGFIQSIEYFSYSLLICYAFFLGLGAVSFISSYYFIKFMYRNIKLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004240EMP70
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004240Nonaspanin (TM9SF)PFAMPF02990EMP70coord: 46..554
e-value: 1.1E-137
score: 459.9
IPR004240Nonaspanin (TM9SF)PANTHERPTHR10766TRANSMEMBRANE 9 SUPERFAMILY PROTEINcoord: 21..597
NoneNo IPR availablePANTHERPTHR10766:SF14TRANSMEMBRANE 9 SUPERFAMILY MEMBER-RELATEDcoord: 21..597
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.508
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 319..341
NoneNo IPR availableTMHMMTMhelixcoord: 488..510
NoneNo IPR availableTMHMMTMhelixcoord: 287..309
NoneNo IPR availableTMHMMTMhelixcoord: 565..587
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
NoneNo IPR availableTMHMMTMhelixcoord: 456..478
NoneNo IPR availableTMHMMTMhelixcoord: 523..545