Cationic amino acid transporter

Overview
NameCationic amino acid transporter
Smed IDSMED30024755
Length (bp)1721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cationic amino acid transporter (SMED30024755) t-SNE clustered cells

Violin plots show distribution of expression levels for Cationic amino acid transporter (SMED30024755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cationic amino acid transporter (SMED30024755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cationic amino acid transporter (SMED30024755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30024755SMESG000081276.1 SMESG000043908.1 SMESG000012010.1 Contig37742newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024755SMESG000081276.1 SMESG000043908.1 SMESG000012010.1 Contig37742uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024755SMESG000081276.1 SMESG000081275.1 Contig38862newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024755SMESG000081276.1 SMESG000081275.1 Contig38862uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30024755SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024755SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30024755SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024755SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024755SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024755SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024755SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30024755SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cationic amino acid transporter vs. Ensembl Human
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 309.686 bits (792), Expect = 1.810e-98
Identity = 173/438 (39.50%), Postives = 270/438 (61.64%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            L++T SVG+S  IW + GV S+ GAL YAELG TI  SGG Y YIL+ FG L AF  +W+  L+I  A+TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K++A+L+II  G+  +  G++ +F + F+G + +   L LAFY+G +A+AGW YLNF+TEE++NP + +P+AI +S+ IVT  Y++ NVAY   +   E+L+    S+A+AV F+ER +G+FS  +PI VA S FGSMNG + ++SRL Y  + E HLP  +SMI     TP+P++I++  + +    S D+  L+    FA  +   +A   L+Y+R+K  +    F++ + IP  F    +F+  L+LY  P  + IG  I + GVP + + + W  KP+ F   +E +T   Q +L V+P   E+DK
Sbjct:   70 LQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLL----SNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVP---EEDK 500          
BLAST of Cationic amino acid transporter vs. Ensembl Human
Match: SLC7A8 (solute carrier family 7 member 8 [Source:HGNC Symbol;Acc:HGNC:11066])

HSP 1 Score: 310.457 bits (794), Expect = 3.061e-98
Identity = 173/445 (38.88%), Postives = 273/445 (61.35%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNF---NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPEH 1608
            L++  SVGL+ ++W++TG  +++GAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  F+ Y+L+PLF  C  P S    L    +  L  +NC +V+WA ++  +FT GK+ AL LII +G+  I  G         A  NF   + G ++LAF  G +A+ GWN+LN++TEE+ +P +NLP AI +S+ +VT VY+  NVAY+  ++P+E+L    +S+A+AV F E+ +G  +WIMPI VA S FG +NG + + SRL +AGA E HLP+ ++MI     TP+P+++   +  +   ++ D++ LI   GF   + + +     + +R K  +     ++N++ PI +L+   F+ V +L+ +P    IG+ IM+ GVP++ +GV W+ KPK F++F E LT+ +QK+ +V+ P+ E     E 
Sbjct:   66 LENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEE 506          
BLAST of Cationic amino acid transporter vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 305.834 bits (782), Expect = 9.371e-97
Identity = 179/453 (39.51%), Postives = 263/453 (58.06%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIP-------ASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKD--KPKSFNNFTENLTVWAQKLLLVI--PPDAEDDKNPEH 1608
            L HT S G+S ++W + G+FS++GAL YAELG TI  SG  Y YIL+ FGG +AF  LW++ L++     A  A  FA Y+++P F  C+ P       A+A ICL  F       +NC  VKW  ++   FT  KV AL+ II +GL  +  G S+ F + F GS+++ G+LSLA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT +YI+ NVAY  VL   ++L    SS A+AV FA++T G FSW +PI VA S FG +N  I + SRL + G+ E HLP  +SMI     TP+P+++    + + + +  DVF LI    F+Y     ++    LY+R K  +     +L++  PI F I  +F+ ++ L+     SLIGIGI + GVP + +GV   +  +P    N    +T   Q+L   +    D  ++K  E 
Sbjct:   71 LVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTF-------VNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVL----SSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELDVAEEKKDER 512          
BLAST of Cationic amino acid transporter vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 305.834 bits (782), Expect = 9.371e-97
Identity = 179/453 (39.51%), Postives = 263/453 (58.06%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIP-------ASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKD--KPKSFNNFTENLTVWAQKLLLVI--PPDAEDDKNPEH 1608
            L HT S G+S ++W + G+FS++GAL YAELG TI  SG  Y YIL+ FGG +AF  LW++ L++     A  A  FA Y+++P F  C+ P       A+A ICL  F       +NC  VKW  ++   FT  KV AL+ II +GL  +  G S+ F + F GS+++ G+LSLA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT +YI+ NVAY  VL   ++L    SS A+AV FA++T G FSW +PI VA S FG +N  I + SRL + G+ E HLP  +SMI     TP+P+++    + + + +  DVF LI    F+Y     ++    LY+R K  +     +L++  PI F I  +F+ ++ L+     SLIGIGI + GVP + +GV   +  +P    N    +T   Q+L   +    D  ++K  E 
Sbjct:   71 LVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTF-------VNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVL----SSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELDVAEEKKDER 512          
BLAST of Cationic amino acid transporter vs. Ensembl Human
Match: SLC7A5 (solute carrier family 7 member 5 [Source:HGNC Symbol;Acc:HGNC:11063])

HSP 1 Score: 305.449 bits (781), Expect = 1.109e-96
Identity = 184/437 (42.11%), Postives = 268/437 (61.33%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFN-EP---FAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPD 1581
            LK   S GL+ V+W   GVFSI+GAL YAELG TI  SGG+Y Y+L+ +G L AF  LWI  L+I  +S    A +FA YLLKPLF  C +P  A   +    V  L A+NCY+VK A ++   F   K+ AL LII LG   I  G+ D  N +P   F G+  + G++ LA Y G +A+ GWNYLNF+TEEM NP RNLP+AI++SL IVT VY++ N+AY   L+  +ML    SS A+AV F    +G  SWI+P+ V  S FGS+NG + + SRL + G+ E HLP+ +SMI    LTP+PS++   V+ + +  S D+F +I    F   +  A+A   ++++RH+  E +   ++N+ +P+ F++  +F+  ++ ++ P E  IG  I++ G+P++  GV WK+KPK       + TV  QKL+ V+P +
Sbjct:   76 LKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQI--GKGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTLSTEQML----SSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQE 506          
BLAST of Cationic amino acid transporter vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 303.138 bits (775), Expect = 1.709e-96
Identity = 173/439 (39.41%), Postives = 264/439 (60.14%), Query Frame = 1
Query:  286 KHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRS---DSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQL-SLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
            +   SVGLS ++WL++G+F+ IGA  YAELG  I  SGG+Y YI++ FG  +AF  LWI  +++   +    A  FA Y L+P F +C  P      L +  +  + AINC +V+ A  +   FT+ KV AL LII  GL  +F G S   DSF   F  ++ +   +SLAFY G +A++GWN+LNF+ EE++NP RNLP+AI +S+   T +Y++ NVA    ++P EML     S A+AV FA +  G F++IMP+CVA S  GS NG I + +RL Y+GA E  +P  ++MI+K   TP+P++I+ G + I + L S DV+ LI     +Y +    A  +L ++R    +     ++ +I P  FL   I + ++ +   P+++ IG+ IM+  VP++ + + WK+KPK FN F ++ TV+ QKL +V+  D ED
Sbjct:   59 EQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEML----ESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVVDEDKED 493          
BLAST of Cationic amino acid transporter vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 303.138 bits (775), Expect = 1.709e-96
Identity = 173/439 (39.41%), Postives = 264/439 (60.14%), Query Frame = 1
Query:  286 KHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRS---DSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQL-SLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
            +   SVGLS ++WL++G+F+ IGA  YAELG  I  SGG+Y YI++ FG  +AF  LWI  +++   +    A  FA Y L+P F +C  P      L +  +  + AINC +V+ A  +   FT+ KV AL LII  GL  +F G S   DSF   F  ++ +   +SLAFY G +A++GWN+LNF+ EE++NP RNLP+AI +S+   T +Y++ NVA    ++P EML     S A+AV FA +  G F++IMP+CVA S  GS NG I + +RL Y+GA E  +P  ++MI+K   TP+P++I+ G + I + L S DV+ LI     +Y +    A  +L ++R    +     ++ +I P  FL   I + ++ +   P+++ IG+ IM+  VP++ + + WK+KPK FN F ++ TV+ QKL +V+  D ED
Sbjct:   59 EQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEML----ESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVVDEDKED 493          
BLAST of Cationic amino acid transporter vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 289.656 bits (740), Expect = 2.887e-91
Identity = 172/438 (39.27%), Postives = 267/438 (60.96%), Query Frame = 1
Query:  289 HTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRS---DSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSII-IMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
               SVGLS ++W+L+G+F+ IGA  YAELG  I  SGG+Y YI++ FG  LAF  LWI  +++   +    A  FA Y+LKP + +C+ P  +   +    +  L A+NC +VKWA+K+   F V K +AL+LII  GL+N+  G+    DSF   F  +  +  + SLAFY G +A+ GWNYLNF+ EE++NP RNLP++I +S  + T +Y + NVA    +TP EML    +S A+AV FAE+  G F++ MPI VA S  GS NG IL+ SRL Y GA E  +P  ++M++K+  TP+P++I    + ++   LS +++ LI     +Y +    A  +L Y R    +     +  I+ PI F I  + + ++ +   PK++ IGI IM+ GVP++L+ ++WK KPK  ++ T+++T++ QKL +V+  + E+
Sbjct:   60 QAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEML----ASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVVDANKEE 493          
BLAST of Cationic amino acid transporter vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 288.886 bits (738), Expect = 1.726e-90
Identity = 172/435 (39.54%), Postives = 267/435 (61.38%), Query Frame = 1
Query:  298 SVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRS---DSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSII-IMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
            SVGLS ++W+L+G+F+ IGA  YAELG  I  SGG+Y YI++ FG  LAF  LWI  +++   +    A  FA Y+LKP + +C+ P  +   +    +  L A+NC +VKWA+K+   F V K +AL+LII  GL+N+  G+    DSF   F  +  +  + SLAFY G +A+ GWNYLNF+ EE++NP RNLP++I +S  + T +Y + NVA    +TP EML    +S A+AV FAE+  G F++ MPI VA S  GS NG IL+ SRL Y GA E  +P  ++M++K+  TP+P++I    + ++   LS +++ LI     +Y +    A  +L Y R    +     +  I+ PI F I  + + ++ +   PK++ IGI IM+ GVP++L+ ++WK KPK  ++ T+++T++ QKL +V+  + E+
Sbjct:   99 SVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEML----ASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVVDANKEE 529          
BLAST of Cationic amino acid transporter vs. Ensembl Celegans
Match: aat-2 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19151])

HSP 1 Score: 234.958 bits (598), Expect = 1.571e-70
Identity = 163/442 (36.88%), Postives = 258/442 (58.37%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFG---VFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEP--FAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSF--SWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHE---TKTKFRLNIIIPITFLIVDIFVAVLALYQ-QPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIP 1575
            L    S G+S +IWLL+GVF++IGA+ Y+ELG  IP SGG+Y YI + FG L +F  LW+  ++I   S A  A   A Y L+P F  C +P    + + LF    +  L  INC++V+ A +    FT+ K+ AL LII  G + + +G  D+   P    GS     ++++AFY G ++F+G++YLNF+TEE+KNP RNLP AI +S+ IVT VY++VN+AY  VLT  E+L     S A+A+ FA++ +G+F    +MP+ V+ S  GS+NG +++ SR+ ++GA    LP   +MIS   LTP+PS+I +G   I      +VF LI    FA +++   +   LL +R    E        +++++ PI F ++ +F+ +L  +   P E + G+ +++ G+PI+++ V  K +P    +     T + QKL   +P
Sbjct:   45 LLEAGSAGMSLLIWLLSGVFAMIGAVCYSELGTLIPKSGGDYAYIYEAFGPLPSFLFLWVALVIINPTSLAIIAITCATYALQP-FYSCPVP---DVVVNLFAGCIIAVLTFINCWDVRMATRTNDFFTITKLIALTLIITCGGYWLSLGHIDNLVMPDVAEGSQTKLSAIAMAFYSGVFSFSGFSYLNFVTEELKNPFRNLPRAIYISIPIVTIVYMLVNIAYFSVLTVDEIL----DSDAVAITFADKILGTFGSKILMPLFVSFSCVGSLNGILITCSRMFFSGARNSQLPELFAMISIRQLTPIPSLIFLGGTSIVMLFIGNVFQLINYLSFAESLVVFSSVAGLLKLRFTMPENVLNARPIKISLLWPILFFLMCLFLLILPFFHSDPWELIYGVFLVLSGIPIYVLFVYNKYRPGFIQSVWIGFTHFIQKLFYCVP 478          
BLAST of Cationic amino acid transporter vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085785)

HSP 1 Score: 312.383 bits (799), Expect = 1.110e-99
Identity = 169/437 (38.67%), Postives = 266/437 (60.87%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            L +T SV L+ ++W+++G+FS++GA  YAELG  I  SG +Y YI++TFG  +AF  LWI  +++   S A  A  F+ Y+LKP F EC  P  +   L +  +  L  INC++VKWA  +  +FT  K+ AL +II  G++ +++G +  F   F  ++    S++L+FY G +A+ GWNYLNF+ EE+K+P +NLP AI +S  +VT VY+M NV++  +L+P E++     SSA+AV +AER  G  +W +P+ VA S FG++NG +L+ SRL YAGAN   +P  ++MI     TP P+++ M ++ + +    D+F LI   GFA  +   +A   L ++R          R+ ++ PI +LI  IFV V+ +Y  P E+  GI +++  +P++LV ++WK+KP  F      LT   QKL++V+ P A   
Sbjct:   75 LMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMGGLTQVLQKLMMVVRPKAASK 505          
BLAST of Cationic amino acid transporter vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085786)

HSP 1 Score: 312.383 bits (799), Expect = 1.110e-99
Identity = 169/437 (38.67%), Postives = 266/437 (60.87%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            L +T SV L+ ++W+++G+FS++GA  YAELG  I  SG +Y YI++TFG  +AF  LWI  +++   S A  A  F+ Y+LKP F EC  P  +   L +  +  L  INC++VKWA  +  +FT  K+ AL +II  G++ +++G +  F   F  ++    S++L+FY G +A+ GWNYLNF+ EE+K+P +NLP AI +S  +VT VY+M NV++  +L+P E++     SSA+AV +AER  G  +W +P+ VA S FG++NG +L+ SRL YAGAN   +P  ++MI     TP P+++ M ++ + +    D+F LI   GFA  +   +A   L ++R          R+ ++ PI +LI  IFV V+ +Y  P E+  GI +++  +P++LV ++WK+KP  F      LT   QKL++V+ P A   
Sbjct:   75 LMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMGGLTQVLQKLMMVVRPKAASK 505          
BLAST of Cationic amino acid transporter vs. Ensembl Fly
Match: mnd (gene:FBgn0002778 transcript:FBtr0075626)

HSP 1 Score: 311.997 bits (798), Expect = 1.329e-99
Identity = 178/438 (40.64%), Postives = 274/438 (62.56%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKP-KSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            LK + S+G S ++W+L+GV S++GAL YAELG  IP SGG+Y YI   FG L AF  LW+  L++     A  A  FA YLLKP +  C+ P  A   L    +  L  INCYNVKW  ++  +FT  KV ALL+I+G G++ +F G ++ ++ PF+G   + G ++LAFY G ++++GWNYLNF+TEE+K+P RNLP AI +S+ +VT +Y++ N+AY  VL+P E+L    SS A+AV F ++ +G  SWIMP  VA S FGS+NG I + SRL + GA   HLP AIS+I+ + LTP+PS+I +GV+ +      DV+ LI    +   +   ++   LL++R+K  +T+   ++N+ +PI +LIV +F+ + +  Q P    IG  I++ G+P++ + +    KP K   + ++ + +W  K  + +P   + D
Sbjct:   69 LKFSGSIGQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAFLYLWVALLILVPTGNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCYNVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEIL----SSDAVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRYKQPKTERPIKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTI---HKPVKWLADTSQAINLWCSKFFICMPNQEKFD 499          
BLAST of Cationic amino acid transporter vs. Ensembl Fly
Match: mnd (gene:FBgn0002778 transcript:FBtr0114529)

HSP 1 Score: 311.997 bits (798), Expect = 1.329e-99
Identity = 178/438 (40.64%), Postives = 274/438 (62.56%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKP-KSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            LK + S+G S ++W+L+GV S++GAL YAELG  IP SGG+Y YI   FG L AF  LW+  L++     A  A  FA YLLKP +  C+ P  A   L    +  L  INCYNVKW  ++  +FT  KV ALL+I+G G++ +F G ++ ++ PF+G   + G ++LAFY G ++++GWNYLNF+TEE+K+P RNLP AI +S+ +VT +Y++ N+AY  VL+P E+L    SS A+AV F ++ +G  SWIMP  VA S FGS+NG I + SRL + GA   HLP AIS+I+ + LTP+PS+I +GV+ +      DV+ LI    +   +   ++   LL++R+K  +T+   ++N+ +PI +LIV +F+ + +  Q P    IG  I++ G+P++ + +    KP K   + ++ + +W  K  + +P   + D
Sbjct:   69 LKFSGSIGQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAFLYLWVALLILVPTGNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCYNVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEIL----SSDAVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRYKQPKTERPIKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTI---HKPVKWLADTSQAINLWCSKFFICMPNQEKFD 499          
BLAST of Cationic amino acid transporter vs. Ensembl Fly
Match: mnd (gene:FBgn0002778 transcript:FBtr0075627)

HSP 1 Score: 311.997 bits (798), Expect = 1.329e-99
Identity = 178/438 (40.64%), Postives = 274/438 (62.56%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKP-KSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            LK + S+G S ++W+L+GV S++GAL YAELG  IP SGG+Y YI   FG L AF  LW+  L++     A  A  FA YLLKP +  C+ P  A   L    +  L  INCYNVKW  ++  +FT  KV ALL+I+G G++ +F G ++ ++ PF+G   + G ++LAFY G ++++GWNYLNF+TEE+K+P RNLP AI +S+ +VT +Y++ N+AY  VL+P E+L    SS A+AV F ++ +G  SWIMP  VA S FGS+NG I + SRL + GA   HLP AIS+I+ + LTP+PS+I +GV+ +      DV+ LI    +   +   ++   LL++R+K  +T+   ++N+ +PI +LIV +F+ + +  Q P    IG  I++ G+P++ + +    KP K   + ++ + +W  K  + +P   + D
Sbjct:   69 LKFSGSIGQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAFLYLWVALLILVPTGNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCYNVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEIL----SSDAVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRYKQPKTERPIKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTI---HKPVKWLADTSQAINLWCSKFFICMPNQEKFD 499          
BLAST of Cationic amino acid transporter vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 316.62 bits (810), Expect = 2.789e-101
Identity = 183/438 (41.78%), Postives = 270/438 (61.64%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFN----EPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDA 1584
            +K   SVGLS V+W + GVFS IGAL YAELG TI  SGG+Y YIL+ +G L AF  LWI  L+I  +S    A++FA Y+LKP+F  C +P +    +    +  L A+NCY+VK A ++   F   K+ AL LII +G   I  G+ D+        F GSN + G++ LA Y G +A+ GWNYLNF+TEEM  P +NLP AI++SL IVT VY++ N+AY   L+P +ML    SS A+AV F    +G  +WI+P+ V  S FGS+NG + + SRL + G+ E HLP+ +SMI    LTP+PS+I   ++ + +  S D+F +I    F   +  AMA   ++++R+K  E +   ++NI++PI F++  +F+ V++ ++ P E  IG GI+  GVP++  GV W+ KPK       + TV  QK++ V+P ++
Sbjct:   66 VKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEI--GKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKML----SSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVVPQES 497          
BLAST of Cationic amino acid transporter vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 315.849 bits (808), Expect = 9.756e-101
Identity = 183/438 (41.78%), Postives = 270/438 (61.64%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFN----EPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDA 1584
            +K   SVGLS V+W + GVFS IGAL YAELG TI  SGG+Y YIL+ +G L AF  LWI  L+I  +S    A++FA Y+LKP+F  C +P +    +    +  L A+NCY+VK A ++   F   K+ AL LII +G   I  G+ D+        F GSN + G++ LA Y G +A+ GWNYLNF+TEEM  P +NLP AI++SL IVT VY++ N+AY   L+P +ML    SS A+AV F    +G  +WI+P+ V  S FGS+NG + + SRL + G+ E HLP+ +SMI    LTP+PS+I   ++ + +  S D+F +I    F   +  AMA   ++++R+K  E +   ++NI++PI F++  +F+ V++ ++ P E  IG GI+  GVP++  GV W+ KPK       + TV  QK++ V+P ++
Sbjct:   92 VKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEI--GKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKML----SSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVVPQES 523          
BLAST of Cationic amino acid transporter vs. Ensembl Zebrafish
Match: slc7a8a (solute carrier family 7 member 8a [Source:ZFIN;Acc:ZDB-GENE-121120-2])

HSP 1 Score: 307.375 bits (786), Expect = 2.566e-97
Identity = 173/447 (38.70%), Postives = 274/447 (61.30%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGR------SDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPE 1605
            L++  SVGL+ ++W+LTG+ + IGAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  F+ Y+L+PLF  C  P +    L    +  L  +NC +V+WA ++  VFT GK+ AL+LII +G+  I  G       +++F EPF   +++ G ++LAF  G +A+ GWN+LN++TEE+ +P  NLP AI +S+ +VT VY+  N+AY+  ++P+E+L    +S+A+AV F E+ +G  SWIMPI VA S FG +NG + + SRL +AGA E HLP+ ++MI     TP+P+++   +  +    + D++ LI   GF   + + +     + +R K  +     +++++ P+ +L+   F+ + +LY +P    IG+ IM+ GVP++ +GV W +KP+ FN F + +T   QK  +V+ P  E  K  E
Sbjct:   65 LENASSVGLALIVWILTGIITAIGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPENGLRILAAICLLLLTWVNCSSVRWATRVQDVFTAGKLLALILIIIMGIVQICKGEYYWLEPANAF-EPF--QDYDVGLIALAFLQGSFAYGGWNFLNYVTEELVDPYVNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELL----ASNAVAVTFGEKLLGVMSWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLLAMIHVKRCTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIKQPDMHRPIKISLVWPVIYLLFWAFLLIFSLYSEPVVCGIGLAIMLTGVPVYFLGVYWDNKPQCFNTFVDKMTYLGQKFCVVVYPMEEVKKTDE 504          
BLAST of Cationic amino acid transporter vs. Ensembl Zebrafish
Match: slc7a8b (solute carrier family 7 member 8b [Source:ZFIN;Acc:ZDB-GENE-030616-586])

HSP 1 Score: 305.449 bits (781), Expect = 6.739e-97
Identity = 178/448 (39.73%), Postives = 271/448 (60.49%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMG-----RSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVI-PPDAEDDKNPEH 1608
            L+++ SVGL+ ++W+LTG+ + IGAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  FA Y L+PLF  C  P  A   L    +  L  INC +V+WA ++  VFT GK+ AL LII +G+  I  G       +    P     ++ G ++LA   G +A+AGWN+LN++TEE+ +P RNLP AI +S+ +VT VY+  N+AY+  ++P+E+L    +S+A+AV F E+ +G  SW+MPI VA S FG +NG + + SRL +AGA E HLP  ++MI  +  TP+P+++I  +  +      D++ LI   GF   + + +     + +R +  +     ++++  P  FLI   F+ + +LY +P    IG+ IM+ GVP++L G+ W++KPKSF++F   LT   QKL LV+ P +  +D N + 
Sbjct:   60 LENSGSVGLALIVWILTGIITAIGALCYAELGVTIPKSGGDYSYVNDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFANYALQPLFPSCFPPERALGLLAAVCLLLLTWINCSSVRWATRVQDVFTTGKLLALGLIIIMGIVQICKGHFYWLEPEHAFHPL--QPYDMGRIALAVLQGSFAYAGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVSANIAYVTAMSPQELL----ASNAVAVTFGEKLLGVMSWLMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPRLLAMIHVNRCTPIPALLITCISTLLMLCVSDIYTLINYVGFINYLFYGVTVAGQIVLRIREPDIYRPIKVSLAWPAVFLIFWAFLLIFSLYSEPVVCCIGLAIMLSGVPVYLFGIYWENKPKSFSSFVARLTHLGQKLCLVVYPGEDREDGNEDR 501          
BLAST of Cationic amino acid transporter vs. Ensembl Zebrafish
Match: slc7a8b (solute carrier family 7 member 8b [Source:ZFIN;Acc:ZDB-GENE-030616-586])

HSP 1 Score: 305.449 bits (781), Expect = 6.739e-97
Identity = 178/448 (39.73%), Postives = 271/448 (60.49%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMG-----RSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVI-PPDAEDDKNPEH 1608
            L+++ SVGL+ ++W+LTG+ + IGAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  FA Y L+PLF  C  P  A   L    +  L  INC +V+WA ++  VFT GK+ AL LII +G+  I  G       +    P     ++ G ++LA   G +A+AGWN+LN++TEE+ +P RNLP AI +S+ +VT VY+  N+AY+  ++P+E+L    +S+A+AV F E+ +G  SW+MPI VA S FG +NG + + SRL +AGA E HLP  ++MI  +  TP+P+++I  +  +      D++ LI   GF   + + +     + +R +  +     ++++  P  FLI   F+ + +LY +P    IG+ IM+ GVP++L G+ W++KPKSF++F   LT   QKL LV+ P +  +D N + 
Sbjct:   60 LENSGSVGLALIVWILTGIITAIGALCYAELGVTIPKSGGDYSYVNDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFANYALQPLFPSCFPPERALGLLAAVCLLLLTWINCSSVRWATRVQDVFTTGKLLALGLIIIMGIVQICKGHFYWLEPEHAFHPL--QPYDMGRIALAVLQGSFAYAGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVSANIAYVTAMSPQELL----ASNAVAVTFGEKLLGVMSWLMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPRLLAMIHVNRCTPIPALLITCISTLLMLCVSDIYTLINYVGFINYLFYGVTVAGQIVLRIREPDIYRPIKVSLAWPAVFLIFWAFLLIFSLYSEPVVCCIGLAIMLSGVPVYLFGIYWENKPKSFSSFVARLTHLGQKLCLVVYPGEDREDGNEDR 501          
BLAST of Cationic amino acid transporter vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 318.931 bits (816), Expect = 5.358e-102
Identity = 179/443 (40.41%), Postives = 267/443 (60.27%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIF--LVGVSWKDKPKSFNNFTENLTVWAQKLL--LVIPPDAEDDKN 1599
            L ++ S GLS V+W + G+FSI GAL YAELG TI  SG  Y YIL+ FGG +AF  LW + L+I   S A  A  F+ Y+L+P+F  C  P +A   +    +  L  +NC  VKW  ++  +FT  KV AL+ +I  G+  I  G S++F   FAGS+++ G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT +YI+ NVAY  VL  RE+L    +S A+AV FA++  G F+W +P+ VA S FG +N  IL+ SRL + G+ E HLP A+SMI     TP+P+++  G + + +    D+F LI    F+Y +   ++    LY+R K  +     +L+++ PI F +  +F+  + LY     SLIG+GI + GVP++  LV VS K KP+        LT + Q L   ++   D E++K+
Sbjct:   65 LIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREIL----ASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRWKQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAGALTRYTQILCYSVLTEMDTEEEKD 503          
BLAST of Cationic amino acid transporter vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 318.546 bits (815), Expect = 6.664e-102
Identity = 179/443 (40.41%), Postives = 267/443 (60.27%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIF--LVGVSWKDKPKSFNNFTENLTVWAQKLL--LVIPPDAEDDKN 1599
            L ++ S GLS V+W + G+FSI GAL YAELG TI  SG  Y YIL+ FGG +AF  LW + L+I   S A  A  F+ Y+L+P+F  C  P +A   +    +  L  +NC  VKW  ++  +FT  KV AL+ +I  G+  I  G S++F   FAGS+++ G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT +YI+ NVAY  VL  RE+L    +S A+AV FA++  G F+W +P+ VA S FG +N  IL+ SRL + G+ E HLP A+SMI     TP+P+++  G + + +    D+F LI    F+Y +   ++    LY+R K  +     +L+++ PI F +  +F+  + LY     SLIG+GI + GVP++  LV VS K KP+        LT + Q L   ++   D E++K+
Sbjct:   53 LIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREIL----ASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRWKQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAGALTRYTQILCYSVLTEMDTEEEKD 491          
BLAST of Cationic amino acid transporter vs. Ensembl Xenopus
Match: SLC7A10 (solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10 [Source:NCBI gene;Acc:100494333])

HSP 1 Score: 317.39 bits (812), Expect = 9.549e-102
Identity = 181/456 (39.69%), Postives = 276/456 (60.53%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNF----NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPD---AEDDKNP--EHYITNE 1623
            L+HT SVGL+ +IW+L G  + +G+L YAELGVTIP SGG+Y Y+ + FGGL  F  LW T L++   S A     F+ Y+L+P+F EC  P  A   L +  +  L  +N  +V+WA ++  +FT GK+ AL LII +G   IF G  +   +P    NF      G L+LAF    +AF+GWN+LN++TEEM +P RNLP AI LS+ +VT VY   N+AY   ++P+E++    SS+A+AV F E+ +G FSWIMP+ VA S FG +NG + + SRL ++GA E HLP+ ++MI   + TP+P++++     I   L  D + LI    F   + + +    L+ +R K  +     ++N++IPIT+L+   F+ + + Y +P    +G+ I++ GVP+F +GV WK+KPK  + F E++T   QK+  V+ P     E++  P  E+ +TN 
Sbjct:   25 LEHTGSVGLALIIWVLGGGVAALGSLCYAELGVTIPKSGGDYSYVTEIFGGLAGFLLLWSTVLIMYPTSLAVITLTFSNYVLQPVFPECIPPYDASRVLSIVCLLLLTWVNSSSVRWATRIQDIFTAGKLLALGLIIVVGFMQIFKGNYEEL-KPSNAFNFWMIPTVGQLALAFLQASFAFSGWNFLNYVTEEMVDPRRNLPRAIFLSIPLVTFVYTFTNIAYFTAMSPQELM----SSNAVAVTFGEKLLGYFSWIMPVSVALSTFGGINGYLFTSSRLCFSGAREGHLPSLLAMIHFKYCTPVPALLVCCGATIIIMLVGDTYTLINYVSFINYLCYGVTIMGLIVLRLKKPKMFRPIKVNLLIPITYLVFWAFLLIFSFYSEPVVCGVGLIIILTGVPVFFLGVYWKNKPKCIDRFIESMTYCGQKVCYVVYPQPNVPEEEIMPQNENQVTNN 475          
BLAST of Cationic amino acid transporter vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 315.849 bits (808), Expect = 6.446e-101
Identity = 197/479 (41.13%), Postives = 300/479 (62.63%), Query Frame = 1
Query:  148 MPFCKKKL-KVDEKAVLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPD 1581
            +P   KK+ +  EK VL+K++ +L+G+SIIIG IIG+GIF+SP G+L++T SVG+S V+W   G+ S+ GAL YAELG  I  SGG Y YIL+ FG L AF  +W+  L+I  A+TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K+ A+L+II  G+  +  G + +F + F G + +   L LAFY G +A+AGW YLNF+TEE++NP +N+P+AI +S+ IVT  Y++ NVAY   ++  E+++    SSA+AV +AER  GSFS  +PI VA S FGSMNG + ++SR+ Y  + E HLP  +SMI     TP+P++I++  + +    + D++ L+    F   +   +A   L+Y+R+K  E    F++ I IP  F    +F+  L+LY  P  + IG  I + GVP + + V W +KP+ F  FT+  T+  Q LL V P D
Sbjct:   22 LPSADKKMSEKGEKVVLKKKVTLLRGISIIIGTIIGAGIFISPKGILQNTGSVGMSLVVWTACGILSLFGALCYAELGTCIKKSGGHYTYILEAFGPLPAFIRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPDLAIKLVTALGITIVMVLNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELVL----SSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTDRTTLMLQILLEVAPTD 496          
BLAST of Cationic amino acid transporter vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 316.62 bits (810), Expect = 8.290e-101
Identity = 178/442 (40.27%), Postives = 267/442 (60.41%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIF--LVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNP 1602
            L ++ S GLS V+W + G+FSI GAL YAELG TI  SG  Y YIL+ FGG +AF  LW + L+I   S A  A  F+ Y+L+P+F  C  P +A   +    +  L  +NC  VKW  ++  +FT  KV AL+ +I  G+  I  G S++F   FAGS+++ G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT +YI+ NVAY  VL  RE+L    +S A+AV FA++  G F+W +P+ VA S FG +N  IL+ SRL + G+ E HLP A+SMI     TP+P+++  G + + +    D+F LI    F+Y +   ++    LY+R K  +     +L+++ PI F +  +F+  + LY     SLIG+GI + GVP++  LV VS K KP+     ++ +   A+  L + PP+ +   NP
Sbjct:   65 LIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREIL----ASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRWKQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRVSDLVQPGARICLNLNPPE-KGKPNP 501          
BLAST of Cationic amino acid transporter vs. Ensembl Mouse
Match: Slc7a11 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 [Source:MGI Symbol;Acc:MGI:1347355])

HSP 1 Score: 315.464 bits (807), Expect = 8.465e-101
Identity = 193/471 (40.98%), Postives = 298/471 (63.27%), Query Frame = 1
Query:  178 DEKAVLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
             EK VL+K+I +L+GVSIIIG +IGSGIF+SP G+L++T SVG+S V W   GV S+ GAL YAELG +I  SGG Y YIL+ FG LLAF  +W+  L+I   +TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K++A+L+II  G+  +  G++  F + F+G + +   L LAFY+G +A+AGW YLNF+TEE+ NP + +P+AI +S+ I+T  Y++ NVAY   ++  E+L     SSA+AV F+ER +G FS  +PI VA S FGSMNG + ++SRL Y  + E HLP  +SMI     TP+P++I++  + +    S D++ L+    FA  +   +A   L+Y+R+K  +    F++ + IP  F    +F+ VL+LY  P  + +G  I + GVP + + + W  KPK F   ++ +T   Q +L V+P D+++
Sbjct:   35 QEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELL----QSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITRTLQIILEVVPEDSKE 501          
BLAST of Cationic amino acid transporter vs. Ensembl Mouse
Match: Slc7a6 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 6 [Source:MGI Symbol;Acc:MGI:2142598])

HSP 1 Score: 309.301 bits (791), Expect = 2.936e-98
Identity = 179/446 (40.13%), Postives = 261/446 (58.52%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKD--KPKSFNNFTENLTVWAQKLLLVI--PPDAEDDKNPEH 1608
            LK+T S GLS ++W + G+FS++GAL YAELG TI  SG  Y YIL+ FGG +AF  LW++ L++   S A  A  FA Y++KP F  C+ P  A   L    V  L  +NC  VKW  ++   FT  KV AL+ II +GL  +  G ++ F + F GS++N G LSLA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT +YI+ NVAY  VL  +++      S A+AV FA++T G FSW +PI VA S FG +N  I + SRL + G+ E HLP  +SMI     TP+P+++    + + + +  DVF LI    F+Y     ++    LY+R K  +     +L++  PI F +  +F+  + L+     SLIGIGI + GVP++ +GV   +  +P    N    +T   QKL   +    D  ++KN E 
Sbjct:   71 LKYTASYGLSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLIVEPTSQAIIAITFANYIIKPSFPTCDPPYVACRLLAAACVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDV----HKSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRWKEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVTRVTQKLCFCVLTELDVTEEKNVER 512          
BLAST of Cationic amino acid transporter vs. Ensembl Mouse
Match: Slc7a10 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 10 [Source:MGI Symbol;Acc:MGI:1858261])

HSP 1 Score: 307.375 bits (786), Expect = 2.040e-97
Identity = 170/444 (38.29%), Postives = 269/444 (60.59%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNF---NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDA--EDDKN 1599
            L+H+ SVGL+  +W+L G  + +G+L YAELGV IP SGG+Y Y+ + FGGL  F  LW   L++   S A  +  F+ Y+L+P+F  C  PA+A   L +  +  L  +N  +V+WA ++ ++FT GK+ AL LII +G   IF G  +      A + +   + G L+LAF  G +AF+GWN+LN++TEE+ +P +NLP AI +S+ +VT VY   NVAY   ++P+E+L    SS+A+AV F E+ +G FSW+MP+ VA S FG +NG + + SRL ++GA E HLP+ ++MI     TP+P++++         L  D + LI    F   + + +    LL +R +        ++N+++P+ +L+   F+ V +   +P    +GI I++ GVPIF +GV W+ KPK  + FTE++T W Q+L  V+ P    E+++N
Sbjct:   72 LEHSGSVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGFLLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNCIPPATASRVLSMACLMLLTWVNSSSVRWATRIQVIFTGGKLLALSLIITVGFVQIFQGHFEELRPTNAFAFWMTPSVGHLALAFLQGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTFVYTFTNVAYFTAMSPQELL----SSNAVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTSSRLCFSGAREGHLPSFLAMIHVRRCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLVLRWRRPALHRPIKVNLLVPVVYLVFWAFLLVFSFISEPMVCGVGIIIILTGVPIFFLGVFWRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEEN 511          
BLAST of Cationic amino acid transporter vs. Ensembl Mouse
Match: Slc7a8 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 [Source:MGI Symbol;Acc:MGI:1355323])

HSP 1 Score: 305.449 bits (781), Expect = 1.527e-96
Identity = 171/453 (37.75%), Postives = 276/453 (60.93%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNF---NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPP--------DAEDDKNPEH 1608
            L++  SVGL+ ++W++TG+ + +GAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  F+ Y+L+PLF  C  P S    L    +  L  +NC +V+WA ++  +FT GK+ AL LII +G+  I  G         A  NF   + G ++LAF  G +A+ GWN+LN++TEE+ +P +NLP AI +S+ +VT VY+  N+AY+  ++P+E+L    +S+A+AV F E+ +G  +WIMPI VA S FG +NG + + SRL +AGA E HLP+ ++MI     TP+P+++   +  +   ++ D++ LI   GF   + + +     + +R K  +     +++++ PI +L+   F+ + +L+ +P    IG+ IM+ GVP++ +GV W+ KPK FN+F ++LT+ +QK+ +V+ P        +  DD   +H
Sbjct:   65 LENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYPQEGNSGAEETTDDLEEQH 513          
BLAST of Cationic amino acid transporter vs. Ensembl Mouse
Match: Slc7a11 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 [Source:MGI Symbol;Acc:MGI:1347355])

HSP 1 Score: 303.908 bits (777), Expect = 1.653e-96
Identity = 191/470 (40.64%), Postives = 291/470 (61.91%), Query Frame = 1
Query:  178 DEKAVLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAE 1587
             EK VL+K+I +L+GVSIIIG +IGSGIF+SP G+L++T SVG+S V W   GV S+ GAL YAELG +I  SGG Y YIL+ FG LLAF  +W+  L+I   +TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K++A+L+II  G+  +  G++  F + F+G + +   L LAFY+G +A+AGW YLNF+TEE+ NP + +P+AI +S+ I+T  Y++ NVAY   ++  E+L     SSA+AV F+ER +G FS  +PI VA S FGSMNG + ++SRL Y  + E HLP  +SMI     TP+P++I++  + +    S D++ L+    FA  +   +A   L+Y+R+K  +    F++ + IP  F    +F+ VL+LY  P  + +G  I + GVP + + + W  KPK           W ++L    PP+ E
Sbjct:   35 QEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELL----QSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPK-----------WFRRLSAYYPPEKE 489          
BLAST of Cationic amino acid transporter vs. UniProt/SwissProt
Match: sp|Q9WTR6|XCT_MOUSE (Cystine/glutamate transporter OS=Mus musculus OX=10090 GN=Slc7a11 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 5.921e-100
Identity = 193/471 (40.98%), Postives = 298/471 (63.27%), Query Frame = 1
Query:  178 DEKAVLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
             EK VL+K+I +L+GVSIIIG +IGSGIF+SP G+L++T SVG+S V W   GV S+ GAL YAELG +I  SGG Y YIL+ FG LLAF  +W+  L+I   +TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K++A+L+II  G+  +  G++  F + F+G + +   L LAFY+G +A+AGW YLNF+TEE+ NP + +P+AI +S+ I+T  Y++ NVAY   ++  E+L     SSA+AV F+ER +G FS  +PI VA S FGSMNG + ++SRL Y  + E HLP  +SMI     TP+P++I++  + +    S D++ L+    FA  +   +A   L+Y+R+K  +    F++ + IP  F    +F+ VL+LY  P  + +G  I + GVP + + + W  KPK F   ++ +T   Q +L V+P D+++
Sbjct:   35 QEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELL----QSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITRTLQIILEVVPEDSKE 501          
BLAST of Cationic amino acid transporter vs. UniProt/SwissProt
Match: sp|Q9UPY5|XCT_HUMAN (Cystine/glutamate transporter OS=Homo sapiens OX=9606 GN=SLC7A11 PE=1 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 8.694e-98
Identity = 173/438 (39.50%), Postives = 270/438 (61.64%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            L++T SVG+S  IW + GV S+ GAL YAELG TI  SGG Y YIL+ FG L AF  +W+  L+I  A+TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K++A+L+II  G+  +  G++ +F + F+G + +   L LAFY+G +A+AGW YLNF+TEE++NP + +P+AI +S+ IVT  Y++ NVAY   +   E+L+    S+A+AV F+ER +G+FS  +PI VA S FGSMNG + ++SRL Y  + E HLP  +SMI     TP+P++I++  + +    S D+  L+    FA  +   +A   L+Y+R+K  +    F++ + IP  F    +F+  L+LY  P  + IG  I + GVP + + + W  KP+ F   +E +T   Q +L V+P   E+DK
Sbjct:   70 LQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLL----SNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVP---EEDK 500          
BLAST of Cationic amino acid transporter vs. UniProt/SwissProt
Match: sp|Q5RAG7|XCT_PONAB (Cystine/glutamate transporter OS=Pongo abelii OX=9601 GN=SLC7A11 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.136e-97
Identity = 173/438 (39.50%), Postives = 270/438 (61.64%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            L++T SVG+S  IW + GV S+ GAL YAELG TI  SGG Y YIL+ FG L AF  +W+  L+I  A+TA  +  F +Y+L+P F++CEIP  A   +   G+  ++ +N  +V W+A++ I  T  K++A+L+II  G+  +  G++ +F + F+G + +   L LAFY+G +A+AGW YLNF+TEE++NP + +P+AI +S+ IVT  Y++ NVAY   +   E+L+    S+A+AV F+ER +G+FS  +PI VA S FGSMNG + ++SRL Y  + E HLP  +SMI     TP+P++I++  + +    S D+  L+    FA  +   +A   L+Y+R+K  +    F++ + IP  F    +F+  L+LY  P  + IG  I + GVP + + + W  KP+ F   +E +T   Q +L V+P   E+DK
Sbjct:   70 LQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLL----SNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGSVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVP---EEDK 500          
BLAST of Cationic amino acid transporter vs. UniProt/SwissProt
Match: sp|Q9N1Q4|LAT2_RABIT (Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC7A8 PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.424e-97
Identity = 173/450 (38.44%), Postives = 275/450 (61.11%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRS---------DSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPE 1605
            L++  SVGL+ ++W++TG+ + +GAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  F+ Y+L+PLF  C  P S    L    +  L  +NC +V+WA ++  +FT GK+ AL LII +G+  I  G           D+F EP      + G ++LAF  G +A+ GWN+LN++TEE+ +P +NLP AI +S+ +VT VY+  NVAY+  ++P+E+L    +S+A+AV F E+ +G  +WIMPI VA S FG +NG + + SRL +AGA E HLP+ ++MI     TP+P+++   +  +   ++ D++ LI   GF   + + +     + +R K  +     ++N++ PI +L+   F+ + +L+ +P    IG+ IM+ GVP++ +GV W+ KPK FN+F E LT+ +QK+ +V+ P+ +     E
Sbjct:   66 LENAGSVGLAVIVWIVTGLITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPDSGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGVVQICKGEYFWLEPKNAFDNFQEP------DIGLIALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYITAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIELLTLVSQKMCVVVYPEVDGGSGTE 505          
BLAST of Cationic amino acid transporter vs. UniProt/SwissProt
Match: sp|Q9UHI5|LAT2_HUMAN (Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.470e-97
Identity = 173/445 (38.88%), Postives = 273/445 (61.35%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNF---NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPEH 1608
            L++  SVGL+ ++W++TG  +++GAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  F+ Y+L+PLF  C  P S    L    +  L  +NC +V+WA ++  +FT GK+ AL LII +G+  I  G         A  NF   + G ++LAF  G +A+ GWN+LN++TEE+ +P +NLP AI +S+ +VT VY+  NVAY+  ++P+E+L    +S+A+AV F E+ +G  +WIMPI VA S FG +NG + + SRL +AGA E HLP+ ++MI     TP+P+++   +  +   ++ D++ LI   GF   + + +     + +R K  +     ++N++ PI +L+   F+ V +L+ +P    IG+ IM+ GVP++ +GV W+ KPK F++F E LT+ +QK+ +V+ P+ E     E 
Sbjct:   66 LENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEE 506          
BLAST of Cationic amino acid transporter vs. TrEMBL
Match: A0A0H3YF65 (Slc7a-8 OS=Schmidtea mediterranea OX=79327 GN=slc7a-8 PE=2 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 2.242e-162
Identity = 242/436 (55.50%), Postives = 329/436 (75.46%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
            LK+T+SVG+S ++W+L G+FS +G++VYAELGVTIP SGGEYIYIL++FG L AF C+WITF+ IG  S AAN+ IFAQY+L+PLF  C+IP SA I +GL G+ ++ AINCY+VKWA +  + FT+ KV ALL+II +G + +F G   SF +PFA SN + GSL+LAFY GFWA+AGWNYLNFLT EM NP+RNLPIAI+ SL IVT +Y+  N+AYL VL+PREML     S A+AV FA++TMG FS +MPI V ASVFGSMNGE LS+SRLTY  A + HLP +++M+S  +LTPMP++I +  + + F  +  + YLIELAGF++ VI  MA   L+Y+R K       F+L +++PI FL++D+F+ +L +Y++P +SLIG+ I+ LG+PI+++ V WK KPKS  N TE+LT++ QK  LV+P + E+
Sbjct:   44 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLVLPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 479          
BLAST of Cationic amino acid transporter vs. TrEMBL
Match: A0A0H3YK27 (Slc7a-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc7a-4 PE=2 SV=1)

HSP 1 Score: 478.019 bits (1229), Expect = 3.732e-161
Identity = 237/410 (57.80%), Postives = 319/410 (77.80%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPK 1512
            LK+T SVGLSFV+WL+ G+FS  GALV+AELG TIP SGGEYIYI+KTFG + AF CLWITF+LIGA +TAAN+ IFAQY+L+P+F  CE+P +A +     G+ TL AINCYNV+WA K+AIVFTV KV ALL+II +G   +  G ++SF +PF+GS F+  S+ +AFY GFWA++GWNYLNFLT EMKNP +NLP+AI+LSL ++T VY++VNVAYL VL+P+E+L+ G+SS+A+AV FA+RTMG  SW+MPI V  SVFGSMN E+LS+SRLT  GA EK +P  ++M+S  HLTPMP++II+ ++ I FQ   + FYLIELAGFA+ VI AMA C LLY+R+K  +    F+L II+P+ FL+ D+F+  L +YQQP +S I + +M+L +P++++ ++W  K +
Sbjct:   72 LKYTDSVGLSFVMWLIAGIFSTTGALVWAELGTTIPRSGGEYIYIMKTFGSMPAFLCLWITFILIGAVATAANSMIFAQYILQPIFGSCEVPVTAVLITANLGIMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKTE 481          
BLAST of Cationic amino acid transporter vs. TrEMBL
Match: A0A564YEX9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5212 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 5.832e-149
Identity = 231/439 (52.62%), Postives = 323/439 (73.58%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKN 1599
            LK+++SVGLS ++W++ GVFS++GALVYAELGV I  SGGEY YIL+ FGGL AF  +WITF++IG  S AAN+ +FAQY+L+P++ +CEIP+     + + G+  + AINCY VKWAA++A++F+ GK+ ALLLIIG GL+ +  G  ++F+  F  S ++ G L+L+FY GFWAF+GWNYLNFLTEE+KNP +NLP++I + L +VT +Y++ N+AYL VL+  EML +G  SSA+AV FA+R M   + +MPI V ASVFGS+NGE +SMSRLTY GA E H+P+ +SMI  ++ TP+P+III+  + I FQ   D+F LIELAGFA++ I ++A  SL+Y+R++    KT FRL II PI FLI D+F+  L +YQQPKESL  + +M+  +PI+  GVSWK+KP+S  N     TV+ QK+  V+P + E   +
Sbjct:   54 LKYSNSVGLSLIMWVVPGVFSMLGALVYAELGVRIQKSGGEYAYILEAFGGLPAFIVMWITFVIIGGVSCAANSLVFAQYILQPIYPDCEIPSHIVTMVAICGLMLICAINCYKVKWAARVAVIFSFGKIFALLLIIGFGLYFLATGHVENFHNAFEDSRYSPGELALSFYQGFWAFSGWNYLNFLTEEIKNPGKNLPLSIGIGLSLVTGLYMLTNIAYLAVLSRHEMLASGSGSSAVAVIFAQRAMPWIAMLMPIFVGASVFGSINGEAMSMSRLTYTGAREGHMPSILSMIHHTNFTPIPAIIILLFLAIGFQFYSDIFALIELAGFAFSFIASLAVASLIYMRYRDPHLKTSFRLPIIFPILFLICDVFILALTVYQQPKESLSNVILMLSAIPIYWFGVSWKNKPRSLQNTIYKTTVYLQKVFAVVPVEDESQLD 492          
BLAST of Cationic amino acid transporter vs. TrEMBL
Match: A0A158R9Z0 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8071 PE=4 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 1.895e-147
Identity = 233/446 (52.24%), Postives = 322/446 (72.20%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSR-------LTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKN 1599
            L++++SVGLS ++W++ G+FS++GALVYAELGV I  SGGEY YIL+ FGGL AF  +WITF++IG  S AAN+ +FA+Y+L+P++ +C IP      + L G+  + AINCY V+WA +LA++F+ GKV ALLLII  GL+ +  G  +SF+  F GSN + G L+L+FY GFWAF+GWNYLNFL EEM+NP RNLP+AI ++L +VT +Y++ N+AYL VL+P EML  G  SSAIAV FAER M   S +MP+ V ASVFGS+NGE LSMSR       LTY GA E H+P+ ++MI   + TP+P+I+I+ V+ + +Q   D+F LIELAGFA++ I A+A  +LLY+R+K  + KT F+L I  P+ FL  D+F+ VL +YQQP+ESL  + +M+  VPI+ +GVSWK+KPKSF NF    TV+ QK+   +P + E   +
Sbjct:   55 LRYSNSVGLSLIMWIVPGLFSMLGALVYAELGVRIQKSGGEYAYILEAFGGLPAFIVMWITFVVIGGVSCAANSIVFAEYMLQPVYPDCAIPGPVVSMIALCGLMLICAINCYKVRWATRLAVIFSCGKVIALLLIISFGLYYLTTGHVESFHNAFEGSNLSPGYLALSFYQGFWAFSGWNYLNFLVEEMENPGRNLPLAIGIALSLVTGLYMLTNIAYLAVLSPYEMLATGSGSSAIAVVFAERAMPWISMLMPVFVGASVFGSINGEALSMSRCVLFLFSLTYTGAREGHMPSILAMIHHCNFTPIPAILILLVLAVSYQFYSDLFALIELAGFAFSFIAALAVTALLYMRYKDPKLKTPFQLPIFFPVLFLGCDLFILVLTIYQQPRESLSNVILMLAAVPIYWLGVSWKNKPKSFQNFIHKGTVFLQKVFACVPVEDESQLD 500          
BLAST of Cationic amino acid transporter vs. TrEMBL
Match: A0A0R3TXZ6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12719 PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 2.038e-147
Identity = 231/442 (52.26%), Postives = 315/442 (71.27%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGW---NYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKN 1599
            L+ T+SVGLS ++W++ G+FS +GALVYAELGV I  SGGEY YIL+ FGGL AF  +WI F++IG+ S AAN+  FA+Y+L+PL+  C IP      + + G+  + AINCY V WAAK+A+VF+ GK+ ALLLII  G++N+F G ++SF+  F GSN++ G L+LAFY GFWAF+GW   NYLNFL EEM+NP R+LP AI L L +VT +Y++ NVAYL VL+P EML A   SSAIAV FA+R M   + IMP+ V ASVFGS+NGE + +SRLTY GA E H+P  ++M+   +LTP+P+++++  + I FQ   D+F LIELAGFA++ I A+ATCSL+Y+R+K    +T FRL I +PI FL+ D+F+  L +YQQP+ESL  + IM+  +PI+  GVSWK+KP SF      +TV  QK    +P + E   +
Sbjct:   54 LRQTNSVGLSLIMWIVPGLFSYLGALVYAELGVRIQKSGGEYAYILEAFGGLPAFIVMWINFVIIGSVSCAANSLAFAEYILQPLYPNCPIPTHIISMVAICGLMLICAINCYKVSWAAKVAVVFSFGKIVALLLIICFGMYNLFKGHTESFHNAFEGSNYSPGYLALAFYQGFWAFSGWQVWNYLNFLVEEMRNPGRDLPRAIGLGLFLVTLLYMLTNVAYLAVLSPHEMLEAAAGSSAIAVVFAQRAMPWLTAIMPLFVGASVFGSINGETMGVSRLTYTGAREGHMPALLAMLHYRNLTPIPAVLVLLFLAIGFQFYSDLFALIELAGFAFSFIAALATCSLIYMRYKEPHVRTSFRLPIFLPIVFLLADLFILALTIYQQPRESLYNVIIMLAAIPIYWFGVSWKNKPVSFQRTVNKVTVLGQKTFSCVPVEDESQLD 495          
BLAST of Cationic amino acid transporter vs. Ensembl Cavefish
Match: slc7a8b (large neutral amino acids transporter small subunit 2 [Source:NCBI gene;Acc:103044995])

HSP 1 Score: 313.153 bits (801), Expect = 7.270e-100
Identity = 175/447 (39.15%), Postives = 275/447 (61.52%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGR------SDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPE 1605
            L++  SVGL+ +IW+ TGV + IGAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  +  F+ Y+L+PLF  C    S    L    +  L  +NC++V+WA ++  +FT GK+ AL LII +G+  +  G       + +F EPF   +++ G ++LAF  G +A+ GWN+LN++TEE+ +P RNLP AI +S+ +VT VY+  NVAY+  ++P E+L    +S+A+AV F E+ +G  SWIMPI VA S FG +NG + + SR+ +AGA E HLP  ++MI  +  TP+P+++   +  +    + D++ LI   GF   + + +     + +R +  +     +++++ P+ +L+   F+ V +LY QP    IG+ IM+ GVP++ +GV W++KPK F +F   +T   QKL LV+ P AED++  +
Sbjct:   59 LENASSVGLALIIWISTGVITAIGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIALLVIYPTNQAVISLTFSNYVLQPLFPTCFATESGLRLLAAVCLLLLTWVNCFSVRWATRVQDIFTAGKLLALGLIIIMGIVQMCKGNYYWLEPAHAF-EPF--QDYDVGRIALAFLQGSFAYGGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVFANVAYITAMSPTELL----ASNAVAVTFGEKLLGVMSWIMPISVALSTFGGINGSLFTSSRMFFAGAREGHLPRLLAMIHVNRFTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIRQPDLSRPIKVSLVWPVIYLLFWAFLLVFSLYSQPMVCCIGLAIMLTGVPVYYLGVYWENKPKKFTHFVGKMTGLGQKLCLVVYP-AEDERRTD 497          
BLAST of Cationic amino acid transporter vs. Ensembl Cavefish
Match: slc7a8a (large neutral amino acids transporter small subunit 2-like [Source:NCBI gene;Acc:103040361])

HSP 1 Score: 307.76 bits (787), Expect = 1.477e-97
Identity = 173/447 (38.70%), Postives = 277/447 (61.97%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGR------SDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPE 1605
            L++  SVGL+ ++W++TGV + IGAL YAELGVTIP SGG+Y Y+   FGGL  F  LWI  L+I   + A  A  F+ Y+L+PLF  C  P +    L    +  L  +NC +V+WA ++  +FT GK+ AL+LII +G+  I  G       +++F EPF   +++ G ++LAF  G +A+ GWN+LN++TEE+ +P  NLP AI +S+ +VT VY+  N+AY+  ++P+E+L    +S+A+AV F E+ +G  SWIMPI VA S FG +NG + + SRL +AGA E HLP+ ++MI     TP+P+++   +  +    + D++ LI   GF   + + +     + +R K  +     +++++ P+ +L+   F+ + +LY +P    IG+ IM+ GVP++ +GV W +KP+ FN F + +T   QK  +V+ P AED+K  +
Sbjct:   63 LENASSVGLALIVWIITGVITAIGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPENGLRLLAGICLLLLTWVNCASVRWATRVQDMFTAGKLLALILIIIMGIVQICKGEYYWLEPANAF-EPF--QDYDVGLIALAFLQGSFAYGGWNFLNYVTEELVDPYVNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELL----ASNAVAVTFGEKLLGVMSWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSLLAMIHVKRCTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIKEPDMHRPIKISLVWPVIYLLFWAFLLIFSLYSEPVVCGIGLAIMLTGVPVYFLGVYWDNKPQCFNTFVDKMTYLGQKFCVVVYP-AEDEKKED 501          
BLAST of Cationic amino acid transporter vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 296.975 bits (759), Expect = 1.250e-93
Identity = 174/448 (38.84%), Postives = 255/448 (56.92%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVG--VSWKDKPKSFNNFTENLTVWAQK----LLLVIPPDAEDDKNPEH 1608
            L ++ S GLS V+W + GVFS+ GAL YAELG TI  SG  Y YIL+ FGG LAF  LW + L+I   S A  A  F+ Y+++P+F  C  P +A   L    +  L  +NC  VKW  ++   FT  KV AL+ +I  GL  IF G + +F   F  S+ + G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP++I +S+ IVT +YI+ NVAY  +L    +L     S A+AV FA++  G F+W +P+ VA S FG +N  IL+ SRL + G+ E HLP  + MI  S  TP+P+++  G + + +    D+F LI    F+Y     ++    LY+R K  +     +L+II PI F +  IF+ V+ LY     SLIGIGI + G+P++ +        +P     F  +  V  QK    +L  +  D   D NP++
Sbjct:   62 LMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAIL----DSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMDTDEGKDLNPKY 505          
BLAST of Cationic amino acid transporter vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 295.434 bits (755), Expect = 3.708e-93
Identity = 170/440 (38.64%), Postives = 252/440 (57.27%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVG--VSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            L ++ S GLS V+W + GVFS+ GAL YAELG TI  SG  Y YIL+ FGG LAF  LW + L+I   S A  A  F+ Y+++P+F  C  P +A   L    +  L  +NC  VKW  ++   FT  KV AL+ +I  GL  IF G + +F   F  S+ + G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP++I +S+ IVT +YI+ NVAY  +L    +L     S A+AV FA++  G F+W +P+ VA S FG +N  IL+ SRL + G+ E HLP  + MI  S  TP+P+++  G + + +    D+F LI    F+Y     ++    LY+R K  +     +L+II PI F +  IF+ V+ LY     SLIGIGI + G+P++ +        +P     F  +  V  QK+   +  + + D+
Sbjct:   62 LMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAIL----DSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMDTDE 497          
BLAST of Cationic amino acid transporter vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 295.434 bits (755), Expect = 3.708e-93
Identity = 170/440 (38.64%), Postives = 252/440 (57.27%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVG--VSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            L ++ S GLS V+W + GVFS+ GAL YAELG TI  SG  Y YIL+ FGG LAF  LW + L+I   S A  A  F+ Y+++P+F  C  P +A   L    +  L  +NC  VKW  ++   FT  KV AL+ +I  GL  IF G + +F   F  S+ + G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP++I +S+ IVT +YI+ NVAY  +L    +L     S A+AV FA++  G F+W +P+ VA S FG +N  IL+ SRL + G+ E HLP  + MI  S  TP+P+++  G + + +    D+F LI    F+Y     ++    LY+R K  +     +L+II PI F +  IF+ V+ LY     SLIGIGI + G+P++ +        +P     F  +  V  QK+   +  + + D+
Sbjct:   62 LMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAIL----DSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMDTDE 497          
BLAST of Cationic amino acid transporter vs. Ensembl Sea Lamprey
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 290.426 bits (742), Expect = 6.088e-92
Identity = 165/433 (38.11%), Postives = 253/433 (58.43%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPD 1581
            L +T SVG+S V+W   GV S+ GAL YAELG  I  SGG Y YIL+ FG L AF  LW+  ++I  A+TA  A  F QY+L+P+F +C +P  A   +    +  ++ IN  +V W A+L    T  K++A+ +II  G+ ++  G ++ F + F G       L LAFY G +A++GW Y+NF+TEE+ NP RN+P+AI +S+ IVT  Y  +N+AY  V++  E+L    +S A+AV FAER +G+FS  +P+ VA S  GS+NG + +++R+ +  + E HLP  +SMI     TP+P++II+  + +      D++ L+    FA  +  AMA   L+Y+R         F++ + IP+ F +  + V  L+LY  P  S IG  I + GVP++ + V W  KP +    T+ +T   Q +L V P +
Sbjct:   76 LTNTGSVGMSLVVWAACGVLSLFGALSYAELGTCIKKSGGHYTYILEAFGPLPAFVRLWVELIIIRPAATAVIALTFGQYILQPMFPQCHVPQLAVKIVTALAISLVMFINSSSVSWTARLQTFLTFSKLAAVGIIIIPGIIHLAKGNTEHFQDSFVGKEVGLMGLPLAFYSGMYAYSGWFYMNFVTEEVDNPERNIPLAICISMGIVTVAYTFMNMAYFAVMSGAELL----ASKAVAVTFAERLLGNFSITVPVFVALSCLGSLNGGVFAIARMFFVASREGHLPHILSMIHIRKHTPLPAVIILYPLTMLMLFVGDIYSLLNFFSFARWLFIAMAVSGLVYMRFTRPHMHRPFKVPLFIPVFFSLSCLLVVALSLYSDPVNSGIGCAITLSGVPVYYLTVVWDGKPTAVKRATDRVTRVLQLILQVAPQE 504          
BLAST of Cationic amino acid transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.491 bits (589), Expect = 2.141e-70
Identity = 126/350 (36.00%), Postives = 209/350 (59.71%), Query Frame = 1
Query:  310 SFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLN 1359
            + ++W   G+ S++GAL YAELG  +P +GGEY Y+ + FG  LAF   W +  L+  A  +A A  FA+Y+L+PLF  C  P +   CL +  +  +  +NC ++KWA +   V T+ K+ AL ++   GL  +  GR+ +    FAG+  +   +  +FY G WA+ GWN LN+ TEE+K+  +N+   I++++ +VT+ Y++VN++Y+ VLTP+E++    SS+A+AV + +R +GSFSWI+P+ VA S FGS+N     M RL YA A E H    ++M+S  H TP P++    ++ + F L  D+  L    GF   ++  +    LL +R++  + +  +R++
Sbjct:   76 ALLVWAGCGLLSLLGALCYAELGAAVPTTGGEYAYVRRAFGAPLAFLFAWTSVALLRPAMNSAVALTFAEYVLRPLFHGCPAPPAIVKCLAIASLLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQGLWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPKEII----SSAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPAVAFSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRYREPDLRRPYRVS 421          
BLAST of Cationic amino acid transporter vs. Ensembl Sea Lamprey
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 148.288 bits (373), Expect = 7.717e-42
Identity = 72/196 (36.73%), Postives = 125/196 (63.78%), Query Frame = 1
Query:  997 AVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDA 1584
            A  F    +G  SWI+P+ V+ S FGS+NG + + SRL + GA E HLP  +SMI +   TP+PS++   ++ + + +S D+F +I    F   +  AMA C ++++R+K  +     ++NI++PI+F++  IF+ V+++   P E  IG+GI++ G+P++ VGV W++KP S  N   ++T+ +QK+L VIP ++
Sbjct:    1 AQDFGNYHLGVMSWIIPVFVSLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHRRLFTPVPSLLFTCLMTLLYAISDDIFSVINFFSFFNWLCIAMAICGMMWLRYKEPQRDRPIKVNILLPISFVLACIFLIVVSVVVTPVECGIGLGIILTGIPVYFVGVRWQNKPPSLLNLISSMTILSQKVLEVIPQES 196          
BLAST of Cationic amino acid transporter vs. Ensembl Sea Lamprey
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 139.428 bits (350), Expect = 9.301e-38
Identity = 81/195 (41.54%), Postives = 119/195 (61.03%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSR 867
            L ++ S GLS V+W L G+FS+ GAL YAELG TI  SG  Y YIL+ FG   AF  LW + L+I   S A  A  FA YL++P+F  CE P +A   +    +  L  +NC  VK   ++  + T  KV AL+ +I  G+  +  G++++    F GSN++ G+++LA Y   ++++GW+ LNF+TEE+KNP R
Sbjct:   72 LMYSASYGLSLVVWALGGIFSVFGALCYAELGTTITKSGASYAYILEAFGKFPAFIRLWTSLLIIEPTSQAVIAITFANYLVQPIFSTCEPPYAASRLIAAACICLLTFVNCAYVKHGIRVQDLSTYAKVIALIAVIIAGIVFLGKGKTENLESSFEGSNWDVGNMALALYSALFSYSGWDTLNFVTEEIKNPER 266          
BLAST of Cationic amino acid transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000258.1 (pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 gene:ENSPMAG00000000231.1 transcript:ENSPMAT00000000258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 2.630e-32
Identity = 71/195 (36.41%), Postives = 113/195 (57.95%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSR 867
            L+H  SVG + ++WL  G  S++GAL YAELG TI  SG  YIY+ +T G L AF  LW+ F+++  +  A       QY L+ L+  C +P  A   L +  +  ++ +N ++   + ++    +V K++AL  IIG+G+ ++  GR++ F   F  ++     L LAFY G +A++GW  LN +TEE+K P R
Sbjct:   33 LRHAGSVGWALMVWLACGFLSLLGALSYAELGTTIRQSGSHYIYLRETLGTLPAFLFLWVEFIIVRPSVMAVVFLSMGQYSLEALYSPCAVPRIAVKLLAMVSISFVVWVNTWSSTLSLRVQSCLSVSKLAALASIIGVGIAHVARGRTEYFENAFDTADSRPEGLPLAFYSGMFAYSGWASLNSVTEEVKRPER 227          
BLAST of Cationic amino acid transporter vs. Ensembl Yeast
Match: MUP3 (Low affinity methionine permease; similar to Mup1p [Source:SGD;Acc:S000001028])

HSP 1 Score: 77.0258 bits (188), Expect = 2.253e-15
Identity = 64/236 (27.12%), Postives = 112/236 (47.46%), Query Frame = 1
Query:  766 NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVG--FAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKS--HLTPMPSIIIMGVVVICFQLSL-----DVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIG 1446
            +  S++ AF   F+ F+GW+ ++ +T E+KNP + L ++  LSL+I    Y M+NVAYL VLT  E++ AG    ++     F  R  G F   +   +A S   ++   I S+SR+      E +LP +I M SK+     P+PSI + G + I + L L        YL+ + G+       +    L   R K      + R +    +  + + +++ +   +  P  + +G
Sbjct:  257 SVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSLIICFVCYTMMNVAYLKVLTYEEIVSAGPLVGSVLFTKLFGPRVGGKF---IAFSIAISAASNILVVIYSISRVNQEIFKEGYLPFSIHM-SKNWPFDAPLPSISLCGFITIAWILILPKEGESFNYLVSMDGYGNQFFLLLVAIGLFIWRFKHKNEVPEIRASTFGVLAIITLSLYMLMAPFFADPSLNRVG 488          
BLAST of Cationic amino acid transporter vs. Ensembl Yeast
Match: MUP1 (High affinity methionine permease; integral membrane protein with 13 putative membrane-spanning regions; also involved in cysteine uptake [Source:SGD;Acc:S000003287])

HSP 1 Score: 77.0258 bits (188), Expect = 2.771e-15
Identity = 95/365 (26.03%), Postives = 159/365 (43.56%), Query Frame = 1
Query:  298 SVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAF-CCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMG-----RSDSFNEPFAGSNF-NAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPIC-VAASVFGSMNGEILSMSRLTYAGANEKHLP-TAISMISKSHLTPMPSI---IIMGVVVICFQLSLDVFYLIE-LAGFAYTVIFAMATCSLLYIRHKSHETKTKFR 1353
            SVGL+ ++W +  + +I G  VY E G  IP +GGE  Y+   F     F  C++  ++     +   +      +L      + E+    Q  +G+  VF    IN  NVK    L  +  + K+  +L I   G   +  G     +S +F   F G+    A  +  A Y   W+F G++ +N+   E+KNP R L IA   S++ +  +YI VN+AY  V+ P++ LI+  S   +A  F +   G  +       V  S  G++   I S  R+      E  LP +     SK   +PM  +    I+  V I      D + L++ L  +   +I    +  LL+I  +  + K ++ 
Sbjct:   92 SVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGGEKNYLEAIFRKPKFFITCMYAAYIFFLGWAAGNSINTAIMFLTAA---DTEVTKWNQRGIGVAVVFFAFLINSLNVKIGLYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHNFRNAFEGTETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIYIFVNIAYFAVV-PKDKLIS--SKLILAADFFDIVFGGQAKRAAAALVGLSALGNVLSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIVCTVTILAPPPGDAYLLVQNLISYPMNIINFAISAGLLWIYWQRRQGKIEWN 450          
BLAST of Cationic amino acid transporter vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 262.692 bits (670), Expect = 5.710e-81
Identity = 161/452 (35.62%), Postives = 253/452 (55.97%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEI-PASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQL--SLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPK----SFNNFTENLTVWAQKLLLVIPPDAEDDKN--PEHY 1611
            L+ T SVGLS V+W   G+ ++ G+L Y E+G  IP SG EY Y+   FG L AF   W   L+I  +S A  +  FA+Y+ +P F  CEI P S +  L    +   L INC +V+WA ++   FT+GK+ A+ +++ LG+  I  G+ +   +PF  S  N  ++ LAFY G WA+ GWN LNF+TEEMKNP+R+LP A+++ + +VT  Y++ N+AY+ V+  RE ++   SS A+A+   +  +G  SWI+PI VA S FG +NG + S +RL Y  A   H+P  ++MI     TPMPSII M  + +   +  + +   L+    FA  + +    C+LLY+R K       +++ ++IP+      +++ +    ++P ES + +  ++LG+P++ +   W    K    S + F  N+  W   L L   PD  DD+   P  Y
Sbjct:   65 LQQTGSVGLSLVVWAGCGLLALFGSLCYCEMGTMIPKSGAEYSYLKDAFGPLPAFLYSWTLALIIRPSSLAIVSLTFARYVTQPFFPNCEISPLSVRKILAACCLALTLFINCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLEDPFEKSTPNPAAIGLAFYSGLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVG-REGIL---SSGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPSIIFMNTIALIMLIPDASEFGTLVNYFSFAAWLSYFAVICALLYLRWKRPNAHRPYKVWLVIPVIAACAALYLLITPFAKEPVESSMALIFIVLGIPVYFLFCKWDILGKMCGPSVDKFLWNVQKWFD-LSLEERPDLIDDEEEIPAKY 511          
BLAST of Cationic amino acid transporter vs. Ensembl Nematostella
Match: EDO41594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U0])

HSP 1 Score: 259.61 bits (662), Expect = 2.289e-80
Identity = 153/449 (34.08%), Postives = 251/449 (55.90%), Query Frame = 1
Query:  289 HTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECE--IPAS----------AQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQL--SLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            +T S GL   +W L GV +++G+L YAELG  I  SG EY Y+   FG  +AF   W + +L+  +  A  +  F QY+++P F  C    P            A +C+G+     +  +NC++VK A ++ +VFT  K+ A+ ++I  GL  +  G + SF++ F G+  + G +  AFY+G WA+ GWN LN++TEE+KNP R+LP +IL  + + T  Y++VN+AYL VLTP E++ +G    A+AV  + R  G  +W +PI VA S FG+ NG   S  RL Y  A E HLP  ++M+     TP+P+++   ++     L  S     LI    FA  V +     +LL++R++  E +  +++ +++PI  L+  +++ +   Y+ P ES   +  ++ G+P +LV V +K  PK F N  +++T   Q L     P++E++
Sbjct:   16 YTGSAGLGIAVWALCGVIAMMGSLCYAELGTMIVKSGAEYAYLNAAFGERVAFLFSWTSTILLKPSQIAIVSLAFGQYVVEPFFPTCSGFDPDRLDLKILEKLLAAVCIGV-----ITYVNCFSVKLATRVQVVFTAAKLIAIAMLIITGLVRLGQGFTGSFDDAFKGTTTSIGMVGFAFYNGLWAYDGWNNLNYVTEELKNPYRDLPRSILFGIPLGTVCYVLVNIAYLTVLTPVEVMASG----AVAVTLSNRLYGVMAWTIPIFVACSTFGAANGSAFSGGRLVYVAAREGHLPEFLAMVHTKRHTPLPAMLFNSIIAWLMLLPDSSSFETLINYFSFAAWVFYGSTVSALLWLRYRKPEMERPYKVPLLVPIMVLLASLYLIIAPFYEAPLESFYCLLFILAGIPFYLVFVYFKVAPKWFLNGVDSITYKLQVLCDCALPESEEE 455          
BLAST of Cationic amino acid transporter vs. Ensembl Nematostella
Match: EDO37074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGV3])

HSP 1 Score: 255.373 bits (651), Expect = 2.177e-78
Identity = 149/437 (34.10%), Postives = 247/437 (56.52%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQL--SLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAE 1587
            L  T S+GLS ++W   G  +++  L Y ELG  +  SG EY Y+++ FG + AF   W   ++   A TA  + IFA+Y+ KP F EC  P +    LGL  + T+  INC++V+WA ++  +FT  K+  + +++ +G+  +  G++++    F GS  +   +  AFY G WA+ GWN LN+ TEEMK+P+R++P AI++ + I+T  Y+MVN+AY+ VL    +L    +S A+AV   +  +G   WI+P+ VAAS FG++NG   +  RLTY  A +  LP+ ++MI    LTP+PS+++   + IC  L    +   L+    FA  + +  +  +LL++R+K  E    +R+ I+IPI  L+  +++ +     +P  S I   I++ G+P +    S    PK F  + E+ T  +QKL  +   D +
Sbjct:   68 LGTTQSIGLSLMVWFGCGFLALLACLCYTELGTAVQKSGAEYAYLMEAFGPIPAFLFAWTGIIINRPAITAIVSLIFAEYVAKPFFPECAPPPAVVKLLGLACIVTVTGINCWSVRWATRVQRIFTYAKLLCIAMLVIIGVVELCKGKTENLQNAFEGSETDPAKIGFAFYIGLWAYDGWNSLNYCTEEMKDPARDMPKAIIIGISIITGCYLMVNIAYITVLGGAGIL----ASEAVAVSIGDVYLGPMKWIIPVFVAASTFGTVNGVAFTSGRLTYTAARDGLLPSMLAMIQVKRLTPLPSMLLTSTIAICMLLPPGSNFMSLVGFFSFAAWLFYGGSFAALLWLRYKKPEMPRPYRVPIVIPIFMLLASMYLCIAPFVAKPIGSTIACLIILAGLPFYFFFKS-PYVPKWFRRYFESFTYGSQKLFNIALADED 499          
BLAST of Cationic amino acid transporter vs. Ensembl Nematostella
Match: EDO41148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S561])

HSP 1 Score: 254.988 bits (650), Expect = 3.228e-78
Identity = 150/445 (33.71%), Postives = 245/445 (55.06%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECE-----IPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFY---LIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            L +T SVGLS ++W L G+ ++ G+L Y EL + IP  GGEY Y+++ FG   AF   WI+   +   +T      F  Y+++P F  C      +P    +     GV T+  +NC +VKW++++ I FTVGK+ A+L+++  G+  I  G   S  + F G+  + G +  AFY+G +++ GWN LNF  EE+K P+R +P AI +++ +VT+ Y++VN+ YL VLTP E+     +S+A+AV  A R  G  +W +PI VA S FGS NG   S  RL YA A E HLP  ++M+     TP+P+I+    +  C  L  D      L+    F   + + +   S++++R +  +    +++ II+P    ++ I++ V   YQ P  S   +  ++ G+P++L  V +K  P+   +    +TV  Q +L V  P +E +
Sbjct:   64 LLYTGSVGLSLLVWALCGMIALFGSLSYVELALMIPRCGGEYAYLMQAFGPFAAFLYSWISVCFL-KPATVLILLAFGAYVIEPFFPHCSHREDLVPVIKILAASALGVITI--VNCASVKWSSRIQIAFTVGKMIAILMLVLTGIVRIAQGHVSSLKDSFQGTATSLGMVGFAFYNGLFSYDGWNQLNFFVEEIKEPNRTVPRAIWIAIPLVTASYVLVNIGYLSVLTPDEL----RTSNAVAVTLASRMYGVMAWTIPILVAFSTFGSANGNFFSGGRLAYAAAREGHLPELLAMVHTKRHTPIPAILFSSTIS-CIMLIPDSSKFETLLNFGAFIVWLFYGVTMFSIIWMRVRQKDKTRPYKVPIILPCLMTLLSIYLVVAPFYQAPLPSFYALLAVLSGIPVYLFFVRYKVLPQCIMDRYARITVRIQLVLGVALPKSEKE 500          
BLAST of Cationic amino acid transporter vs. Ensembl Nematostella
Match: EDO38377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD43])

HSP 1 Score: 248.054 bits (632), Expect = 1.242e-75
Identity = 145/413 (35.11%), Postives = 234/413 (56.66%), Query Frame = 1
Query:  289 HTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTL---LAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQL-SLDVF-YLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPK 1512
            ++ SVGLS V+W L G+ S+ G+L Y ELG+ IP+SGGEY Y+L+ FG L AF   W+  L I          +F  Y+ +P +  C      +    L    +L   + +NC +VKW++++ + FTV K+ A+++++  G+  I MG   SF + F GS    G +  AFY+  +++ GWN +N+  EE+KNP RNLP+ I +S+ +VT  Y++VNV YL VL+P E+    + S+A+AV  A R  G  +W MP  VA SVFGS+NG   ++ RLTYA A   HLP  ++MI K   TP+P+I+    + +   +  +  F  L+    F   V +      LL++R++  +    +++ I+IP   L++ +++ +   Y+ P  S      ++ G+P++ V V +K  PK
Sbjct:   66 YSGSVGLSLVVWCLGGLISLFGSLCYIELGLMIPVSGGEYEYLLEAFGPLPAFLFAWLYSLFIKNMGIVILLLVFGAYVTEPFYPGCNEREDLERLRKLIAAASLGVVVFLNCASVKWSSRIQVGFTVAKMVAIVMLVFTGVVRIAMGHVSSFADVFEGSETRVGLVGFAFYNALFSYDGWNNVNYCVEELKNPKRNLPLCIWISIPVVTLSYVLVNVGYLAVLSPVEI----QESNAVAVTLAYRLYGVMAWTMPFLVACSVFGSVNGSCFALGRLTYAAARNGHLPRIMAMIHKKKRTPLPAILFSAFICVLMMIPDVSTFSSLLNYFSFLTWVNYGATISGLLWMRYRKPDVHRPYKVFILIPCLVLLLSLYLVIAPFYEAPIASSFATLFVLAGIPVYFVFVRFKLLPK 474          
BLAST of Cationic amino acid transporter vs. Ensembl Medaka
Match: slc7a5 (solute carrier family 7 member 5 [Source:NCBI gene;Acc:101163489])

HSP 1 Score: 326.25 bits (835), Expect = 7.402e-105
Identity = 180/436 (41.28%), Postives = 274/436 (62.84%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSF--NEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDA 1584
            +K   SVGLS ++W + GVFS +GAL YAELG TI  SGG+Y YIL+ +G L AF  LWI  L+I  +S    A++FA YLLKPLF  C +P +    +    +  L  +NCY+VK A ++   F   K+ AL+LII +G   I  G +D       F GSN+  G++ LA Y G +A+ GWNYLNF+TEEM  P +NLP AI++SL IVT+VY++ N+AY   L+P++ML     S A+AV F    +G  +WI+P+ V  S FGS+NG + + SRL + GA E HLP  +SMI  + LTP+PS+I   ++ + +  S D+F +I    F   +  A+A   ++++RHK  E +   ++NI++PI+F++  +F+ +++ ++ P E  IG GI+  G+P++ +GV W++KPK   +   + T W QK++ V+P ++
Sbjct:   86 VKEAGSVGLSLIVWAVCGVFSTVGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYLLKPLFPVCPVPENGAKLVACLCILLLTFVNCYSVKAATRVQDFFAAAKLLALILIIIIGFVKIGQGDTDDLLPENSFKGSNYEFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTAVYVLTNLAYFTTLSPQQML----GSEAVAVDFGNHHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHPTLLTPLPSLIFTCLMTLLYAFSNDIFSVINFFSFFNWLCIALAIIGMMWLRHKKPELERPIKVNILLPISFVLACLFLIIVSFWKTPIECAIGFGIIATGLPVYFIGVWWQNKPKWLLHGIFSSTAWCQKVMEVVPQES 517          
BLAST of Cationic amino acid transporter vs. Ensembl Medaka
Match: ENSORLT00000006048.2 (large neutral amino acids transporter small subunit 1 [Source:NCBI gene;Acc:101158196])

HSP 1 Score: 308.916 bits (790), Expect = 4.986e-98
Identity = 173/443 (39.05%), Postives = 263/443 (59.37%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSF--NEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPE 1605
            +K T S GLS V+W   GV S +GAL YAELG TI  SGG+Y YIL+ +G L AF  LW+  L+I  +S    + +FA YLLKPL+  C +P SA   +    + +L  +NC +V+ A K+  +FT  K+ AL +II  G   IF G        + F GS     ++ LA Y G +AF GWNYLN++TEEM NP RNLP+AI++S+ IVT VY++ N+AY   ++P  M+     S A+AV F E+ +G  SW++P+ V  S FG++NG + + +RL YAGA E  LP A+ ++     TP+PS+I    + + + +S D+F +I L  F   +   MA   L+++R    + +   ++ + IP+TF++  IF+ V++ +  P E L+G  I++ G+P +L+G  WK KP       E  T++ QK+L+ +P + E  +  E
Sbjct:   95 VKETGSAGLSLVVWSACGVVSTMGALCYAELGTTIAKSGGDYTYILEVYGELAAFLKLWVEMLIIRPSSQYVVSLVFATYLLKPLYPSCPVPDSAAKLIACLCLTSLTFVNCISVRAATKVQDLFTASKLFALCIIILFGFIQIFTGDVPYLTPEKSFEGSKMGVDNIVLALYSGLFAFGGWNYLNYVTEEMVNPERNLPLAIIISMPIVTVVYVLTNLAYFTTISPEVMV----ESEAVAVTFGEQHLGRMSWLIPVFVGMSCFGAVNGSLFTSARLFYAGAREGQLPAALGLVHTDLFTPVPSLIFTCFLSMMYTISQDIFSVINLFSFFTWLCVGMAIAGLVWLRLTKPDLRRPIKVYLFIPVTFVLGCIFMIVVSFWAAPFECLVGTSIILTGIPAYLLGYKWK-KPHMVQKMLEIFTMFCQKILMSVPEEREQHEAAE 532          
BLAST of Cationic amino acid transporter vs. Ensembl Medaka
Match: slc7a10a (asc-type amino acid transporter 1 [Source:NCBI gene;Acc:101166040])

HSP 1 Score: 297.36 bits (760), Expect = 7.604e-94
Identity = 170/442 (38.46%), Postives = 257/442 (58.14%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFA---GSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKN 1599
            L+H  SVGLS ++W+  G    +G+L YAELGVTIP SGG+Y Y+ + FGGL+ F  LW   L++   + A  A  F+ Y+L+P F  C  P  A   L    V  L  +NC +V+WA ++  +FTVGK+ AL LII +GL  IF G  D+     A     + + G ++LAF    +A++GWN+LN++TEE+  P +NLP AI +S+ +VT VY M N+AY   +TP E+L    +S+A+AV F E+ +G FSW+MPI VA S FG +NG + + SRL ++GA E HLP  ++MI   + TP+P++++     I      +   LI    F   + + +    LLY+R          R+++++PI++L+    +   +LY +P    +G+ IM+ GVP++ VGV WK+KPK      E  T   QKL  V+ P  +  + 
Sbjct:   63 LEHAGSVGLSLIVWVCGGGICALGSLCYAELGVTIPKSGGDYSYVTEIFGGLVGFLLLWSAVLIMYPTTLAVIALTFSNYVLQPAFQNCVPPFIAIKLLAAICVLFLTWVNCSSVRWATRIQDIFTVGKLLALALIIVVGLVQIFRGHYDALVPSVAFEFQQDSSVGQIALAFLQASFAYSGWNFLNYVTEEVVEPRKNLPRAIYISIPLVTLVYTMTNIAYFSSMTPEELL----ASNAVAVTFGEKLLGMFSWVMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPYLLAMIHLKNCTPIPALLVCCFATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYLRKTRPNLARPIRVSLLVPISYLVFWAVLLGFSLYSEPVVCGLGMVIMLTGVPVYFVGVQWKEKPKWVYRLVERFTYVGQKLCYVVFPQNDSSET 500          
BLAST of Cationic amino acid transporter vs. Ensembl Medaka
Match: ENSORLT00000022942.2 (asc-type amino acid transporter 1 [Source:NCBI gene;Acc:101165956])

HSP 1 Score: 297.36 bits (760), Expect = 8.150e-94
Identity = 193/481 (40.12%), Postives = 293/481 (60.91%), Query Frame = 1
Query:  163 KKLKVDEKAVLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGS---NFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            KK K+ ++  L+KEIG+L   +IIIG IIGSGIF+SP GVL+H+ SVGL+ V+W+L G  + +G+L YAELGVTIP SGG+Y Y+ + FGGL+ F  LW   L++   + A  A  F+ Y+L+P+F +C  P  A   L    +  L  +NC +V+ A ++  +FTVGK+ AL LII +GL  IF G  ++     A S     + G ++LAF    +AF+GWN+LN++TEE+  P RNLP AI +S+ +VT VY + N+AY   ++P E+L    SS+A+AV F E+ +G FS IMPI VA S FG +NG + + SRL ++GA E HLP+ ++MI     TP+P++++     I      +   LI    F   + + +    LLY R K        R+N+++P+++L+    +   +LY +P    +G+ IM+ GVP++ +GV WK+KPK   +  E  T   Q+L  V+ P  + ++
Sbjct:   23 KKEKIPDRVTLKKEIGLLSACTIIIGNIIGSGIFISPKGVLEHSGSVGLALVVWVLGGCIAGLGSLCYAELGVTIPKSGGDYSYVTEIFGGLMGFLLLWSAVLIMYPTTLAVIALTFSSYILQPVFPDCVPPYVATRLLSATCLIFLTWVNCSSVRLATRIQDIFTVGKLMALGLIIVVGLVQIFNGNYEALTPQVAFSMSRTPSVGQIALAFLQASFAFSGWNFLNYVTEEVVEPRRNLPRAIYISIPLVTFVYTLTNIAYFSSMSPEELL----SSNAVAVTFGEKLLGVFSVIMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPSLLAMIHCKRCTPIPALLVCCAATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYYRWKKPNLYRPIRVNLLVPVSYLMFWALLLGFSLYSEPVVCGVGLVIMLTGVPVYFLGVHWKEKPKCIYSMIEKATFVGQRLCFVVFPQIDPNE 499          
BLAST of Cationic amino acid transporter vs. Ensembl Medaka
Match: slc7a6 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101174987])

HSP 1 Score: 293.123 bits (749), Expect = 6.000e-93
Identity = 169/426 (39.67%), Postives = 253/426 (59.39%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKD--KPKSFNNFTENLTVWAQ 1554
            L ++ S GLS VIW + G+FS++GAL YAELG TI  SG  Y YIL++FGG +AF  LW + L+I   S A  A  FA YL++PLF  CE P  A   L    +  L  IN   V+W  ++  +FT  KV+AL++II  G+  +  G +++F   F GS+ + G ++LA Y   ++++GW+ LNF+TEE+KNP RNLP+AI +S+ IVT++YI+ NVAY  VL    +L     S A+AV FA+ T+G  SW +PI VA S +G +N  I++ SRL + G+ E HLP A+SMI     TP+P++I   ++ + +    DVF LI    F+Y     ++    +Y+R K  +     +L ++ P+ F +  +F+  + LY     SLIGI I + GVP++ +GV   +  +P        +LT + Q
Sbjct:   12 LIYSASYGLSLVIWAIGGLFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYVAARLLAAACLCLLTFINSAYVRWGTRVQDIFTYAKVAALIVIIVTGIVKLCQGYTNNFESAFQGSSADPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTTIYILTNVAYYAVLDVGAIL----GSDAVAVTFADHTLGLMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHIERFTPIPALIFNCIMSLIYLTVEDVFQLINYYSFSYWFFMGLSVAGQIYLRWKQPDRARPLKLTLVYPLVFCMCSVFLVAVPLYSNTVNSLIGIAIALSGVPVYFLGVYLPESKRPPIITKLLRSLTYFTQ 433          
BLAST of Cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000081276.1 (SMESG000081276.1)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 492/493 (99.80%), Postives = 492/493 (99.80%), Query Frame = 1
Query:  148 MPFCKKKLKVDEKAVLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPEHYITNEC 1626
            MPFCKKKLKVDEKAVLRKEIGVLQGVSIIIGVIIGSGIFVSPVGVLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGAASTAANAFIFAQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSALLLIIGLGLFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPT ISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPEHYITNEC
Sbjct:    1 MPFCKKKLKVDEKAVLRKEIGVLQGVSIIIGVIIGSGIFVSPVGVLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGAASTAANAFIFAQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSALLLIIGLGLFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTVISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPEHYITNEC 493          
BLAST of Cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000017104.1 (SMESG000017104.1)

HSP 1 Score: 498.819 bits (1283), Expect = 3.128e-172
Identity = 248/438 (56.62%), Postives = 334/438 (76.26%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDK 1596
            LK+T SVGLSFV+WL+ G+FS  GALV+AELG TIP SGGEYIYI+KTFG + AF CLWITF+LIGA +TAAN+ IFAQY+L+P+F  CE+P +A +     G+ TL AINCYNV+WA K+AIVFTV KV ALL+II +G   +  G ++SF +PF+GS F+  S+ +AFY GFWA++GWNYLNFLT EMKNP +NLP+AI+LSL ++T VY++VNVAYL VL+P+E+L+ G+SS+A+AV FA+RTMG  SW+MPI V  SVFGSMN E+LS+SRLT  GA EK +P  ++M+S  HLTPMP++II+ ++ I FQ   + FYLIELAGFA+ VI AMA C LLY+R+K  +    F+L II+P+ FL+ D+F+  L +YQQP +S I + +M+L +P++++ ++W  KP+S  +    +TV  QKLL V+  D   D+
Sbjct:   63 LKYTDSVGLSFVMWLIAGIFSTTGALVWAELGTTIPRSGGEYIYIMKTFGSMPAFLCLWITFILIGAVATAANSMIFAQYILQPIFGSCEVPVTAVLITANLGIMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITVNLQKLLNVVLQDVVSDE 500          
BLAST of Cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000006721.1 (SMESG000006721.1)

HSP 1 Score: 481.1 bits (1237), Expect = 5.297e-166
Identity = 244/436 (55.96%), Postives = 330/436 (75.69%), Query Frame = 1
Query:  283 LKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 1590
            LK+T+SVG+S ++W+L G+FS +G++VYAELGVTIP SGGEYIYIL++FG L AF C+WITF+ IG  S AAN+FIFAQY+L+PLF  C+IP SA I +GL G+ ++ AINCY+VKWA +  + FT+ KV ALL+II +G + +F G   SF +PFA SN + GSL+LAFY GFWA+AGWNYLNFLT EM NP+RNLPIAI+ SL IVT +Y+  N+AYL VL+PREML     S A+AV FA++TMG FS +MPI V ASVFGSMNGE LS+SRLTY  A + HLP +++M+S  +LTPMP++I +  + + F  +  + YLIELAGF++ VI  MA   L+Y+R K       F+L +I+PI FL++D+F+ +L +Y++P +SLIG+ I+ LG+PI+++ V WK KPKS  N TE+LT++ QK  LV+P + E+
Sbjct:   44 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSFIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLILPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 479          
BLAST of Cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000044247.1 (SMESG000044247.1)

HSP 1 Score: 296.204 bits (757), Expect = 9.763e-94
Identity = 166/434 (38.25%), Postives = 263/434 (60.60%), Query Frame = 1
Query:  298 SVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIR--HKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
            S G + VIW+L GVFS+IGA  Y ELG  I  S G+Y YI + FG  LAF  LWI  ++      A  +  FA+Y+L+P+FL C  P  A+ CL    +  L  INC++VK + ++  +FT  K+ AL+++I  G+  + MG + ++  PF+ +N + G L++ FY+G +A+ GWNYLN + EEMKNP ++LP A+L+S  IVT VY++ NV+Y  +L+P E+    + ++A+AV           W++P+ V+ S FG +NG I++ SR+    A    +P +++MIS S  TP+PS+I + +V + + +  D++ L+   GF   + FA A  +LLY R   K  + +  F +++I PI +L+V  F+ V A      ES++G  IM+  VP++L+GV WK KPKSFN    + T + QKL +V+  + ++ 
Sbjct:   58 SSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEI----KLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDES 486          
BLAST of Cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000025359.1 (SMESG000025359.1)

HSP 1 Score: 290.041 bits (741), Expect = 1.688e-91
Identity = 158/435 (36.32%), Postives = 259/435 (59.54%), Query Frame = 1
Query:  289 HTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGXXXXXXXXXXXXQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSAXXXXXXXXXFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 1593
             T S   S +IWLL G++++IGA  YAELG  I  S G+Y Y+ + FG L+AF  +WI  ++    + A  +  FAQY+L+P++  C  P  A+  L    +  +  +NC++VK + ++  + T  KVSAL++II  G+  + MG + ++  PF G+  NAG +++AFY G +A+ GW+YLN + EEMK+P +++P AI +S  +VT +Y++ NV+Y  +L+  E+      S+A+AV    +  G   WI+P+ VA S FG +NG IL+ SR+    A    +P  ++MI+    TP+PS++ + +V + + L  D+F L+   GF   + F +A  SL+Y R K  + +   R+NI+ PI +L V +F+ + A    P ES++G  IM+  +P++ + V WK KPK FN   E++ +  QK+ +VI P   + 
Sbjct:   55 KTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIF----ESNALAVRIGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKRFNRMLESINISVQKMFMVILPAMPEK 485          
The following BLAST results are available for this feature:
BLAST of Cationic amino acid transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A111.810e-9839.50solute carrier family 7 member 11 [Source:HGNC Sym... [more]
SLC7A83.061e-9838.88solute carrier family 7 member 8 [Source:HGNC Symb... [more]
SLC7A69.371e-9739.51solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A69.371e-9739.51solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A51.109e-9642.11solute carrier family 7 member 5 [Source:HGNC Symb... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aat-11.709e-9639.41Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-11.709e-9639.41Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-32.887e-9139.27Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-31.726e-9039.54Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-21.571e-7036.88Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16071.110e-9938.67gene:FBgn0039844 transcript:FBtr0085785[more]
CG16071.110e-9938.67gene:FBgn0039844 transcript:FBtr0085786[more]
mnd1.329e-9940.64gene:FBgn0002778 transcript:FBtr0075626[more]
mnd1.329e-9940.64gene:FBgn0002778 transcript:FBtr0114529[more]
mnd1.329e-9940.64gene:FBgn0002778 transcript:FBtr0075627[more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a52.789e-10141.78solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a59.756e-10141.78solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a8a2.566e-9738.70solute carrier family 7 member 8a [Source:ZFIN;Acc... [more]
slc7a8b6.739e-9739.73solute carrier family 7 member 8b [Source:ZFIN;Acc... [more]
slc7a8b6.739e-9739.73solute carrier family 7 member 8b [Source:ZFIN;Acc... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a75.358e-10240.41solute carrier family 7 (amino acid transporter li... [more]
slc7a76.664e-10240.41solute carrier family 7 (amino acid transporter li... [more]
SLC7A109.549e-10239.69solute carrier family 7 (neutral amino acid transp... [more]
SLC7A116.446e-10141.13solute carrier family 7 member 11 [Source:NCBI gen... [more]
slc7a78.290e-10140.27solute carrier family 7 (amino acid transporter li... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a118.465e-10140.98solute carrier family 7 (cationic amino acid trans... [more]
Slc7a62.936e-9840.13solute carrier family 7 (cationic amino acid trans... [more]
Slc7a102.040e-9738.29solute carrier family 7 (cationic amino acid trans... [more]
Slc7a81.527e-9637.75solute carrier family 7 (cationic amino acid trans... [more]
Slc7a111.653e-9640.64solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of Cationic amino acid transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WTR6|XCT_MOUSE5.921e-10040.98Cystine/glutamate transporter OS=Mus musculus OX=1... [more]
sp|Q9UPY5|XCT_HUMAN8.694e-9839.50Cystine/glutamate transporter OS=Homo sapiens OX=9... [more]
sp|Q5RAG7|XCT_PONAB1.136e-9739.50Cystine/glutamate transporter OS=Pongo abelii OX=9... [more]
sp|Q9N1Q4|LAT2_RABIT1.424e-9738.44Large neutral amino acids transporter small subuni... [more]
sp|Q9UHI5|LAT2_HUMAN1.470e-9738.88Large neutral amino acids transporter small subuni... [more]
back to top
BLAST of Cationic amino acid transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF652.242e-16255.50Slc7a-8 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YK273.732e-16157.80Slc7a-4 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A564YEX95.832e-14952.62Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A158R9Z01.895e-14752.24Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3TXZ62.038e-14752.26Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a8b7.270e-10039.15large neutral amino acids transporter small subuni... [more]
slc7a8a1.477e-9738.70large neutral amino acids transporter small subuni... [more]
slc7a71.250e-9338.84solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a73.708e-9338.64solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a73.708e-9338.64solute carrier family 7 member 7 [Source:NCBI gene... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A116.088e-9238.11solute carrier family 7 member 11 [Source:HGNC Sym... [more]
ENSPMAT00000002665.12.141e-7036.00pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
slc7a57.717e-4236.73solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a79.301e-3841.54solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000258.12.630e-3236.41pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 g... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MUP32.253e-1527.12Low affinity methionine permease; similar to Mup1p... [more]
MUP12.771e-1526.03High affinity methionine permease; integral membra... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405515.710e-8135.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415942.289e-8034.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370742.177e-7834.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411483.228e-7833.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383771.242e-7535.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cationic amino acid transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a57.402e-10541.28solute carrier family 7 member 5 [Source:NCBI gene... [more]
ENSORLT00000006048.24.986e-9839.05large neutral amino acids transporter small subuni... [more]
slc7a10a7.604e-9438.46asc-type amino acid transporter 1 [Source:NCBI gen... [more]
ENSORLT00000022942.28.150e-9440.12asc-type amino acid transporter 1 [Source:NCBI gen... [more]
slc7a66.000e-9339.67Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Cationic amino acid transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081276.10.000e+099.80SMESG000081276.1[more]
SMESG000017104.13.128e-17256.62SMESG000017104.1[more]
SMESG000006721.15.297e-16655.96SMESG000006721.1[more]
SMESG000044247.19.763e-9438.25SMESG000044247.1[more]
SMESG000025359.11.688e-9136.32SMESG000025359.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024755 ID=SMED30024755|Name=Cationic amino acid transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1721bp
AATATAAGAATATGCCAAATTTTGATTAATTTTTATCAATTATTAAAAGG
TTTAGTCTTTGTTTAATCTTGTTTAATTAATCAGCAATAATTTAAAACAG
TTTTAATTTAAACTAGTGTTTCATCACTTTGTTATAACTAATTTTAAATG
CCATTTTGTAAAAAAAAACTTAAGGTTGATGAAAAGGCGGTTCTCAGAAA
AGAAATCGGTGTTTTACAGGGTGTAAGTATAATCATTGGTGTCATTATTG
GATCAGGAATTTTTGTATCTCCTGTTGGTGTTCTTAAACATACTCATTCT
GTGGGACTCTCATTTGTTATCTGGCTCCTAACAGGAGTATTTAGTATAAT
TGGTGCTTTAGTTTATGCCGAACTTGGTGTCACTATTCCTCTATCTGGTG
GTGAATATATATACATTCTCAAAACCTTTGGGGGACTATTGGCATTTTGT
TGTTTATGGATAACATTTCTTTTAATTGGTGCGGCTAGTACTGCAGCTAA
TGCTTTCATATTTGCTCAATATTTATTGAAACCATTATTTTTGGAGTGTG
AAATACCAGCTAGTGCACAAATTTGCCTTGGTTTGTTTGGAGTGTTCACT
TTATTAGCGATAAATTGCTACAACGTCAAATGGGCGGCAAAGTTAGCAAT
TGTCTTTACTGTTGGAAAAGTATCAGCACTTCTTTTGATTATTGGCTTAG
GGTTGTTTAATATTTTTATGGGAAGATCGGATAGTTTCAATGAACCGTTT
GCTGGCTCAAACTTTAATGCAGGTTCATTATCATTAGCTTTTTATCATGG
CTTCTGGGCCTTCGCAGGCTGGAATTATTTAAATTTCCTCACTGAAGAAA
TGAAAAATCCTTCAAGAAATTTGCCAATAGCAATCTTATTGTCATTGTTA
ATTGTAACGTCGGTTTATATAATGGTCAATGTTGCCTATTTGGGTGTACT
TACTCCTCGGGAAATGTTAATTGCAGGAGAATCTTCATCAGCAATCGCTG
TGGGATTTGCCGAAAGAACTATGGGCTCATTTTCGTGGATCATGCCTATA
TGCGTTGCAGCATCAGTATTTGGCAGCATGAATGGTGAAATATTGTCAAT
GTCCAGATTAACATATGCTGGAGCTAATGAAAAACACTTGCCAACAGCAA
TCAGTATGATTAGTAAGAGTCATTTGACTCCAATGCCGTCAATAATTATT
ATGGGTGTTGTTGTAATTTGTTTCCAGCTATCACTTGATGTTTTTTATTT
AATTGAATTAGCTGGATTTGCATATACAGTTATTTTTGCAATGGCTACAT
GTTCTTTGCTTTATATTCGCCACAAAAGTCATGAAACAAAAACCAAATTT
CGGTTAAACATAATAATTCCCATCACATTTTTGATAGTTGATATTTTTGT
TGCTGTCTTGGCACTATACCAACAGCCGAAAGAATCACTAATTGGTATAG
GAATTATGATTTTAGGAGTCCCAATATTTCTCGTAGGAGTTTCTTGGAAA
GATAAACCGAAATCGTTCAATAATTTTACAGAAAATTTGACTGTATGGGC
ACAAAAGTTATTGTTAGTTATTCCACCAGATGCTGAAGATGATAAAAACC
CTGAACATTATATTACAAATGAATGTTAATAACTCTTATATAAAACAAAA
TATGGTAAATGTTTAGTCTATTTTTAGCATGTATAAACGAAATATAATTT
TACAAAACTTTTCGAAAAAAA
back to top

protein sequence of SMED30024755-orf-1

>SMED30024755-orf-1 ID=SMED30024755-orf-1|Name=SMED30024755-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=494bp
MPFCKKKLKVDEKAVLRKEIGVLQGVSIIIGVIIGSGIFVSPVGVLKHTH
SVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAF
CCLWITFLLIGAASTAANAFIFAQYLLKPLFLECEIPASAQICLGLFGVF
TLLAINCYNVKWAAKLAIVFTVGKVSALLLIIGLGLFNIFMGRSDSFNEP
FAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSL
LIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMP
ICVAASVFGSMNGEILSMSRLTYAGANEKHLPTAISMISKSHLTPMPSII
IMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTK
FRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSW
KDKPKSFNNFTENLTVWAQKLLLVIPPDAEDDKNPEHYITNEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 493..493
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 15..469
e-value: 2.2E-89
score: 302.2
NoneNo IPR availablePANTHERPTHR11785:SF389LD25378Pcoord: 9..481
NoneNo IPR availablePANTHERPTHR11785AMINO ACID TRANSPORTERcoord: 9..481
NoneNo IPR availableTMHMMTMhelixcoord: 403..425
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 341..363
NoneNo IPR availableTMHMMTMhelixcoord: 431..450
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
NoneNo IPR availableTMHMMTMhelixcoord: 368..390
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 5..465
e-value: 3.6E-76
score: 253.8
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 20..424
e-value: 3.1E-51
score: 174.5