FBP32

Overview
NameFBP32
Smed IDSMED30024752
Length (bp)1514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FBP32 (SMED30024752) t-SNE clustered cells

Violin plots show distribution of expression levels for FBP32 (SMED30024752) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024752

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024752h1SMcG0007635 dd_Smed_v4_71482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024752h1SMcG0007635 dd_Smed_v4_71482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024752h1SMcG0007635 dd_Smed_v4_71482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FBP32 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 61.6178 bits (148), Expect = 8.991e-11
Identity = 37/122 (30.33%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  872 AVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIF-FTRLVARTIGISKPFIEDAINFCEIEVF 1234
            AVDGN   +   GSC H+   +++ WW V L  VS +N++ I +R DCC ER++   I      R   + +N  N        +D    +  F F  +  R + +  P  ++ ++ CE+EVF
Sbjct:   47 AVDGNTEADYRKGSCTHTS-REFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQI------RIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          
BLAST of FBP32 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 61.2326 bits (147), Expect = 3.086e-10
Identity = 37/122 (30.33%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  872 AVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIF-FTRLVARTIGISKPFIEDAINFCEIEVF 1234
            AVDGN   +   GSC H+   +++ WW V L  VS +N++ I +R DCC ER++   I      R   + +N  N        +D    +  F F  +  R + +  P  ++ ++ CE+EVF
Sbjct:   47 AVDGNTEADYRKGSCTHTS-REFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQI------RIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          
BLAST of FBP32 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 61.6178 bits (148), Expect = 6.078e-10
Identity = 37/127 (29.13%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  857 ATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIF-FTRLVARTIGISKPFIEDAINFCEIEVF 1234
              +  AVDGN   +   GSC H+   +++ WW V L  VS +N++ I +R DCC ER++   I      R   + +N  N        +D    +  F F  +  R + +  P  ++ ++ CE+EVF
Sbjct:   42 GNAEHAVDGNTEADYRKGSCTHTS-REFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQI------RIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          

HSP 2 Score: 55.8398 bits (133), Expect = 4.327e-8
Identity = 49/189 (25.93%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  704 IFSGMQFCQKLVFILIYIKFINL-----NHQLKYIEVLL----SRNEATNAANFFP---PYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVF 1234
            +   ++  Q   F  I  +++N+     +  L   EV +    S+N A  AA       P++    N AVDG+  +    GSC H+   + + WW V L  V  I R+ I +R DCC ER+    I        + N+++     + H P     N     F  +  R + I  P +   +  CE++VF
Sbjct:  122 LLDAIKGSQTFEFQPIQGRYLNVFLPGNDETLSLCEVEVFSGPSKNIAAGAAAIQSSTWPHDGDAGN-AVDGSTESEYQEGSCSHT-LGETNPWWRVDLGRVFSIRRVSITNRGDCCEERLNGAEIRIGNSLENNGNSNHLV-ATVEHIPA---GNTETFEFQPVQGRFLNIVLPGVNVYLTLCEVQVF 304          
BLAST of FBP32 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 72.7886 bits (177), Expect = 3.057e-13
Identity = 52/173 (30.06%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  773 NHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTR-LVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSN 1285
              + K +EV L+R  +   ++ + P YN AT   AVDGN N+NM  GSC H+       WW + LK    + ++ I +R DCC ER++        E R   + DN   V    G   D +  T     + +  R + +  P   + +  CE+EV+G    KP++++  A S 
Sbjct:  104 GQEAKAVEVNLARLGDVKQSSTYRPEYNAAT---AVDGNKNSNMMLGSCSHTN-SDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLR------GAEVRVGNSADNNNPVC---GAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYGQ-EAKPDAVVNLAKSG 262          

HSP 2 Score: 51.9878 bits (123), Expect = 1.650e-6
Identity = 38/153 (24.84%), Postives = 64/153 (41.83%), Query Frame = 2
Query:  800 LLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIF-------FTRLVARTIGISKPFIEDAINFCEIEVFG 1237
            L     A  ++ + P YN A    A+DG+  TN+    C H+ P     WW + L     I  + I +R DCC ER++   I                 +F +   P+  + +TD+           +V + I +  P  ++ +  CE+EV+G
Sbjct:  258 LAKSGRARQSSTYRPEYNAAA---AIDGDKGTNIFQHPCSHTNP-DNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVG--------------IFPFINSPV-CDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTLCEVEVYG 391          
BLAST of FBP32 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 71.633 bits (174), Expect = 4.149e-13
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  716 MQFCQKLVFILIYIKFINLNHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNN-----ITDIFFTRLVARTIGISK-------PFIEDAINFCEIEVFG 1237
            +Q C+  V+            + K  +V L+R  EA+ ++ F P YN A    A+DGN +TNM AGSC H+       WW + LK    + ++ I +R DCC ER++                       I  G   DNNN     +TD+    L     GI         P   + +  CE+EV+G
Sbjct:  152 LQLCEVEVY----------GQEAKPADVNLARLGEASQSSTFSPKYNAAA---AIDGNKDTNMMAGSCSHTN-SDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLR--------------------GAEIRVGDSPDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 304          

HSP 2 Score: 49.2914 bits (116), Expect = 8.436e-6
Identity = 44/158 (27.85%), Postives = 62/158 (39.24%), Query Frame = 2
Query:  800 LLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNN-----ITDIFFTRLVARTIGISKPFIE-------DAINFCEIEVFG 1237
            L    +   ++ F   Y   T+ KAVDGN +TNM   SC H+       WW + LK    I+ I I +R DCC ER+                        I  G   DNNN     ITD+          G+   ++        + +  CE+EV+G
Sbjct:   28 LAQSGDVKQSSTFGAQY---TAQKAVDGNKDTNMFQNSCSHTN-NDKPSWWQLDLKKNYNIDTIVIANRGDCCAERL--------------------LRAEIRVGNSPDNNNPVCATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 161          
BLAST of FBP32 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 71.633 bits (174), Expect = 4.303e-13
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  716 MQFCQKLVFILIYIKFINLNHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNN-----ITDIFFTRLVARTIGISK-------PFIEDAINFCEIEVFG 1237
            +Q C+  V+            + K  +V L+R  EA+ ++ F P YN A    A+DGN +TNM AGSC H+       WW + LK    + ++ I +R DCC ER++                       I  G   DNNN     +TD+    L     GI         P   + +  CE+EV+G
Sbjct:  151 LQLCEVEVY----------GQEAKPADVNLARLGEASQSSTFSPKYNAAA---AIDGNKDTNMMAGSCSHTN-SDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLR--------------------GAEIRVGDSPDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 60.077 bits (144), Expect = 2.972e-9
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 2
Query:  734 LVFILIYIKFINLNHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIE-------DAINFCEIEVFG 1237
            +V +L+ I    ++     + V L+R  +   ++ + P YN AT   AVDGN N+NM  GSC H+       WW + LK    + ++ I +R DCC ER++        E R   + DN   V            ITD+          G+   ++        + +  CE+EV+G
Sbjct:    4 IVVLLVGISMGWVHSCSPPLGVNLARLGDVKQSSTYRPEYNAAT---AVDGNKNSNMMLGSCSHTN-SDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLR------GAEVRVGNSADNNNPVCA---------TITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 160          
BLAST of FBP32 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 71.633 bits (174), Expect = 4.761e-13
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  716 MQFCQKLVFILIYIKFINLNHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNN-----ITDIFFTRLVARTIGISK-------PFIEDAINFCEIEVFG 1237
            +Q C+  V+            + K  +V L+R  EA+ ++ F P YN A    A+DGN +TNM AGSC H+       WW + LK    + ++ I +R DCC ER++                       I  G   DNNN     +TD+    L     GI         P   + +  CE+EV+G
Sbjct:  151 LQLCEVEVY----------GQEAKPADVNLARLGEASQSSTFSPKYNAAA---AIDGNKDTNMMAGSCSHTN-SDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLR--------------------GAEIRVGDSPDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 56.9954 bits (136), Expect = 2.763e-8
Identity = 48/181 (26.52%), Postives = 76/181 (41.99%), Query Frame = 2
Query:  734 LVFILIYIKFINLNHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNN-----ITDIFFTRLVARTIGISKPFIE-------DAINFCEIEVFG 1237
            +V +L+ I    ++     + V L+R  +   ++ + P YN AT   AVDGN N+NM  GSC H+       WW + LK    +  + I +R DCC ER++                       I  G   +NNN     ITD+          G+   ++        + +  CE+EV+G
Sbjct:    4 IVVLLVGISMGWVHSCSPPLGVNLARLGDVRQSSTYRPEYNAAT---AVDGNKNSNMMLGSCSHTN-SDNPAWWQLDLKKRYKVETVVIVNRGDCCWERLR--------------------GAVIRVGDSANNNNPVCATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 160          
BLAST of FBP32 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 71.633 bits (174), Expect = 5.825e-13
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  716 MQFCQKLVFILIYIKFINLNHQLKYIEVLLSR-NEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNN-----ITDIFFTRLVARTIGISK-------PFIEDAINFCEIEVFG 1237
            +Q C+  V+            + K  +V L+R  EA+ ++ F P YN A    A+DGN +TNM AGSC H+       WW + LK    + ++ I +R DCC ER++                       I  G   DNNN     +TD+    L     GI         P   + +  CE+EV+G
Sbjct:  173 LQLCEVEVY----------GQEAKPADVNLARLGEASQSSTFSPKYNAAA---AIDGNKDTNMMAGSCSHTN-SDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLR--------------------GAEIRVGDSPDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 325          
BLAST of FBP32 vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.678e-8
Identity = 30/81 (37.04%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  809 RNEATNAANFFPPY-NYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIF 1048
            R  AT +A     +  +A ++ A+DGN ++N + GSC H+E    + WW V LK V  I  + I +R DCC ER+    I 
Sbjct:   37 RGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHGSCSHTE--GDNSWWRVDLKQVYTITSVTITNRGDCCGERISGARIL 115          
BLAST of FBP32 vs. UniProt/SwissProt
Match: sp|Q9I928|FUCL4_ANGJA (Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.820e-7
Identity = 42/148 (28.38%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  809 RNEATNAANFFPPYN-YATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYV 1249
            R  AT +A     +   A ++ A+DGN ++N + GSC H+E    + WW V L  V  I  + I +R DCC ER+    I     +  + N  N     +  G        T      ++ R + +  P IE ++  CE+EV   + V
Sbjct:   37 RGRATQSAQLRGEHAALAHASNAIDGNRDSNYHHGSCTHTEGA--NPWWRVDLLQVYTIASVTITNRGDCCGERISGARILIG--NSLENNGINNPQCSVI-GSLATGETRTFHCPQPMIGRYVTVYLPKIE-SLQLCEVEVNALLPV 178          
BLAST of FBP32 vs. UniProt/SwissProt
Match: sp|Q7SIC1|FUCL_ANGAN (Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 7.524e-7
Identity = 32/81 (39.51%), Postives = 42/81 (51.85%), Query Frame = 2
Query:  809 RNEATNAANFFPPY--NYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTI 1045
            R +AT +A     +  N   SN A+DGN ++N   GSC HS   Q + WW V L  V  I  + I +R DCC ER+    I
Sbjct:   14 RGKATQSAQLRGEHAANSEASN-AIDGNRDSNFYHGSCTHSS-GQANPWWRVDLLQVYTITSVTITNRGDCCGERISGAEI 92          
BLAST of FBP32 vs. TrEMBL
Match: A0A3Q3C4Q4 (Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.407e-11
Identity = 56/160 (35.00%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  782 LKYIEVLLS------RNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLV-ARTIGISKPFIEDAINFCEIEVFGF 1240
            L YI  +LS      R +AT +  F   +  A +N A+DGN  ++ NAGSC  SE  Q + WW V L +  ++  + I +R DCC ER+    I     S  D    N     I H P   +  IT   FTRLV  R + +  P I   +  CE+EV+G+
Sbjct:   13 LNYISTVLSTENVALRGKATQSKQFN--HQLADANNAIDGNRESDYNAGSCACSE-KQTNPWWRVDLLDSYIVTSVTITNRRDCCPERLNGAEIHIG-NSLQDNGAGNPVVAVISHIPAGRSLTIT---FTRLVEGRYVTVVLPGINKYLTLCEVEVYGY 165          
BLAST of FBP32 vs. TrEMBL
Match: A0A3B4G613 (Si:ch211-215k15.4 OS=Pundamilia nyererei OX=303518 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.504e-11
Identity = 56/160 (35.00%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  782 LKYIEVLLS------RNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLV-ARTIGISKPFIEDAINFCEIEVFGF 1240
            L YI  +LS      R +AT +  F   +  A +N A+DGN  ++ NAGSC  SE  Q + WW V L +  ++  + I +R DCC ER+    I     S  D    N     I H P   +  IT   FTRLV  R + +  P I   +  CE+EV+G+
Sbjct:   13 LNYISTVLSTENVALRGKATQSKQF--NHQLADANNAIDGNRESDYNAGSCACSE-KQTNPWWRVDLLDSYIVTSVTITNRRDCCPERLNGAEIHIG-NSLQDDGAGNPVVAVISHIPAGRSLTIT---FTRLVEGRYVTVVLPGINKYLTLCEVEVYGY 165          
BLAST of FBP32 vs. TrEMBL
Match: A0A3Q2VQI6 (Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.541e-11
Identity = 56/160 (35.00%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  782 LKYIEVLLS------RNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLV-ARTIGISKPFIEDAINFCEIEVFGF 1240
            L YI  +LS      R +AT +  F   +  A +N A+DGN  ++ NAGSC  SE  Q + WW V L +  ++  + I +R DCC ER+    I     S  D    N     I H P   +  IT   FTRLV  R + +  P I   +  CE+EV+G+
Sbjct:   18 LNYISTVLSTENVALRGKATQSKQFN--HQLADANNAIDGNRESDYNAGSCACSE-KQTNPWWRVDLLDSYIVTSVTITNRRDCCPERLNGAEIHIG-NSLQDNGAGNPVVAVISHIPAGRSLTIT---FTRLVEGRYVTVVLPGINKYLTLCEVEVYGY 170          
BLAST of FBP32 vs. TrEMBL
Match: A0A3Q2VYN2 (Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.593e-11
Identity = 56/160 (35.00%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  782 LKYIEVLLS------RNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLV-ARTIGISKPFIEDAINFCEIEVFGF 1240
            L YI  +LS      R +AT +  F   +  A +N A+DGN  ++ NAGSC  SE  Q + WW V L +  ++  + I +R DCC ER+    I     S  D    N     I H P   +  IT   FTRLV  R + +  P I   +  CE+EV+G+
Sbjct:   10 LNYISTVLSTENVALRGKATQSKQFN--HQLADANNAIDGNRESDYNAGSCACSE-KQTNPWWRVDLLDSYIVTSVTITNRRDCCPERLNGAEIHIG-NSLQDNGAGNPVVAVISHIPAGRSLTIT---FTRLVEGRYVTVVLPGINKYLTLCEVEVYGY 162          
BLAST of FBP32 vs. TrEMBL
Match: A0A3Q2VPX7 (Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.703e-11
Identity = 52/158 (32.91%), Postives = 79/158 (50.00%), Query Frame = 2
Query:  770 LNHQLKYIEVLLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLV-ARTIGISKPFIEDAINFCEIEVFGF 1240
            + H++  ++ +  R +AT +  F   +  A +N A+DGN  ++ NAGSC  SE  Q + WW V L +  ++  + I +R DCC ER+    I     S  D    N     I H P   +  IT   FTRLV  R + +  P I   +  CE+EV+G+
Sbjct:   13 VQHKVAPLKNVALRGKATQSKQFN--HQLADANNAIDGNRESDYNAGSCACSE-KQTNPWWRVDLLDSYIVTSVTITNRRDCCPERLNGAEIHIG-NSLQDNGAGNPVVAVISHIPAGRSLTIT---FTRLVEGRYVTVVLPGINKYLTLCEVEVYGY 163          
BLAST of FBP32 vs. Ensembl Cavefish
Match: ENSAMXT00000002948.2 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30964207:30969859:-1 gene:ENSAMXG00000002882.2 transcript:ENSAMXT00000002948.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.027e-8
Identity = 46/168 (27.38%), Postives = 70/168 (41.67%), Query Frame = 2
Query:  734 LVFILIYIKFINLNHQLKYIEVLLSRNEATNAANFFPPYNYATSNK-AVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVF 1234
            L+ IL  +  +   H +  +E    RN A  A        Y    + AVDG+  TN +   C H+   Q + WW V L     I+RI I +R DCC+ER+    I      R + N++    V       I + +         V   + I  P +E  +  CE++VF
Sbjct:   58 LMLILSGVSGLLRTHAIPRLE---ERNVALGAEAVQSSTGYGGLARYAVDGSLETNYHLKKCTHT-AQQDNPWWRVDLNRTYNISRIVITNRGDCCVERISGAQIRVGQSLRNNGNSNKKVAVI----ETILSGHSQSYQVQNAVGSYVNIFLPGVEKILTLCEVQVF 217          
BLAST of FBP32 vs. Ensembl Cavefish
Match: ENSAMXT00000035987.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 57.3806 bits (137), Expect = 1.059e-8
Identity = 43/133 (32.33%), Postives = 63/133 (47.37%), Query Frame = 2
Query:  842 PPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGF 1240
            P   +  +  A+DGN ++N + GSC  +   Q + WW V L +   I  I I +R DCC ER+    I     S  +   +N +   I   P     ++T  F T L  R I +  P     +NFCEIEV+G+
Sbjct:   44 PWTGHGHAYNAIDGNTDSNYDHGSCTATT-WQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIG-NSLVNNGNNNPWAGVISTIPA--GKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGY 172          
BLAST of FBP32 vs. Ensembl Cavefish
Match: ENSAMXT00000042585.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 57.3806 bits (137), Expect = 1.223e-8
Identity = 43/133 (32.33%), Postives = 63/133 (47.37%), Query Frame = 2
Query:  842 PPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGF 1240
            P   +  +  A+DGN ++N + GSC  +   Q + WW V L +   I  I I +R DCC ER+    I     S  +   +N +   I   P     ++T  F T L  R I +  P     +NFCEIEV+G+
Sbjct:   44 PWTGHGHAYNAIDGNTDSNYDHGSCTATT-WQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIG-NSLVNNGNNNPWAGVISTIPA--GKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGY 172          
BLAST of FBP32 vs. Ensembl Cavefish
Match: ENSAMXT00000054425.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 57.3806 bits (137), Expect = 1.264e-8
Identity = 43/133 (32.33%), Postives = 63/133 (47.37%), Query Frame = 2
Query:  842 PPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGF 1240
            P   +  +  A+DGN ++N + GSC  +   Q + WW V L +   I  I I +R DCC ER+    I     S  +   +N +   I   P     ++T  F T L  R I +  P     +NFCEIEV+G+
Sbjct:   44 PWTGHGHAYNAIDGNTDSNYDHGSCTATT-WQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIG-NSLVNNGNNNPWAGVISTIPA--GKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGY 172          
BLAST of FBP32 vs. Ensembl Cavefish
Match: ENSAMXT00000017984.2 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 57.3806 bits (137), Expect = 1.346e-8
Identity = 43/133 (32.33%), Postives = 63/133 (47.37%), Query Frame = 2
Query:  842 PPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGF 1240
            P   +  +  A+DGN ++N + GSC  +   Q + WW V L +   I  I I +R DCC ER+    I     S  +   +N +   I   P     ++T  F T L  R I +  P     +NFCEIEV+G+
Sbjct:   44 PWTGHGHAYNAIDGNTDSNYDHGSCTATT-WQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIG-NSLVNNGNNNPWAGVISTIPA--GKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGY 172          
BLAST of FBP32 vs. Ensembl Nematostella
Match: EDO40750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6H5])

HSP 1 Score: 50.0618 bits (118), Expect = 1.767e-7
Identity = 41/127 (32.28%), Postives = 56/127 (44.09%), Query Frame = 2
Query:  863 SNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFV 1243
            SN AVDGN + N    SC  S   Q + WW V L+   V  R+ + +R DCC ER+    I    +S  +   DN      Y  P    N I     T L  R + I     +  +  CE+EV+ F+
Sbjct:   24 SNHAVDGNRSGNYYQKSC-SSTTAQTNPWWRVDLQKSHVNLRLFVVNRADCCGERLDNFEIRIG-DSLVNDGNDNPSCGSSYIIPQGRGNTIA--CHTLLKGRYVNIWIQGPDKVLTLCEVEVYPFI 146          
BLAST of FBP32 vs. Ensembl Nematostella
Match: EDO29994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T225])

HSP 1 Score: 50.447 bits (119), Expect = 6.760e-7
Identity = 32/129 (24.81%), Postives = 55/129 (42.64%), Query Frame = 2
Query:  848 YNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVF 1234
            +    ++ AVDGN + N    SC H+   + + WW V L     + ++ I +R+DCC ++ +L  I          N +        +  P    N+T      L  R + I  P  +  +  CE+EV+
Sbjct:  153 HQEGVASHAVDGNRDGNYGNWSCTHTN-AETNPWWRVDLGASHRVAQVFIVARSDCCGDKQELRNIVIHVGDSLANNGNTNARCGGAYTIP-QGKNLTITCSPALQGRYVSIMLPGAKQILTLCEVEVY 279          
BLAST of FBP32 vs. Ensembl Nematostella
Match: EDO25871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH1])

HSP 1 Score: 47.3654 bits (111), Expect = 1.041e-6
Identity = 39/126 (30.95%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  863 SNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGF 1240
            +  AVDG+ +      SC  ++ +Q + WW V L+   VI R+ I +R DCC ER+    I    +S  +  TDN      Y  P   + +I+    T L  R + I  P  +  +  CE+EV+ F
Sbjct:    3 AEHAVDGDRSGRFADLSCTETK-VQSNPWWRVDLQKSYVILRLFIVNRADCCGERLDNFEIRIG-DSLENNGTDNPSCGSSYIIPHGGSKSIS--CHTLLKGRYVNIWIPGSDRRLTLCEVEVYPF 124          
BLAST of FBP32 vs. Ensembl Nematostella
Match: EDO33194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX9])

HSP 1 Score: 46.595 bits (109), Expect = 1.491e-6
Identity = 39/123 (31.71%), Postives = 59/123 (47.97%), Query Frame = 2
Query:  863 SNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEV 1231
            +  AVDGN +   +  SC  ++ +Q + WW V L+   VI R+ I +R DCC ER+    I    +S  +  TDN      Y  P   + +I+    T L  R + I  P  +  +  CE+EV
Sbjct:    1 AEHAVDGNRSGRFSDLSCTETK-VQSNPWWRVDLQKSYVILRLFIVNRADCCGERLDNFEIRIG-DSLENNGTDNPSCGSSYIIPHGGSKSIS--CHTLLKGRYVNIWIPGSDRRLTLCEVEV 119          
BLAST of FBP32 vs. Ensembl Nematostella
Match: EDO42275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W6])

HSP 1 Score: 45.8246 bits (107), Expect = 3.461e-6
Identity = 40/127 (31.50%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  863 SNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFV 1243
            S  AVDG  + N    SC  S   Q + WW V L+   VI R  I +R DCC ER+    I    +S  +   DN      Y  P     +I     T L  R + I     + ++  CE+EV+ F+
Sbjct:    1 SKHAVDGIRSGNYKDKSC-ASTARQTNPWWRVDLQKSYVILRFFIVNRADCCGERLDNFEIRIG-DSLVNNGNDNPSCGSSYIIPQGRGKSIA--CHTLLKGRYVNIRIQGPDRSVTLCEVEVYPFI 123          
BLAST of FBP32 vs. Planmine SMEST
Match: SMESG000055412.1 (SMESG000055412.1)

HSP 1 Score: 354.369 bits (908), Expect = 7.408e-122
Identity = 171/172 (99.42%), Postives = 171/172 (99.42%), Query Frame = 2
Query:  932 MQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFTS 1447
            MQYHKWWLVVLKNVSVINRIRIFSRTDCCLER KLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFTS
Sbjct:    1 MQYHKWWLVVLKNVSVINRIRIFSRTDCCLERTKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFTS 172          
BLAST of FBP32 vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 182.185 bits (461), Expect = 6.328e-54
Identity = 96/220 (43.64%), Postives = 135/220 (61.36%), Query Frame = 2
Query:  794 EVLLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYE--SRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFTS 1447
            + LLS    T A N   P+   TS+KAVDGNYN NM+ GSCYHSE   Y KWWLV+L ++SV+ ++ I+SRTDCC +R  LL+ + SY+  +    N ++F NV  Y GPP     IT + FTRL ART+ ISKP +EDAIN CE+EV+G+ + K  SM +  +  L+   +   F +    SN +C ++C    KC+SF++     C ++ H  G F+S
Sbjct:   23 DSLLSIGRPTFANNAMFPW---TSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRLYARTLAISKPSLEDAINLCELEVYGYPFTKTMSMTFKYFGALSIYDSLGNFGTFPVQSNLDCAMICLLEAKCLSFSVQFGVKCFIYFHTGGDFSS 239          
BLAST of FBP32 vs. Planmine SMEST
Match: SMESG000046835.1 (SMESG000046835.1)

HSP 1 Score: 186.808 bits (473), Expect = 8.397e-54
Identity = 92/217 (42.40%), Postives = 134/217 (61.75%), Query Frame = 2
Query:  800 LLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASY--ESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFT 1444
            LLSR+  T AAN    Y   TS+KAVDGNY+ NM+ G CYHSE +   KWWLV+L ++SV+ R+ I+SRT+CC +R  LL+ + SY   +    N+++F N+  Y GPP     IT + FTRL  RT+ ISKPF E A+N CE+EV+G+ ++K  SMI+  +   +   +   F +    SN +C I+C    KC+SF++    +C ++ H  G F+
Sbjct:  191 LLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGYCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYYVGPPPPGEFITTLNFTRLYMRTLAISKPFGEQALNICELEVYGYTFIKKMSMIFKYFGRQSLYDSLGNFGTFPVQSNIDCAIICLQEAKCLSFSVQFGVSCFIYAHIGGEFS 407          
BLAST of FBP32 vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 182.57 bits (462), Expect = 1.387e-53
Identity = 96/220 (43.64%), Postives = 135/220 (61.36%), Query Frame = 2
Query:  794 EVLLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYE--SRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFTS 1447
            + LLS    T A N   P+   TS+KAVDGNYN NM+ GSCYHSE   Y KWWLV+L ++SV+ ++ I+SRTDCC +R  LL+ + SY+  +    N ++F NV  Y GPP     IT + FTRL ART+ ISKP +EDAIN CE+EV+G+ + K  SM +  +  L+   +   F +    SN +C ++C    KC+SF++     C ++ H  G F+S
Sbjct:   62 DSLLSIGRPTFANNAMFPW---TSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRLYARTLAISKPSLEDAINLCELEVYGYPFTKTMSMTFKYFGALSIYDSLGNFGTFPVQSNLDCAMICLLEAKCLSFSVQFGVKCFIYFHTGGDFSS 278          
BLAST of FBP32 vs. Planmine SMEST
Match: SMESG000055463.1 (SMESG000055463.1)

HSP 1 Score: 169.088 bits (427), Expect = 7.187e-49
Identity = 90/215 (41.86%), Postives = 127/215 (59.07%), Query Frame = 2
Query:  794 EVLLSRNEATNAANFFPPYNYATSNKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDCCLERMKLLTIFASYESRFDY-NTDNFYNVFIYHGPPIDNNNITDIFFTRLVARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFFLSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASG 1435
            E+LLSRN  T AAN F  Y+  + +KAVDG Y+ NM    CYHS  +   KWWLV+L  VSVI RI I++RTD   ER K LT++AS+    ++ N   FY    Y GPP  +    ++ + RL+ART+ +SKPF E+AIN CE+EV+G+  +   +M Y++        +   F S    +N +CG +C    +C+SFT  N   C L+D+A G
Sbjct:   35 EILLSRNRQTIAANSF--YSQYSPDKAVDGEYDGNMFHNKCYHSREINSVKWWLVILDKVSVIKRILIYTRTDGNAERTKTLTLYASFYKELNFSNEPKFYEFDFYKGPPKSSEIKVELSYLRLIARTVVLSKPFYEEAINICELEVYGYEVLPSLTMTYSSIGFGEKYASTPPFKSEMTKTNIKCGHICSVTLQCLSFTWGNNFQCQLYDNAGG 247          
The following BLAST results are available for this feature:
BLAST of FBP32 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-359m17.28.991e-1130.33si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.23.086e-1030.33si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.26.078e-1029.13si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
back to top
BLAST of FBP32 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectin3.057e-1330.06x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin4.149e-1328.88x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin4.303e-1328.88x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin4.761e-1328.88x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin5.825e-1328.88x-epilectin [Source:NCBI gene;Acc:100144955][more]
back to top
BLAST of FBP32 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9I929|FUCL3_ANGJA1.678e-837.04Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I928|FUCL4_ANGJA5.820e-728.38Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q7SIC1|FUCL_ANGAN7.524e-739.51Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1[more]
back to top
BLAST of FBP32 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3C4Q41.407e-1135.00Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 ... [more]
A0A3B4G6131.504e-1135.00Si:ch211-215k15.4 OS=Pundamilia nyererei OX=303518... [more]
A0A3Q2VQI61.541e-1135.00Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 ... [more]
A0A3Q2VYN21.593e-1135.00Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 ... [more]
A0A3Q2VPX71.703e-1132.91Si:ch211-215k15.4 OS=Haplochromis burtoni OX=8153 ... [more]
back to top
BLAST of FBP32 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002948.21.027e-827.38pep primary_assembly:Astyanax_mexicanus-2.0:2:3096... [more]
ENSAMXT00000035987.11.059e-832.33fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000042585.11.223e-832.33fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000054425.11.264e-832.33fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000017984.21.346e-832.33fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
back to top
BLAST of FBP32 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407501.767e-732.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299946.760e-724.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258711.041e-630.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331941.491e-631.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422753.461e-631.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FBP32 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FBP32 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055412.17.408e-12299.42SMESG000055412.1[more]
SMESG000024705.16.328e-5443.64SMESG000024705.1[more]
SMESG000046835.18.397e-5442.40SMESG000046835.1[more]
SMESG000024705.11.387e-5343.64SMESG000024705.1[more]
SMESG000055463.17.187e-4941.86SMESG000055463.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024752 ID=SMED30024752|Name=FBP32|organism=Schmidtea mediterranea sexual|type=transcript|length=1514bp
TTTAAATAATGGTTAACTAATTTAATTTACAACATTTTTTGGGGGGGAGG
TTTGGGATATTAAGTCACTAAATCAATAAATATTACATCAATAACATACA
AAAACAAAATAACACAACCAATTAAAAAATAAAATTAATATTATCAGATT
TATCATCAAATAAGTTCAAAAATTATCAATTAATATTACTGTAATAAAAT
ATATCACGAAATTGATATAACACATAAAATTAATTAAATCAAATATCTAT
CGTTTTTCACATCATAACATTTTCATAAATTTTCATAAATCATCGGATTG
TCATTGCTATCATTGCCAGTTATCCATTGTTTGATGTGCATGTATATTTA
TTATATCTTTTGCATCCAACCACATAATATTTTAATTTTAAGACTTTTAT
GACTCCCCATCAACCAACAAATGGATAAAGAAAATTTCTTTCAAAAATTA
TGATTCTTTGCCTTTTCAATGATTTGCCTATCCAATATAGTCTGTGTGTT
TATGAGTTCGCCTCTCTCCACTATTATATCGCAAAAATTCAATGTTATAT
TAATTGCTCATACTTCCCTAAATTTTTCCTTACATTAATTTCATTGGCTA
AATTGTTGATTTTCATAATATTTAAATGTTTAAAAATATTCTAATTTACA
ACTAACGATTAAAACAAATTTAATCATGCATAATTTATGTATTTTATTAT
TGTATATTCAGTGGAATGCAATTTTGTCAGAAACTGGTATTTATTTTGAT
TTATATAAAATTTATAAACCTAAATCATCAATTGAAATATATAGAGGTAT
TACTATCCAGAAATGAAGCTACAAATGCTGCAAATTTTTTTCCTCCATAT
AATTATGCCACTTCTAATAAAGCGGTGGACGGCAACTATAATACTAATAT
GAATGCGGGATCGTGTTATCACAGTGAACCTATGCAATATCACAAGTGGT
GGCTAGTTGTTTTGAAAAATGTTTCCGTTATCAACCGAATAAGAATCTTC
AGTAGGACAGATTGCTGTCTTGAAAGAATGAAATTGTTAACAATTTTCGC
CAGTTATGAAAGTCGATTCGATTACAACACAGATAATTTTTACAATGTCT
TTATCTACCATGGACCCCCAATAGATAATAATAATATAACGGACATATTC
TTTACCCGATTAGTAGCAAGAACCATTGGAATTTCGAAGCCGTTTATAGA
GGACGCGATAAACTTTTGCGAAATAGAAGTTTTTGGATTTGTGTATGTCA
AGCCAAATTCCATGATTTATACGGCCTATAGTAATCTGAATACCTTGGTA
AATTGGAAGTTTTTCCTATCAGTTTCCGCCTCATCAAATGCTGAGTGTGG
TATATTGTGTTACACTAATACTAAGTGTATTTCCTTTACTCTGGTGAACC
AAGGTACATGTCTTTTACATGATCATGCCAGCGGATTCTTCACATCATGA
TTTAATATATCTTCATTTGGAAGGTTTCTTTGAAAGTTCGACAATAATAA
ATTGTATTAATGGC
back to top

protein sequence of SMED30024752-orf-1

>SMED30024752-orf-1 ID=SMED30024752-orf-1|Name=SMED30024752-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MQFCQKLVFILIYIKFINLNHQLKYIEVLLSRNEATNAANFFPPYNYATS
NKAVDGNYNTNMNAGSCYHSEPMQYHKWWLVVLKNVSVINRIRIFSRTDC
CLERMKLLTIFASYESRFDYNTDNFYNVFIYHGPPIDNNNITDIFFTRLV
ARTIGISKPFIEDAINFCEIEVFGFVYVKPNSMIYTAYSNLNTLVNWKFF
LSVSASSNAECGILCYTNTKCISFTLVNQGTCLLHDHASGFFTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR008979Galactose-bd-like_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 1..115
e-value: 1.5E-14
score: 56.0
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 4..117