SIN3-HDAC complex-associated factor

Overview
NameSIN3-HDAC complex-associated factor
Smed IDSMED30024748
Length (bp)1860
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SIN3-HDAC complex-associated factor (SMED30024748) t-SNE clustered cells

Violin plots show distribution of expression levels for SIN3-HDAC complex-associated factor (SMED30024748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SIN3-HDAC complex-associated factor (SMED30024748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SIN3-HDAC complex-associated factor (SMED30024748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024748SMESG000033706.1 dd_Smed_v4_8876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024748SMESG000033706.1 dd_Smed_v4_8876_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Human
Match: SINHCAF (SIN3-HDAC complex associated factor [Source:HGNC Symbol;Acc:HGNC:30702])

HSP 1 Score: 64.6994 bits (156), Expect = 8.176e-12
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Human
Match: SINHCAF (SIN3-HDAC complex associated factor [Source:HGNC Symbol;Acc:HGNC:30702])

HSP 1 Score: 64.6994 bits (156), Expect = 8.176e-12
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Human
Match: SINHCAF (SIN3-HDAC complex associated factor [Source:HGNC Symbol;Acc:HGNC:30702])

HSP 1 Score: 64.3142 bits (155), Expect = 8.735e-12
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Human
Match: SINHCAF (SIN3-HDAC complex associated factor [Source:HGNC Symbol;Acc:HGNC:30702])

HSP 1 Score: 64.3142 bits (155), Expect = 8.735e-12
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Human
Match: SINHCAF (SIN3-HDAC complex associated factor [Source:HGNC Symbol;Acc:HGNC:30702])

HSP 1 Score: 64.3142 bits (155), Expect = 5.132e-11
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Fly
Match: CG44774 (gene:FBgn0266000 transcript:FBtr0343137)

HSP 1 Score: 60.077 bits (144), Expect = 3.940e-9
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF+ S ++ +   +CF    E RNG+ICNACVL VKR+ +    S   +  V+D + GPG K    + K ++R  A  K
Sbjct:   10 YRSADGCCICRAKSSSSRFTASRKYEKESMQCFN-LNEPRNGEICNACVLLVKRYKRLPIGSKRHWGHVVDARAGPGTK---SMAKQKKRDNADAK 101          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Fly
Match: CG44774 (gene:FBgn0266000 transcript:FBtr0343138)

HSP 1 Score: 60.077 bits (144), Expect = 3.940e-9
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF+ S ++ +   +CF    E RNG+ICNACVL VKR+ +    S   +  V+D + GPG K    + K ++R  A  K
Sbjct:   10 YRSADGCCICRAKSSSSRFTASRKYEKESMQCFN-LNEPRNGEICNACVLLVKRYKRLPIGSKRHWGHVVDARAGPGTK---SMAKQKKRDNADAK 101          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Fly
Match: CG44774 (gene:FBgn0266000 transcript:FBtr0343139)

HSP 1 Score: 60.077 bits (144), Expect = 3.940e-9
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF+ S ++ +   +CF    E RNG+ICNACVL VKR+ +    S   +  V+D + GPG K    + K ++R  A  K
Sbjct:   10 YRSADGCCICRAKSSSSRFTASRKYEKESMQCFN-LNEPRNGEICNACVLLVKRYKRLPIGSKRHWGHVVDARAGPGTK---SMAKQKKRDNADAK 101          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Fly
Match: CG44774 (gene:FBgn0266000 transcript:FBtr0343136)

HSP 1 Score: 60.077 bits (144), Expect = 4.110e-9
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF+ S ++ +   +CF    E RNG+ICNACVL VKR+ +    S   +  V+D + GPG K    + K ++R  A  K
Sbjct:   10 YRSADGCCICRAKSSSSRFTASRKYEKESMQCFN-LNEPRNGEICNACVLLVKRYKRLPIGSKRHWGHVVDARAGPGTK---SMAKQKKRDNADAK 101          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Fly
Match: CG44774 (gene:FBgn0266000 transcript:FBtr0343141)

HSP 1 Score: 60.077 bits (144), Expect = 4.110e-9
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF+ S ++ +   +CF    E RNG+ICNACVL VKR+ +    S   +  V+D + GPG K    + K ++R  A  K
Sbjct:   10 YRSADGCCICRAKSSSSRFTASRKYEKESMQCFN-LNEPRNGEICNACVLLVKRYKRLPIGSKRHWGHVVDARAGPGTK---SMAKQKKRDNADAK 101          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Zebrafish
Match: sinhcafl (SIN3-HDAC complex associated factor, like [Source:ZFIN;Acc:ZDB-GENE-031114-2])

HSP 1 Score: 62.003 bits (149), Expect = 1.952e-10
Identity = 44/79 (55.70%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLK 301
            +RS  GCCIC TKSSSSRF++S R+ + F  CFG   E R GDICNACVL VKRW K    S   +  V+D + GPG K
Sbjct:   10 YRSNDGCCICKTKSSSSRFTDSSRYEENFRLCFG-LSEDRVGDICNACVLLVKRWKKLPHGSKKNWNHVVDARAGPGFK 87          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Zebrafish
Match: sinhcaf (SIN3-HDAC complex associated factor [Source:ZFIN;Acc:ZDB-GENE-041210-166])

HSP 1 Score: 59.3066 bits (142), Expect = 2.462e-9
Identity = 41/78 (52.56%), Postives = 51/78 (65.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGL 298
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+G+ICNACVL VKRW K    S   +  V+D + GP L
Sbjct:   10 YRSLDGCCICRAKSSSSRFTDSKRYERDFQSCFG-LSETRSGEICNACVLLVKRWKKLPVGSKKNWNHVVDARGGPSL 86          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Zebrafish
Match: sinhcaf (SIN3-HDAC complex associated factor [Source:ZFIN;Acc:ZDB-GENE-041210-166])

HSP 1 Score: 59.3066 bits (142), Expect = 2.462e-9
Identity = 41/78 (52.56%), Postives = 51/78 (65.38%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGL 298
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+G+ICNACVL VKRW K    S   +  V+D + GP L
Sbjct:   10 YRSLDGCCICRAKSSSSRFTDSKRYERDFQSCFG-LSETRSGEICNACVLLVKRWKKLPVGSKKNWNHVVDARGGPSL 86          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Xenopus
Match: ebag9 (estrogen receptor binding site associated, antigen, 9 [Source:Xenbase;Acc:XB-GENE-996539])

HSP 1 Score: 63.929 bits (154), Expect = 5.248e-11
Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHI 307
            +RS+ GCCIC  KSSSSRF++S R+   F  CFG   E R GDICNACVL VKRW K  + S   +  V+D + GP LK +
Sbjct:   10 YRSSRGCCICKAKSSSSRFTDSRRYEGDFQSCFGIH-ESRTGDICNACVLLVKRWKKLPNGSKKNWNHVVDARGGPNLKAM 89          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Mouse
Match: Sinhcaf (SIN3-HDAC complex associated factor [Source:MGI Symbol;Acc:MGI:1929091])

HSP 1 Score: 65.4698 bits (158), Expect = 4.997e-12
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Mouse
Match: Sinhcaf (SIN3-HDAC complex associated factor [Source:MGI Symbol;Acc:MGI:1929091])

HSP 1 Score: 63.929 bits (154), Expect = 1.224e-11
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Mouse
Match: Sinhcaf (SIN3-HDAC complex associated factor [Source:MGI Symbol;Acc:MGI:1929091])

HSP 1 Score: 62.003 bits (149), Expect = 1.688e-11
Identity = 43/79 (54.43%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLK 301
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLK 87          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Mouse
Match: Sinhcaf (SIN3-HDAC complex associated factor [Source:MGI Symbol;Acc:MGI:1929091])

HSP 1 Score: 64.6994 bits (156), Expect = 3.147e-11
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMK 104          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Mouse
Match: Sinhcaf (SIN3-HDAC complex associated factor [Source:MGI Symbol;Acc:MGI:1929091])

HSP 1 Score: 64.6994 bits (156), Expect = 3.147e-11
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMK 104          
BLAST of SIN3-HDAC complex-associated factor vs. UniProt/SwissProt
Match: sp|Q5ZJV7|SHCAF_CHICK (SIN3-HDAC complex-associated factor OS=Gallus gallus OX=9031 GN=SINHCAF PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.286e-11
Identity = 47/96 (48.96%), Postives = 60/96 (62.50%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  KM+    +R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQNCFGLH-EARSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKMKTLSGSRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. UniProt/SwissProt
Match: sp|Q8C8M1|SHCAF_MOUSE (SIN3-HDAC complex-associated factor OS=Mus musculus OX=10090 GN=Sinhcaf PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.201e-10
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMK 104          
BLAST of SIN3-HDAC complex-associated factor vs. UniProt/SwissProt
Match: sp|Q5RCB7|SHCAF_PONAB (SIN3-HDAC complex-associated factor OS=Pongo abelii OX=9601 GN=SINHCAF PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.307e-10
Identity = 53/123 (43.09%), Postives = 68/123 (55.28%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLKLIGQQCGHGMETRSKNQNTFSVNSNHS 433
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K   Q      E R  N +  S  S+ S
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK-SNQISKLQKEFRRHNSDAHSTTSSAS 130          
BLAST of SIN3-HDAC complex-associated factor vs. UniProt/SwissProt
Match: sp|Q9NP50|SHCAF_HUMAN (SIN3-HDAC complex-associated factor OS=Homo sapiens OX=9606 GN=SINHCAF PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.464e-10
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLK 352
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+GDICNACVL VKRW K    S   +  V+D + GP LK   +  K++     R+K
Sbjct:   10 YRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLH-ETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIK 104          
BLAST of SIN3-HDAC complex-associated factor vs. TrEMBL
Match: A0A4Z2D7A6 (SIN3-HDAC complex-associated factor OS=Schistosoma japonicum OX=6182 GN=EWB00_003768 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.249e-17
Identity = 55/95 (57.89%), Postives = 70/95 (73.68%), Query Frame = 2
Query:   56 RSQFRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQ 340
            R+ FRS  GCCIC TKSSSSRF+ S R++++F  CFGPRG  R+GD+CNACVL VKRWL+   Q    + +VLD KKGPG KH+ +I K  +RR+
Sbjct:   22 RAHFRSQLGCCICGTKSSSSRFTASQRYAEHFGACFGPRGATRSGDLCNACVLCVKRWLQRGKQP-NFFVQVLDSKKGPGPKHMKEITKRARRRE 115          
BLAST of SIN3-HDAC complex-associated factor vs. TrEMBL
Match: A0A183RMV2 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 7.728e-16
Identity = 53/95 (55.79%), Postives = 68/95 (71.58%), Query Frame = 2
Query:   56 RSQFRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQ 340
            R+ FRS  GCCIC TKSSSSRF    R++++F  CFGP+G  R+GD+CNACVL VKRWL+   Q    + +VLD KKGPG KH+ +I K  +RR+
Sbjct:   21 RAHFRSQLGCCICGTKSSSSRFXXXXRYAEHFGACFGPQGITRSGDLCNACVLCVKRWLQRGRQP-NFFVQVLDSKKGPGPKHMKEITKRARRRE 114          
BLAST of SIN3-HDAC complex-associated factor vs. TrEMBL
Match: A0A183P8T7 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10773 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.112e-15
Identity = 54/95 (56.84%), Postives = 71/95 (74.74%), Query Frame = 2
Query:   56 RSQFRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQ 340
            R+ FRS  GCCIC TKSSSSRF++S R++++F  CFGP+G  R+GD+CNACVL VKRWL+   Q    + +VLD KKGPG KH+ +I K  +RR+
Sbjct:   18 RAHFRSQLGCCICGTKSSSSRFTSSQRYAEHFGACFGPQGTTRSGDLCNACVLCVKRWLQRGRQP-NFFVQVLDSKKGPGPKHMKEITKRARRRE 111          
BLAST of SIN3-HDAC complex-associated factor vs. TrEMBL
Match: A0A430PZN9 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0011446 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.186e-15
Identity = 54/95 (56.84%), Postives = 71/95 (74.74%), Query Frame = 2
Query:   56 RSQFRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQ 340
            R+ FRS  GCCIC TKSSSSRF++S R++++F  CFGP+G  R+GD+CNACVL VKRWL+   Q    + +VLD KKGPG KH+ +I K  +RR+
Sbjct:   18 RAHFRSQLGCCICGTKSSSSRFTSSQRYAEHFGACFGPQGTTRSGDLCNACVLCVKRWLQRGRQP-NFFVQVLDSKKGPGPKHMKEITKRARRRE 111          
BLAST of SIN3-HDAC complex-associated factor vs. TrEMBL
Match: A0A430QPK5 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0006720 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.257e-15
Identity = 54/95 (56.84%), Postives = 71/95 (74.74%), Query Frame = 2
Query:   56 RSQFRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQ 340
            R+ FRS  GCCIC TKSSSSRF++S R++++F  CFGP+G  R+GD+CNACVL VKRWL+   Q    + +VLD KKGPG KH+ +I K  +RR+
Sbjct:   18 RAHFRSQLGCCICGTKSSSSRFTSSQRYAEHFGACFGPQGTTRSGDLCNACVLCVKRWLQRGRQP-NFFVQVLDSKKGPGPKHMKEITKRARRRE 111          

HSP 2 Score: 65.0846 bits (157), Expect = 3.361e-7
Identity = 33/55 (60.00%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  722 YKRRVHLPPVKLPNADEVDLLLREIMAINSEVVNF---EIPLAMQNHLRLRNRTI 877
            Y RRV LPPV++ +  EVD LLREIM  NS+ VNF   E+ +A+Q  LRLRNRTI
Sbjct:  508 YNRRVVLPPVRMTHNPEVDSLLREIMERNSQAVNFDSREMHMAVQQELRLRNRTI 562          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Cavefish
Match: sinhcaf (SIN3-HDAC complex associated factor [Source:NCBI gene;Acc:103028480])

HSP 1 Score: 63.929 bits (154), Expect = 6.934e-11
Identity = 44/88 (50.00%), Postives = 57/88 (64.77%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQ 328
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG  GE R+G+ICNACVL VKRW K    S   +  V+D + GP LK   +  K++
Sbjct:   10 YRSLDGCCICRAKSSSSRFTDSKRYERDFQSCFG-LGETRSGEICNACVLLVKRWKKLPVGSKKNWNHVVDARGGPSLKMTVKSKKVK 96          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Sea Lamprey
Match: sinhcafl (SIN3-HDAC complex associated factor, like [Source:ZFIN;Acc:ZDB-GENE-031114-2])

HSP 1 Score: 67.781 bits (164), Expect = 4.115e-13
Identity = 47/88 (53.41%), Postives = 56/88 (63.64%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQ 328
            +RST GCCIC  KSSSSRF++S R+   F  CFG   E R GDICNACVL VKRW K    S   +  V+D + GPGLK   +  KM+
Sbjct:   10 YRSTDGCCICKAKSSSSRFTDSRRYQGDFKSCFG-LTEARTGDICNACVLLVKRWKKLPAGSTRNWNHVVDARAGPGLKVAMKPKKMK 96          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Nematostella
Match: EDO41640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3N6])

HSP 1 Score: 50.8322 bits (120), Expect = 2.016e-7
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKG-----PGLKHITQIVKMQQRRQA 343
            FRS  GCCIC  KSSSSRF++S ++  +F  CF    E R G+ICNACVL VKRW K    +   ++ ++ ++       P  +    +VK  +R Q 
Sbjct:   10 FRSRLGCCICKAKSSSSRFTSSAKYEHHFEGCFA-LTEKRQGEICNACVLLVKRWSKLPPGTEKNWKHLMMRRSACHPPWPAFRQAPPLVKYPRRCQT 106          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Nematostella
Match: EDO35710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKQ3])

HSP 1 Score: 49.2914 bits (116), Expect = 8.713e-7
Identity = 44/99 (44.44%), Postives = 54/99 (54.55%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRW--LKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLKL 355
            FRS  GCCIC  KSSSSRF++S ++  +F  CF    E R G+ICNACVL VKRW  L    +   K+ K+    KG   K    I   + R   R KL
Sbjct:   10 FRSRLGCCICKAKSSSSRFTSSAKYEHHFEGCFA-LTEKRQGEICNACVLLVKRWSKLPPGTEKNWKHVKLSTITKGSLEKEEKSIRDFKNRNDFRKKL 107          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Medaka
Match: sinhcafl (SIN3-HDAC complex-associated factor [Source:NCBI gene;Acc:110017569])

HSP 1 Score: 64.3142 bits (155), Expect = 3.069e-11
Identity = 54/135 (40.00%), Postives = 73/135 (54.07%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLKLIGQQCGHGMETRSKNQNTFSVNSNHSSSCLNANKDRLD 469
            +RS  GCCIC TKSSSSRF++S R+ + F  CFG   E R GDICNACVL VKRW K    S   +  V+D + GPG K +T+  K++     +   + +      +    +  T SV+   S S  N + D  D
Sbjct:   12 YRSNDGCCICKTKSSSSRFTDSSRYEETFRMCFG-LSEDRVGDICNACVLLVKRWRKLPHGSKKNWNHVVDARAGPGFK-VTKPKKIKNSDGKKKSKLKKLHKLKRQNSDAHSTTSSVSPAQSPSYSNQSDDGSD 144          
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Medaka
Match: sinhcaf (SIN3-HDAC complex-associated factor [Source:NCBI gene;Acc:101172976])

HSP 1 Score: 58.9214 bits (141), Expect = 3.243e-9
Identity = 41/79 (51.90%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   65 FRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLK 301
            +RS  GCCIC  KSSSSRF++S R+ + F  CFG   E R+G+ICNACVL VKRW K    +   +  V+D + GP LK
Sbjct:   10 YRSLDGCCICRAKSSSSRFTDSKRYEKDFRSCFG-LSETRSGEICNACVLLVKRWKKLPVGTKKNWNHVVDARGGPSLK 87          
BLAST of SIN3-HDAC complex-associated factor vs. Planmine SMEST
Match: SMESG000033706.1 (SMESG000033706.1)

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 314/315 (99.68%), Postives = 314/315 (99.68%), Query Frame = 2
Query:   50 MSRSQFRSTTGCCICATKXXXXXXXXXXXXXXXXXKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLKLIGQQCGHGMETRSKNQNTFSVNSNHSSSCLNANKDRLDKDCYVFYSEYSPIELSDGCNKXXXXXXXXXXXXXXXXXXXXXXXRPCCSRDFRDKNLGDLSQNSLEMGVFRVPEPKRTKTPTTNYKRRVHLPPVKLPNADEVDLLLREIMAINSEVVNFEIPLAMQNHLRLRNRTIMPVRLNSGNQGSCNTSNDQAXXXXXXXXXXXXNLDSLHN 994
            MSRSQFRSTTGCCICATKSSSSRFSNSYRFSQYFSKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLKLIGQQCGHGMETRSKNQNTFS NSNHSSSCLNANKDRLDKDCYVFYSEYSPIELSDGCNKSGGSSLSSRSFLSLSSLDQSISSRPCCSRDFRDKNLGDLSQNSLEMGVFRVPEPKRTKTPTTNYKRRVHLPPVKLPNADEVDLLLREIMAINSEVVNFEIPLAMQNHLRLRNRTIMPVRLNSGNQGSCNTSNDQASVSSDSFGSSVGNLDSLHN
Sbjct:    1 MSRSQFRSTTGCCICATKSSSSRFSNSYRFSQYFSKCFGPRGEGRNGDICNACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARLKLIGQQCGHGMETRSKNQNTFSANSNHSSSCLNANKDRLDKDCYVFYSEYSPIELSDGCNKSGGSSLSSRSFLSLSSLDQSISSRPCCSRDFRDKNLGDLSQNSLEMGVFRVPEPKRTKTPTTNYKRRVHLPPVKLPNADEVDLLLREIMAINSEVVNFEIPLAMQNHLRLRNRTIMPVRLNSGNQGSCNTSNDQASVSSDSFGSSVGNLDSLHN 315          
The following BLAST results are available for this feature:
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SINHCAF8.176e-1247.92SIN3-HDAC complex associated factor [Source:HGNC S... [more]
SINHCAF8.176e-1247.92SIN3-HDAC complex associated factor [Source:HGNC S... [more]
SINHCAF8.735e-1247.92SIN3-HDAC complex associated factor [Source:HGNC S... [more]
SINHCAF8.735e-1247.92SIN3-HDAC complex associated factor [Source:HGNC S... [more]
SINHCAF5.132e-1147.92SIN3-HDAC complex associated factor [Source:HGNC S... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG447743.940e-943.75gene:FBgn0266000 transcript:FBtr0343137[more]
CG447743.940e-943.75gene:FBgn0266000 transcript:FBtr0343138[more]
CG447743.940e-943.75gene:FBgn0266000 transcript:FBtr0343139[more]
CG447744.110e-943.75gene:FBgn0266000 transcript:FBtr0343136[more]
CG447744.110e-943.75gene:FBgn0266000 transcript:FBtr0343141[more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sinhcafl1.952e-1055.70SIN3-HDAC complex associated factor, like [Source:... [more]
sinhcaf2.462e-952.56SIN3-HDAC complex associated factor [Source:ZFIN;A... [more]
sinhcaf2.462e-952.56SIN3-HDAC complex associated factor [Source:ZFIN;A... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ebag95.248e-1153.09estrogen receptor binding site associated, antigen... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sinhcaf4.997e-1247.92SIN3-HDAC complex associated factor [Source:MGI Sy... [more]
Sinhcaf1.224e-1147.92SIN3-HDAC complex associated factor [Source:MGI Sy... [more]
Sinhcaf1.688e-1154.43SIN3-HDAC complex associated factor [Source:MGI Sy... [more]
Sinhcaf3.147e-1147.92SIN3-HDAC complex associated factor [Source:MGI Sy... [more]
Sinhcaf3.147e-1147.92SIN3-HDAC complex associated factor [Source:MGI Sy... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5ZJV7|SHCAF_CHICK1.286e-1148.96SIN3-HDAC complex-associated factor OS=Gallus gall... [more]
sp|Q8C8M1|SHCAF_MOUSE2.201e-1047.92SIN3-HDAC complex-associated factor OS=Mus musculu... [more]
sp|Q5RCB7|SHCAF_PONAB2.307e-1043.09SIN3-HDAC complex-associated factor OS=Pongo abeli... [more]
sp|Q9NP50|SHCAF_HUMAN2.464e-1047.92SIN3-HDAC complex-associated factor OS=Homo sapien... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D7A62.249e-1757.89SIN3-HDAC complex-associated factor OS=Schistosoma... [more]
A0A183RMV27.728e-1655.79Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A183P8T71.112e-1556.84Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A430PZN91.186e-1556.84Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A430QPK51.257e-1556.84Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sinhcaf6.934e-1150.00SIN3-HDAC complex associated factor [Source:NCBI g... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sinhcafl4.115e-1353.41SIN3-HDAC complex associated factor, like [Source:... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO416402.016e-739.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357108.713e-744.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sinhcafl3.069e-1140.00SIN3-HDAC complex-associated factor [Source:NCBI g... [more]
sinhcaf3.243e-951.90SIN3-HDAC complex-associated factor [Source:NCBI g... [more]
back to top
BLAST of SIN3-HDAC complex-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033706.10.000e+099.68SMESG000033706.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024748 ID=SMED30024748|Name=SIN3-HDAC complex-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1860bp
CTATATAAATCTTATATGATACCTTCCAATTTTAACTAGCTTAAGGATAA
TGTCAAGATCTCAGTTTAGAAGTACGACTGGTTGCTGTATATGCGCAACT
AAATCATCAAGCAGCAGATTTTCCAACAGCTACAGATTTTCGCAGTATTT
TTCCAAATGTTTTGGACCAAGAGGCGAAGGTCGTAATGGTGATATTTGCA
ATGCTTGTGTTTTATATGTGAAACGTTGGTTAAAAGCATCAGATCAATCC
TGTGGAAAATATGAAAAAGTTCTTGACAAAAAGAAAGGCCCTGGTTTAAA
ACATATAACTCAAATTGTAAAAATGCAACAACGTCGTCAAGCCAGATTAA
AATTAATCGGCCAACAGTGTGGTCATGGAATGGAAACCAGAAGTAAAAAT
CAGAATACATTTTCAGTTAACTCAAATCATAGTTCATCTTGTTTAAATGC
AAACAAAGATAGACTTGATAAAGACTGTTACGTATTCTATTCTGAATATT
CCCCAATCGAACTATCTGATGGTTGTAATAAAAGTGGTGGTTCAAGCCTA
TCATCTCGCAGTTTTTTGAGTTTGTCTTCATTAGATCAGTCAATCAGTTC
TAGGCCGTGTTGCTCTAGAGATTTCAGAGATAAAAATCTAGGAGATTTAA
GTCAAAACAGTTTGGAAATGGGTGTATTTCGAGTTCCAGAACCTAAACGA
ACAAAAACTCCTACTACAAATTATAAACGCCGTGTTCATTTACCTCCAGT
CAAGTTGCCAAATGCAGATGAAGTTGATCTTCTATTAAGAGAAATAATGG
CTATAAACAGTGAAGTTGTAAATTTTGAAATTCCTTTAGCGATGCAAAAT
CATTTGCGTTTACGCAACCGAACTATAATGCCAGTCCGTTTGAATTCTGG
TAATCAAGGCAGTTGTAATACTAGTAACGACCAAGCCTCTGTCAGTTCAG
ATTCATTCGGTAGTAGTGTCGGTAATTTGGACTCATTACACAACTGATTT
CTGATCTTGAATCTTGTTATCTATTACTTTTGTGTTACACTTTATTGACG
TTTATTTAATCATTTAACCAGATAGACAATTCTTCTTTTATTCATATTAA
TTCTGTTTTTCTAACGAGAAATGGAAAGGAATAGAAAAAAACTGTTTTAC
ATTAAGCATTTGCATCATATCTATCACAAAAACACAATTGCTGATGACGA
CAATACATTAGTTATTTCGGTGGGAATCATTTTGCTCATGTTAAAAATGC
CGAGTGGTGGTAAGTAAGTTTCTTCTATCAAAGAAAAAATAAAATAACCA
CATTGTGTTTCTTACCAAAGGGCAGCTCCTTTATGAAATTGAATTTGAAA
ATAGGAACTTATTTTATCTAATTTATTATTTTATTTGTGTTATGAATTAT
ATTGTTTATTTTAGTCGTGTAGTTTTCATTTTTCTCATTAATGATTTCTT
TTGTTTTTTGTTGTTTTGTGCCTTAAGTGATATATTTAAATTGATTAAGA
AGTAATGCTTTCAAATATTATATATGCTTTGAATTTTGGGTTTGTATAAA
TTGACATTGTATTCATCATTGCTATTGCACATTTTTAACATTTTTTATTT
TACCGAGTTGTCTTTATACTTGAATTTCTATCCTAACTGTTTTTGCATGT
GTCTATTATATATCCTTACACGCGTATATAAATATAAATATCCACTTTTT
GAGTTATGTAAGACTGGTAGCTATAAATCCTAACTATAAGTTATAGCTTA
AAAGTTTAGTATTAGTCGATGTTATCGGTTATTTTGGTTGATGTTTATAA
TTGTATTTTTTGACAAGCAAATTGTGGGAAAAAAATGTAAATAAATATAA
TCAGATTGAG
back to top

protein sequence of SMED30024748-orf-1

>SMED30024748-orf-1 ID=SMED30024748-orf-1|Name=SMED30024748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MSRSQFRSTTGCCICATKSSSSRFSNSYRFSQYFSKCFGPRGEGRNGDIC
NACVLYVKRWLKASDQSCGKYEKVLDKKKGPGLKHITQIVKMQQRRQARL
KLIGQQCGHGMETRSKNQNTFSVNSNHSSSCLNANKDRLDKDCYVFYSEY
SPIELSDGCNKSGGSSLSSRSFLSLSSLDQSISSRPCCSRDFRDKNLGDL
SQNSLEMGVFRVPEPKRTKTPTTNYKRRVHLPPVKLPNADEVDLLLREIM
AINSEVVNFEIPLAMQNHLRLRNRTIMPVRLNSGNQGSCNTSNDQASVSS
DSFGSSVGNLDSLHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0045596negative regulation of cell differentiation
GO:0030336negative regulation of cell migration
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR026065FAM60A
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016580Sin3 complex