SMED30024729

Overview
NameSMED30024729
Smed IDSMED30024729
Length (bp)3613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024729 (SMED30024729) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024729 (SMED30024729) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024729 (SMED30024729) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024729 (SMED30024729) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024729

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024729SMESG000014273.1 SmedASXL_067902SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000043940.1 SMESG000043581.1 SMESG000035410.1 SMESG000029692.1 SMESG000014273.1 Contig10772uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000043940.1 SMESG000043581.1 SMESG000035410.1 SMESG000029692.1 SMESG000014273.1 Contig10772newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000029692.1 SMESG000013857.1 Contig20597uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000029692.1 SMESG000013857.1 Contig20597newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059765.1 SMESG000059761.1 SMESG000059678.1 SMESG000058904.1 SMESG000058773.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000040860.1 SMESG000040455.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000014273.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000002488.1 SMESG000001438.1 SMESG000000690.1 SMESG000000374.1 Contig36656uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059765.1 SMESG000059761.1 SMESG000059678.1 SMESG000058904.1 SMESG000058773.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000040860.1 SMESG000040455.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000014273.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000002488.1 SMESG000001438.1 SMESG000000690.1 SMESG000000374.1 Contig36656newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000002488.1 Contig52515uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024729SMESG000002488.1 Contig52515newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30024729SMESG000037686.1 SMESG000035410.1 SMESG000013977.1 SMESG000013857.1 dd_Smed_v4_10407_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30024729SMESG000029692.1 SMESG000013977.1 SMESG000002488.1 SMED30024729smed_20140614PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30024729SMESG000029692.1 SMESG000013977.1 SMESG000002488.1 SMED30024729smed_20140614PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024729 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.013085:7066..10223 +12537
Homology
BLAST of SMED30024729 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 56.225 bits (134), Expect = 3.330e-7
Identity = 29/102 (28.43%), Postives = 50/102 (49.02%), Query Frame = -1
Query: 3008 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTKGEKSV 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPNE C  K+ ++   +H   C +    C + Q+P  K   ++
Sbjct:   77 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINI 176          
BLAST of SMED30024729 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 56.225 bits (134), Expect = 3.330e-7
Identity = 29/102 (28.43%), Postives = 50/102 (49.02%), Query Frame = -1
Query: 3008 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTKGEKSV 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPNE C  K+ ++   +H   C +    C + Q+P  K   ++
Sbjct:   77 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINI 176          
BLAST of SMED30024729 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 52.7582 bits (125), Expect = 2.837e-6
Identity = 28/97 (28.87%), Postives = 48/97 (49.48%), Query Frame = -1
Query: 3023 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTK 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPN+ C  K+ ++   +H   C +    C + Q+P  K
Sbjct:   77 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQK 171          
BLAST of SMED30024729 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.279e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = -1
Query: 3023 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTK 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPNE C  K+ ++   EH   C +    C + Q+P  K
Sbjct:   78 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQCQRPFQK 172          
BLAST of SMED30024729 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.599e-6
Identity = 29/102 (28.43%), Postives = 50/102 (49.02%), Query Frame = -1
Query: 3008 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTKGEKSV 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPNE C  K+ ++   +H   C +    C + Q+P  K   ++
Sbjct:   77 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINI 176          
BLAST of SMED30024729 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.949e-6
Identity = 29/102 (28.43%), Postives = 50/102 (49.02%), Query Frame = -1
Query: 3008 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTKGEKSV 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPNE C  K+ ++   +H   C +    C + Q+P  K   ++
Sbjct:   77 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINI 176          
BLAST of SMED30024729 vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.965e-6
Identity = 29/102 (28.43%), Postives = 50/102 (49.02%), Query Frame = -1
Query: 3008 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTKGEKSV 3313
            L+E  QT CG R C  CII    +   +CP   +  +E+  +   +    +EIL++ + CPNE C  K+ ++   +H   C +    C + Q+P  K   ++
Sbjct:   77 LREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN--QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINI 176          
BLAST of SMED30024729 vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.601e-6
Identity = 29/97 (29.90%), Postives = 46/97 (47.42%), Query Frame = -1
Query: 3023 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTK 3313
            L+E  QT CG R C  CI+    N   +CP   D +I   K+   +    +EIL++R+ CPN  C   + ++    H+ +C +    C + Q    K
Sbjct:   79 LREAVQTPCGHRFCKACILKSLRNAGHKCP--VDNEILMEKQLFPDNFAKREILSLRVKCPNLGCTDTMELRHLEHHLVQCQFASVECSQCQGSFLK 173          
BLAST of SMED30024729 vs. TrEMBL
Match: A0A3G2YQR5 (TNF receptor-associated factor OS=Eudontomyzon morii OX=682880 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.460e-6
Identity = 31/95 (32.63%), Postives = 50/95 (52.63%), Query Frame = -1
Query: 3029 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPV 3313
            L+EP QT CG R C  CI++   +   +CP   D  +    +   +    +EIL++ + CPN+PC  +  ++   EH  +C Y + PC R + PV
Sbjct:   72 LREPVQTPCGHRFCRACILHSMRDAGPKCPV--DNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPV 164          
BLAST of SMED30024729 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 60.4622 bits (145), Expect = 1.645e-9
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = -1
Query: 3029 LKEPRQTECG*RLCTECIIN--RTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPV 3313
            L+EP QT CG R C  CI++  R  +   +CP   D  +    +   +    +EIL++ + CPN+PC  +  ++   EH  +C Y + PC R + PV
Sbjct:   72 LREPVQTPCGHRFCRACILHSMRLRDAGPKCPV--DNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPV 166          
BLAST of SMED30024729 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 57.7658 bits (138), Expect = 6.054e-8
Identity = 30/97 (30.93%), Postives = 50/97 (51.55%), Query Frame = -1
Query: 3023 LKEPRQTECG*RLCTECIINRTSNRSKRCPDYGDTKIESFKETQENRATTKEILTMRINCPNEPCE*KVRIKDTNEHMEKCYYKRKPCERYQKPVTK 3313
            L+   QT CG R C  CI     +  +RCP   D ++ S  +   +    +EIL++ + CPN  C  K+ ++   +H+ +C +   PC + Q+PV K
Sbjct:   85 LRNAIQTRCGHRFCKSCIEKSIRDTGQRCPV--DNEMLSEDQLFPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPCSQCQQPVRK 179          
BLAST of SMED30024729 vs. Planmine SMEST
Match: SMESG000003311.1 (SMESG000003311.1)

HSP 1 Score: 115.546 bits (288), Expect = 1.113e-51
Identity = 66/91 (72.53%), Postives = 74/91 (81.32%), Query Frame = -3
Query: 1107 EKRQIEKVRKRQNAQWENKKEALETKVRNLESDVEKLKAHENTTMLEKEVEDLIEEVN*LSYMLDGEMATTQESREK*KRTKKIYI*SENI 1379
            EKR I    +RQ AQWENKKEAL+TKVRNLESDVE+LKAHENTTML+KEVEDL  +VN LSYMLDGEMATTQE RE     +KIYI ++ I
Sbjct:   69 EKRDI--TLQRQKAQWENKKEALKTKVRNLESDVERLKAHENTTMLKKEVEDLTGKVNQLSYMLDGEMATTQELRE--NENEKIYIYNQKI 155          

HSP 2 Score: 109.383 bits (272), Expect = 1.113e-51
Identity = 56/65 (86.15%), Postives = 57/65 (87.69%), Query Frame = -1
Query: 1370 AEEREEDSKWILAIRENEITVAQRTSRKLSRLKEQNQLLVEIEQSRSEHDERDVVGYKDMCEKRD 1564
            A+EREEDSK ILAIRENEITVAQRT RKLS L EQNQL VEIE SR EH ERDVVGYKDMCEKRD
Sbjct:    8 AKEREEDSKLILAIRENEITVAQRTFRKLSGLNEQNQLQVEIEHSRLEHAERDVVGYKDMCEKRD 72          

HSP 3 Score: 67.3958 bits (163), Expect = 1.111e-17
Identity = 41/69 (59.42%), Postives = 48/69 (69.57%), Query Frame = -2
Query:  391 NELTTKWTRYVQENHWKVQAKRIQKKNISKNKETKPSI*KARRIRNETV--*KKSATAQTTNTNIERDK 591
            +EL  KWTRYVQE HWKVQAKRIQ+    K ++TK      R++    +   KKSATAQTTNTNIERDK
Sbjct:  224 DELVAKWTRYVQEKHWKVQAKRIQR----KYRKTKRLNRAYRKLEGYAMKQYKKSATAQTTNTNIERDK 288          

HSP 4 Score: 43.1282 bits (100), Expect = 1.111e-17
Identity = 25/48 (52.08%), Postives = 34/48 (70.83%), Query Frame = -1
Query:  593 FQSRNLIEALKRKRDVMKRQRKEVEDENEWLRQNVEVSKGWKEKVDEL 736
             QSR L + LK +  ++ +Q K +E+ENE LRQ +EV KG +EKVDEL
Sbjct:  180 VQSRKLFKTLKEECLILNKQ-KNLEEENELLRQQMEVCKGLEEKVDEL 226          
BLAST of SMED30024729 vs. Planmine SMEST
Match: SMESG000009758.1 (SMESG000009758.1)

HSP 1 Score: 165.236 bits (417), Expect = 3.541e-42
Identity = 107/136 (78.68%), Postives = 122/136 (89.71%), Query Frame = -1
Query:  590 NMNSQIEPTTIEVESGETFINEIVNIKLIKIEVENEFSIPMECKIXXXXXXXXXXXXXXXXXXXMIKNMKIAREQQIQEIDCMTNQWFQSRNLIEALKRKRDVMKRQRKEVEDENEWLRQNVEVSKGWKEKVDELK 997
            ++   IE TTIEVESGET INE   IK +K+EVENEF I M+CKIEES EVESSMEVESSEQEEMIKNMKIA EQQIQEIDCMTNQWFQSRNLI+ALKR+RDV+KRQRKEVEDEN+WL+QN+EV+KGW+E ++ELK
Sbjct:  491 DLTGTIELTTIEVESGETTINE--GIKPLKMEVENEFPISMKCKIEESMEVESSMEVESSEQEEMIKNMKIAMEQQIQEIDCMTNQWFQSRNLIKALKRERDVLKRQRKEVEDENKWLKQNIEVNKGWEEGIEELK 624          

HSP 2 Score: 99.3673 bits (246), Expect = 4.779e-37
Identity = 51/64 (79.69%), Postives = 54/64 (84.38%), Query Frame = -1
Query: 1370 EEREEDSKWILAIRENEITVAQRTSRKLSRLKEQNQLLVEIEQSRSEHDERDVVGYKDMCEKRD 1561
            EEREEDSK ILAI+ENEITVAQRT RK S L EQNQL VEIEQ   EH ERD++GYKDMCEKRD
Sbjct:  382 EEREEDSKLILAIQENEITVAQRTFRKRSGLNEQNQLQVEIEQLHPEHAERDLIGYKDMCEKRD 445          

HSP 3 Score: 76.2554 bits (186), Expect = 4.779e-37
Identity = 38/44 (86.36%), Postives = 42/44 (95.45%), Query Frame = -3
Query: 1221 KRQNAQWENKKEALETKVRNLESDVEKLKAHENTTMLEKEVEDL 1352
            +RQ AQWENK EALETKVRNLES+VE+LKAHENTTML+KEVEDL
Sbjct:  449 QRQKAQWENKNEALETKVRNLESEVERLKAHENTTMLKKEVEDL 492          
BLAST of SMED30024729 vs. Planmine SMEST
Match: SMESG000013977.1 (SMESG000013977.1)

HSP 1 Score: 130.954 bits (328), Expect = 9.507e-31
Identity = 81/93 (87.10%), Postives = 84/93 (90.32%), Query Frame = -1
Query: 1361 NNWKMWEQLEDXXXXXXXXXXXXXKAEEREEDSKWILAIRENEITVAQRTSRKLSRLKEQNQLLVEIEQSRSEHDERDVVGYKDMCEKRDKLR 1639
            N WKM EQLED RKIINK++KQLKKAEEREEDSK ILAIRENEITVAQRT RKLS L EQNQL VEIEQSRSEHDE D+VGYKDMCEKRDKLR
Sbjct:  498 NGWKMREQLEDHRKIINKMRKQLKKAEEREEDSKLILAIRENEITVAQRTFRKLSGLNEQNQLQVEIEQSRSEHDEPDMVGYKDMCEKRDKLR 590          
BLAST of SMED30024729 vs. Planmine SMEST
Match: SMESG000059068.1 (SMESG000059068.1)

HSP 1 Score: 125.561 bits (314), Expect = 2.793e-29
Identity = 89/121 (73.55%), Postives = 96/121 (79.34%), Query Frame = -3
Query: 1563 SSGSCKLXXXXXXXXXXXXXXXXXSGASEKRTNKSERRTSKHKKRTNSTNNLMIQSNGTKWKSRR-----SKNLEEKIPGNCKTAEEIAAKVDTYE*LENVGTTRRPEEDYQQDTKAIKES 1910
            +SGSC LRI RETSK E+RET +PSGASEKRTNKSERRTSKHKKR N TNN MIQSNGTKWKS       SKNLEEKIP N K AE IAAKVDT   LENVGT  RP+EDYQ+D K IK++
Sbjct:  516 NSGSCILRIPRETSKQEDRETRNPSGASEKRTNKSERRTSKHKKRANRTNNSMIQSNGTKWKSHSRAKETSKNLEEKIPRNRKRAEGIAAKVDTSGCLENVGT--RPDEDYQRDAKTIKDN 634          

HSP 2 Score: 64.6994 bits (156), Expect = 3.378e-10
Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = -2
Query: 2128 MTEMKEMIESKTENDVGAAKKSTFCNXXXXXXXXXXKTINGKPSGE 2265
            M EMKE IESKTENDVGAAKKSTFCNKRQQYKKRKRKTIN KPSGE
Sbjct:  461 MAEMKETIESKTENDVGAAKKSTFCNKRQQYKKRKRKTINDKPSGE 506          
BLAST of SMED30024729 vs. Planmine SMEST
Match: SMESG000059068.1 (SMESG000059068.1)

HSP 1 Score: 125.561 bits (314), Expect = 3.475e-29
Identity = 89/121 (73.55%), Postives = 96/121 (79.34%), Query Frame = -3
Query: 1563 SSGSCKLXXXXXXXXXXXXXXXXXSGASEKRTNKSERRTSKHKKRTNSTNNLMIQSNGTKWKSRR-----SKNLEEKIPGNCKTAEEIAAKVDTYE*LENVGTTRRPEEDYQQDTKAIKES 1910
            +SGSC LRI RETSK E+RET +PSGASEKRTNKSERRTSKHKKR N TNN MIQSNGTKWKS       SKNLEEKIP N K AE IAAKVDT   LENVGT  RP+EDYQ+D K IK++
Sbjct:  527 NSGSCILRIPRETSKQEDRETRNPSGASEKRTNKSERRTSKHKKRANRTNNSMIQSNGTKWKSHSRAKETSKNLEEKIPRNRKRAEGIAAKVDTSGCLENVGT--RPDEDYQRDAKTIKDN 645          

HSP 2 Score: 67.3958 bits (163), Expect = 4.651e-11
Identity = 48/58 (82.76%), Postives = 51/58 (87.93%), Query Frame = -2
Query: 2128 KQLNLQKIYEKDMTEMKEMIESKTENDVGAAKKSTFCNXXXXXXXXXXKTINGKPSGE 2301
            K + L+KI  K+M EMKE IESKTENDVGAAKKSTFCNKRQQYKKRKRKTIN KPSGE
Sbjct:  462 KLVELKKI--KNMAEMKETIESKTENDVGAAKKSTFCNKRQQYKKRKRKTINDKPSGE 517          
The following BLAST results are available for this feature:
BLAST of SMED30024729 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAF63.330e-728.43TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF63.330e-728.43TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30024729 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf62.837e-628.87TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30024729 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZCC3|TRAF6_BOVIN6.279e-730.93TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|Q9Y4K3|TRAF6_HUMAN1.599e-628.43TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|B6CJY5|TRAF6_MACMU1.949e-628.43TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|B6CJY4|TRAF6_CERAT1.965e-628.43TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|Q3MV19|TRF6A_XENLA5.601e-629.90TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
back to top
BLAST of SMED30024729 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A3G2YQR52.460e-632.63TNF receptor-associated factor OS=Eudontomyzon mor... [more]
back to top
BLAST of SMED30024729 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf61.645e-932.99TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30024729 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024729 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf66.054e-830.93TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30024729 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003311.11.113e-5172.53SMESG000003311.1[more]
SMESG000009758.13.541e-4278.68SMESG000009758.1[more]
SMESG000013977.19.507e-3187.10SMESG000013977.1[more]
SMESG000059068.12.793e-2973.55SMESG000059068.1[more]
SMESG000059068.13.475e-2973.55SMESG000059068.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024729 ID=SMED30024729|Name=SMED30024729|organism=Schmidtea mediterranea sexual|type=transcript|length=3613bp
AGGTGTGGATTGGGGTTTTTGCATCAGGATTTTCGGAGAAGATATTCCTG
GATTGTGATGAGTTTTGACTTGATTGTTTGGATTGACTCGAGAGCTTCAT
GGATTTTCTGAGGGTTCGGGTTTGATTTGTACACGAAGGTGAAGAGTAGG
AGTAAGGTGATTTTTGACCACAGGTTCCTTTTCCTCTATTTACAGATGTT
CATTTTGTTTTTGTCCACTTTTATATACGGTTTTGTTTTGCACTTATTTT
ACTCTGGGTTCGTCTCACTTTGATCGTCTAGGGTTTGACTTTTCATCGAC
ATCAACTCCGCTCTTATTAATCGATTTGTCATTTCGGGGATTAGGGTGAT
GACTTTCTCTTTTTCTTCAATCATACTTCTTTGATTCTCATTTGTCTCTT
TCAATATTCGTATTTGTGGTTTGTGCTGTTGCACTTTTTTTTTAAACTGT
TTCATTGCGTATCCTTCGAGCTTTCTATATGCTCGGTTTAGTCTCTTTGT
TTTTCGATATATTTTTTTTTTGTATTCTTTTTGCTTGTACTTTCCAGTGA
TTTTCCTGTACGTATCTTGTCCATTTGGTCGTTAGCTCATTTTAATTCAT
CTACCTTTTCTTTCCAACCCTTGCTTACTTCGACGTTTTGCCTTAACCAC
TCGTTTTCATCTTCTACTTCTTTTCGTTGTCTTTTCATTACATCACGTTT
TCTTTTTAACGCCTCTATTAAGTTTCGCGATTGGAACCATTGATTTGTCA
TACAATCTATTTCTTGGATTTGCTGTTCCCTCGCTATTTTCATATTCTTT
ATCATCTCTTCTTGTTCACTACTTTCTACTTCCATTGAACTTTCTACTTC
CCTTGATTCTTCGATTTTACATTCCATAGGTATCGAAAATTCGTTCTCCA
CTTCAATTTTGATGAGTTTGATATTTACAATTTCGTTGATAAAGGTCTCG
CCGGACTCTACTTCTATGGTTGTTGGTTCTATCTGACTATTCATATTTCT
ACCATTTTTATGTTCATGATTTTTGTTATTTTTATTATCGTTTTGATTTT
CTGGTTTTTATGAATTTTATCTTTCTATGAGTTTTTATACATTTTTCTGG
TTTTTATATATTTTCTGATTATATATATATTTTTTTTGTTCGTTTTCATT
TTTCTCGCGATTCTTGTGTGGTAGCCATTTCTCCATCCAACATATAAGAT
AGTTAGTTTACTTCTTCTATGAGATCCTCTACTTCCTTTTCTAGCATAGT
AGTATTTTCATGGGCCTTGAGCTTTTCGACATCACTTTCCAAGTTTCTCA
CTTTCGTCTCAAGTGCCTCCTTCTTATTTTCCCATTGTGCATTTTGCCTT
TTTCTCACTTTCTCAATTTGTCTCTTTTCTCACACATGTCCTTATATCCT
ACCACATCTCGTTCATCATGTTCTGAGCGCGACTGCTCTATTTCCACTAA
CAGTTGATTTTGTTCCTTTAATCTTGATAGTTTTCTAGATGTTCTTTGCG
CCACTGTTATCTCGTTTTCTCGAATTGCTAAGATCCATTTTGAATCCTCT
TCTCTCTCTTCAGCTTTCTTTAATTGCTTTTGTATCTTGTTGATAATCTT
CCTCTGGTCTTCGAGTTGTTCCCACATTTTCCAATTATTCATAGGTGTCC
ACTTTTGCGGCAATTTCTTCCGCTGTCTTACAGTTTCCTGGTATTTTCTC
TTCCAGGTTCTTACTTCTACGGCTCTTCCACTTTGTCCCATTACTTTGGA
TCATTAAGTTATTTGTGCTATTTGTTCTCTTTTTGTGTTTACTAGTTCTT
CTCTCACTCTTATTCGTACGTTTCTCACTTGCTCCACTTGGGCTTCAAGT
TTCTCTCTCTTCTTATTTGCTTGTTTCTCTGGTTATTCGTAGTTTGCAGC
TTCCGCTACTTGTCCACGGTGTTTGATTCTCATCGTTCCTAATTCGTCTA
TCTTTTTGATCAATCTTTCGCTTTACTCATATACTTCGTTTTCTAACTGC
CCGTTGTTTTGGTTTTGCAATTCTGACATTACCTTATTATACTTTAATTT
CATTTCTTGAGCTTTATTGAAATCTTTTATTTTGTTCAATTGGTTTACTT
GTTCGTCCTTTTCTTTGGTTTTCTTTTCTCACCACTCGGCTTGCCATTTA
TAGTTTTCCGTTTCCGCTTTTTGTACTGTTGACGTTTGTTGCAAAATGTA
CTTTTCTTTGCTGCTCCGACATCGTTTTCCGTTTTACTTTCTATCATTTC
CTTCATTTCCGTCATGTCTTTCTCGTATATTTTTTGCAAGTTCAATTGTT
TGATGGTTGTATATGTTCTTGGTTCGTTCTCTCAACTGTTTCATCATCAT
TTTATGTTTTCCATCTCTGTTTCCATTCGATTTATTTTTTCGGCGGCATC
GTTTTTAATCAATATTGCTCTATTTACCTCATTGTTCATTAGTTTCATCA
CCATTACCGTCGGAATATCAACTCGCACATCAATTATCATTTGTTCGGTA
TTCATTTTCTACAATCAGTTTATTTTTCTTTTGCGGTGTTCATCGTTTTA
ATTTTACGCAGTACAGATTTTATAATATTTATGGGTCATACTTTTACAAT
ATATACATATATGTATTTATAATCAATTTACATTCTCGGCGTACTCAATC
TGATATCCCCTGGCTCCCGTCTTTCCCACCGATACTTTTACTAACAACAC
ATTGCCTTTCACATAATTCCACATCATGCTTCATCATTTTGGGAGCTTCG
GTGGCTATTGTAACAGTTCTTCTTTCAAAGTTTTAGTTTTACATCCCATT
TTTACCATTTGGCATTCTGTTCTCTTTTGGCTGCATCTTTCCCAATGCTA
TTTTAGCTCTAATTCTTCTATTACCCACATTGACTTGGACATGTTCGTCT
GAATTTGCCCCGACCTTTTCCTTCTCTACTTCACATGTTTTTGTTGTATT
TGTTTCCACATTTCGGTCATGTTTAAGTGTTCACATTTTATTCTCCCCTC
TTTCACAGACACTTTTCTCACCTTTTGTTACTGGTTTTTGATATCTTTCA
CATGGTTTTCTTTTATAATAACATTTTTCCATATGTTCATTTGTGTCTTT
GATTCTCACTTTTCACTCGCACGGTTCGTTTGGGCAATTTATTCTCATGG
TTAATATTTCTTTGGTGGTTGCTCGGTTCTCTTGAGTTTCTTTAAAGGAT
TCTATTTTAGTATCTCCATAGTCAGGACATCTCTTTGAACGGTTTGATGT
TCGGTTTATTATGCACTCGGTGCACAATCTCTATCCGCATTCCGTTTGTC
TTGGCTCTTTTAGTAACTCTGTATATAATCCTCATCAAAATCTTGGTTCT
AGTTTTATTTGTGGTTGTTTCCTGGTTATTTTGATAATTTCGTTGATTTC
CGTCATGCCTTTTGTTGAATTCATCTTCTACCATATTTTTCTTTGTATTT
TCTACTTTTATCCATTTATTCTTTTACGTATTTTTGATTTCTTTTTACTT
TTATATATCGAATTTTACATATATTTGATTTTGAATTTTCTTTCTACATT
TATACAGTTAATCCTTCTACACCAGTACATTTCCTGTCATTTTCTTTCAC
GCTACTAGACGAG
back to top

protein sequence of SMED30024729-orf-1

>SMED30024729-orf-1 ID=SMED30024729-orf-1|Name=SMED30024729-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MGQSGRAVEVRTWKRKYQETVRQRKKLPQKWTPMNNWKMWEQLEDQRKII
NKIQKQLKKAEEREEDSKWILAIRENEITVAQRTSRKLSRLKEQNQLLVE
IEQSRSEHDERDVVGYKDMCEKRDKLRK*
back to top

protein sequence of SMED30024729-orf-2

>SMED30024729-orf-2 ID=SMED30024729-orf-2|Name=SMED30024729-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp
MNSQIEPTTIEVESGETFINEIVNIKLIKIEVENEFSIPMECKIEESREV
ESSMEVESSEQEEMIKNMKIAREQQIQEIDCMTNQWFQSRNLIEALKRKR
DVMKRQRKEVEDENEWLRQNVEVSKGWKEKVDELK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0000418head
PLANA:0002030early male germ cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis