SMED30024728

Overview
NameSMED30024728
Smed IDSMED30024728
Length (bp)876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024728 (SMED30024728) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024728 (SMED30024728) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024728

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30024728SMESG000074843.1 SMESG000029191.1 dd_Smed_v4_45479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30024728 vs. Ensembl Zebrafish
Match: CABZ01033394.1 (pep chromosome:GRCz11:13:6032844:6038477:-1 gene:ENSDARG00000101795.2 transcript:ENSDART00000166130.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01033394.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.852e-14
Identity = 61/228 (26.75%), Postives = 108/228 (47.37%), Query Frame = -3
Query:    2 IGKKLIQMLNFCVFSSTL*LK-----LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDG--CSEHNFI---ITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSL--AYAD 649
            +G+  + +LN  +   +L L      + L    G+ L+ I ++RP+++  + ++I +K L  R    I +          IIHPD   C     I   I+ +R++ +  +Y       +L L  +D   AF  + H+ LW TLE  G     + + K LY + +SV   N   S P  + +G++QGC LS  L+ L+I+ + +++      F + N ++     AYAD
Sbjct:  513 LGEDFLAVLNESLTEGSLPLSCRRAVVTLLPKKGD-LQEIKNWRPVSLLCSDFKILSKTLANRLKNVIGH----------IIHPDQTYCVPGRSIMDNISLVRDILDLSSYFN----LDLGLISIDQEKAFDRVEHQYLWNTLEAFGFGSGFIGMIKVLYQDIESVLKINGGLSAPFKINRGIRQGCALSGMLYSLAIEPMLRKLRSRIEGFMLANKSVQHQLSAYAD 725          
BLAST of SMED30024728 vs. Ensembl Zebrafish
Match: BX547930.4 (pep chromosome:GRCz11:20:12830448:12834749:1 gene:ENSDARG00000098779.2 transcript:ENSDART00000164754.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX547930.4)

HSP 1 Score: 73.9442 bits (180), Expect = 3.280e-14
Identity = 55/199 (27.64%), Postives = 95/199 (47.74%), Query Frame = -3
Query:    2 LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDG--CSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNI--NLNSLAYAD 586
            L L    G+ LK + ++RP+A+  T Y+I +K L           N L +    +IH D   C  +  I+ ++  + +     K   L ++ L  LD   AF  + H+ LW T E  G  I  +++ K LY +  S+   N   S P  + +G++QGC LS  L+ ++++ +  +I +    F  +N+   +   AYAD
Sbjct:  532 LTLLPKKGD-LKEVKNWRPVALLCTDYKILSKAL----------ANRLREVMGQVIHIDQSYCVPNRSIVDNISLIRDVIEVSKIFGL-KVGLLTLDQEKAFDRVEHQFLWNTFEAFGFPIVFIDMIKVLYSDIGSILKINGGLSVPFKINRGIRQGCALSGMLYSIALEPLLNKIRRELEGFKCENLFPPVKLSAYAD 718          
BLAST of SMED30024728 vs. Ensembl Zebrafish
Match: CABZ01030017.1 (pep scaffold:GRCz11:KN150259.1:45362:50078:-1 gene:ENSDARG00000099418.2 transcript:ENSDART00000162307.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030017.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.375e-12
Identity = 60/214 (28.04%), Postives = 97/214 (45.33%), Query Frame = -3
Query:   83 FPTKFQMHFKLVLTQFLELILQNTRIGKKLIQMLNFCVFSSTL*LKLALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSID 724
            FP++F   F   LT FL ++  ++     L   L+    S        L L   +     +SYRPI++     +I AKV+  R    + +  ++S  Q G I     + H+F   ++R + N   Y + + + E  +  LD   AF  +    L+  LEK G     L+  K LY    +V + N   S+   + +G +QGCPLS  LF L+I+
Sbjct:  475 FPSEFYKKFSKQLTPFLTVVFSDSFKSGALPPTLSQACIS--------LLLKKDKDPLDCTSYRPISLLNCDVKILAKVIASRLENVLPS--IISPDQTGFIK----NRHSFF--NIRRLLNII-YSQHHSIPEC-VVSLDAEKAFDRVEWDYLFLALEKFGFGPNFLSWIKLLYNTPSAVVLTNGSQSRSFNLQRGTRQGCPLSPLLFALAIE 670          
BLAST of SMED30024728 vs. Ensembl Zebrafish
Match: CU462878.3 (pep chromosome:GRCz11:17:8542203:8545189:1 gene:ENSDARG00000103562.2 transcript:ENSDART00000158873.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU462878.3)

HSP 1 Score: 67.0106 bits (162), Expect = 5.891e-12
Identity = 61/225 (27.11%), Postives = 97/225 (43.11%), Query Frame = -3
Query:   59 TSIFPTKFQMHFKLVLTQFLELILQNTRIGKKLIQMLNFCVFSSTL*LKLALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEK 733
            T  +P++    FK  +T  L         G ++ Q     V S        +    G+     SSYRPI++    Y++FA +L++R    I    L+   Q G I      ++      LR      ++     ++ + L  LD   AF S+    L+  L + G N   +   K LYL+ K+    N   SK I + +G +QGCPLS TLF L I+ + + I +
Sbjct:  287 TDGYPSEMYKTFKPQITPMLLKCFNYVLRGGEIPQSWQEAVIS--------IIPKQGKDKNECSSYRPISVLNVDYKLFASILSKRLEVVI--SELVDLDQTGFIQNRQTQDN------LRRTLQIMSHITTENISAM-LLSLDAEKAFDSVGWDYLYQVLARFGFNNKFIECIKGLYLSPKAKIKINGHLSKTIYLERGTRQGCPLSPTLFALFIEPLAQAIRE 494          
BLAST of SMED30024728 vs. Ensembl Zebrafish
Match: CABZ01046949.1 (pep chromosome:GRCz11:12:37938792:37941733:-1 gene:ENSDARG00000086420.3 transcript:ENSDART00000130167.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01046949.1)

HSP 1 Score: 66.2402 bits (160), Expect = 9.564e-12
Identity = 64/227 (28.19%), Postives = 100/227 (44.05%), Query Frame = -3
Query:   59 FPTKFQMHFKLVLTQFLELILQNTRIGKKLIQML---NFCVFSSTL*LKLALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPD--GCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEK 724
            FP++F   F   L+  L   LQN      + +     N CV            L   +  +  +SYRPI++  T  +I AKVL  R        ++L K    +I PD  G  +  +   ++R + N  N+ +      L L  LD   AF  +    L+ TL K  L    +   + LY + K+  V N ++S P  + +G +QGCPLS  LF L I+ + + I +
Sbjct:   12 FPSEFYKSFWPELSNILVPALQNILDQGTIPETWKTANICVI-----------LKKDKDPQDCASYRPISLLNTDSKILAKVLACRL------ESMLPK----LIKPDQTGFIKSRYGTDNIRRLLNVINFVQGEGHPALVLS-LDADKAFDRVEWDFLFATLNKFNLGNNFIKWIQLLYSDPKATVVTNGLTSTPFRIGRGTRQGCPLSPLLFALVIEPLAELIRQ 216          
BLAST of SMED30024728 vs. Ensembl Xenopus
Match: tlr2 (toll like receptor 2 [Source:Xenbase;Acc:XB-GENE-481145])

HSP 1 Score: 78.9518 bits (193), Expect = 8.909e-16
Identity = 56/173 (32.37%), Postives = 88/173 (50.87%), Query Frame = -3
Query:   62 LFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIE 580
            + L  G     + ++RPIA+  T  +I AKV+  R   + +   LLS SQ   +   G S  + ++  +RE+  R    +  K    +L  LD + AF  + H+ LW  L++ GL    +N  K LY   +S  + N  S +   V+ GV+QGCPLS  L+  +ID + +RIE
Sbjct:  500 ILLTKGLDQSKVENWRPIALLNTDRKILAKVMFNRLFPFAER--LLSPSQHCTVK--GRSTFSAVL-GIREVLERCRICEWGK----YLLTLDQSKAFDRVNHEYLWLLLDRYGLPGKFVNWLKILYKGAESFPLVNGWSGESFGVSSGVRQGCPLSPLLYVFAIDPLIRRIE 663          
BLAST of SMED30024728 vs. Ensembl Xenopus
Match: cdkn2d (cyclin-dependent kinase inhibitor 2D [Source:Xenbase;Acc:XB-GENE-483786])

HSP 1 Score: 78.1814 bits (191), Expect = 1.384e-15
Identity = 56/173 (32.37%), Postives = 89/173 (51.45%), Query Frame = -3
Query:   62 LFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIE 580
            + L+ G     + ++RPIA+  T  +I AKV+  R   + +   LLS SQ   +   G S  + ++  +RE+  R    +  K    +L  LD + AF  + H+ LW  L++ GL    +N  K LY   +S  + N  S +   V+ GV+QGCPLS  L+  +ID + +RIE
Sbjct:  500 ILLSKGLDQSKVENWRPIALLNTDRKILAKVMFNRLFPFAER--LLSPSQHCTVK--GRSTFSAVL-GIREVLERCRICEWGK----YLLTLDQSKAFDRVNHEYLWLLLDRYGLPGKFVNWLKILYKGAESFPLVNGWSGESFGVSSGVRQGCPLSPLLYVFAIDPLIRRIE 663          
BLAST of SMED30024728 vs. Ensembl Xenopus
Match: atp6v0d2 (ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 [Source:Xenbase;Acc:XB-GENE-957143])

HSP 1 Score: 78.1814 bits (191), Expect = 1.389e-15
Identity = 56/173 (32.37%), Postives = 89/173 (51.45%), Query Frame = -3
Query:   62 LFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIE 580
            + L+ G     + ++RPIA+  T  +I AKV+  R   + +   LLS SQ   +   G S  + ++  +RE+  R    +  K    +L  LD + AF  + H+ LW  L++ GL    +N  K LY   +S  + N  S +   V+ GV+QGCPLS  L+  +ID + +RIE
Sbjct:  348 ILLSKGLDQSKVENWRPIALLNTDRKILAKVMFNRLFPFAER--LLSPSQHCTVK--GRSTFSAVL-GIREVLERCRICEWGK----YLLTLDQSKAFDRVNHEYLWLLLDRYGLPGKFVNWLKILYKGAESFPLVNGWSGESFGVSSGVRQGCPLSPLLYVFAIDPLIRRIE 511          
BLAST of SMED30024728 vs. Ensembl Xenopus
Match: ENSXETT00000032562.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:9615533:9618922:1 gene:ENSXETG00000008387.1 transcript:ENSXETT00000032562.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 1.419e-15
Identity = 56/173 (32.37%), Postives = 89/173 (51.45%), Query Frame = -3
Query:   62 LFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIE 580
            + L+ G     + ++RPIA+  T  +I AKV+  R   + +   LLS SQ   +   G S  + ++  +RE+  R    +  K    +L  LD + AF  + H+ LW  L++ GL    +N  K LY   +S  + N  S +   V+ GV+QGCPLS  L+  +ID + +RIE
Sbjct:  500 ILLSKGLDQSKVENWRPIALLNTDRKILAKVMFNRLFPFAER--LLSPSQHCTVK--GRSTFSAVL-GIREVLERCRICEWGK----YLLTLDQSKAFDRVNHEYLWLLLDRYGLPGKFVNWLKILYKGAESFPLVNGWSGESFGVSSGVRQGCPLSPLLYVFAIDPLIRRIE 663          
BLAST of SMED30024728 vs. Ensembl Xenopus
Match: ctsf (cathepsin F [Source:Xenbase;Acc:XB-GENE-5876529])

HSP 1 Score: 78.1814 bits (191), Expect = 1.750e-15
Identity = 56/173 (32.37%), Postives = 88/173 (50.87%), Query Frame = -3
Query:   62 LFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIE 580
            + L  G     + ++RPIA+  T  +I AKV+  R   + +   LLS SQ   +   G S  + ++  +RE+  R    +  K    +L  LD + AF  + H+ LW  L++ GL    +N  K LY   +S  + N  S +   V+ GV+QGCPLS  L+  +ID + +RIE
Sbjct:  498 ILLTKGLDQSKVENWRPIALLNTDRKILAKVMFNRLFPFAER--LLSPSQHCTVK--GRSTFSAVL-GIREVLERCRICEWGK----YLLTLDQSKAFDRVNHEYLWLLLDRYGLPGKFVNWLKILYKGAESFPLVNGWSGESFGVSSGVRQGCPLSPLLYVFAIDPLIRRIE 661          
BLAST of SMED30024728 vs. UniProt/SwissProt
Match: sp|Q03278|PO21_NASVI (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Nasonia vitripennis OX=7425 PE=4 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 5.727e-10
Identity = 46/181 (25.41%), Postives = 87/181 (48.07%), Query Frame = -3
Query:    2 SSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 544
            + +RP++I   + R F ++L  R    I    LL   Q+  I  DG +E+  +++++ +       + + K+  L++  LD+  AF S+ H+ +   L +  L +   N    +Y N K+         + I   +GV+QG PLS  LF   +D + +R+ + N  F +    + +L +AD
Sbjct:  387 ACFRPLSIASVALRHFHRILANR----IGEHGLLDTRQRAFIVADGVAENTSLLSAMIK-------EARMKIKGLYIAILDVKKAFDSVEHRSILDALRRKKLPLEMRNYIMWVYRNSKTRLEVVKTKGRWIRPARGVRQGDPLSPLLFNCVMDAVLRRLPE-NTGFLMGAEKIGALVFAD 555          
BLAST of SMED30024728 vs. UniProt/SwissProt
Match: sp|P14381|YTX2_XENLA (Transposon TX1 uncharacterized 149 kDa protein OS=Xenopus laevis OX=8355 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.544e-8
Identity = 46/176 (26.14%), Postives = 76/176 (43.18%), Query Frame = -3
Query:   83 LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCS--------EHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSID 586
            L+L    G+ L+ I ++RP+++  T Y+I AK ++ R          L      +IHPD           ++ F+I  L     R           L    LD   AF  + H+ L  TL+        +   K +Y + + +   N   + P+   +GV+QGCPLS  L+ L+I+
Sbjct:  510 LSLLPKKGD-LRLIKNWRPVSLLSTDYKIVAKAISLR----------LKSVLAEVIHPDQSYTVPGRTIFDNVFLIRDLLHFARRTGL-------SLAFLSLDQEKAFDRVDHQYLIGTLQAYSFGPQFVGYLKTMYASAECLVKINWSLTAPLAFGRGVRQGCPLSGQLYSLAIE 667          
BLAST of SMED30024728 vs. UniProt/SwissProt
Match: sp|P16423|POLR_DROME (Retrovirus-related Pol polyprotein from type-2 retrotransposable element R2DM OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.404e-7
Identity = 50/200 (25.00%), Postives = 87/200 (43.50%), Query Frame = -3
Query:    2 LKLALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRF---IGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 592
            L   +F+      K    +RPI++     R    +L  R    I W          Q+G +  DGC+++  I+    ++  R ++K        ++  LD++ AF SL H  ++ TL   G     ++  +N Y    +    +  SS+  +  +GVKQG PLS  LF L +D + + +        + N   N+ A+AD
Sbjct:  397 LARTVFIPKTVTAKRPQDFRPISVPSVLVRQLNAILATRLNSSINW-------DPRQRGFLPTDGCADNATIV----DLVLRHSHKH---FRSCYIANLDVSKAFDSLSHASIYDTLRAYGAPKGFVDYVQNTYEGGGTSLNGDGWSSEEFVPARGVKQGDPLSPILFNLVMDRLLRTLPS-EIGAKVGNAITNAAAFAD 581          
BLAST of SMED30024728 vs. UniProt/SwissProt
Match: sp|Q03274|PO22_POPJA (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Popillia japonica OX=7064 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.699e-7
Identity = 52/201 (25.87%), Postives = 98/201 (48.76%), Query Frame = -3
Query:   83 LQNTRIGKKLIQM--LNFCVFSSTL*LKLALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFI----ITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLN-LFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSID 664
            +  TR+ +  +Q+  L   V +    ++  L   +G+ L++ S++RPI I     R+  ++L +R    ++    L  +QKG    DG   ++ +    I+S RE   RK Y         ++  LD+  AF ++ H  +   L+++G++  T N +  +L  +  ++ V     ++ I + +GVKQG PLS  LF   +D
Sbjct:   33 ITRTRLPRNFVQLHLLRGHVPTPWTAMRTTLIPKDGD-LENPSNWRPITIASALQRLLHRILAKRLEAAVE----LHPAQKGYARIDGTLVNSLLLDTYISSRRE--QRKTY---------NVVSLDVRKAFDTVSHSSICRALQRLGIDEGTSNYITGSLSDSTTTIRVGPGSQTRKICIRRGVKQGDPLSPFLFNAVLD 217          
BLAST of SMED30024728 vs. UniProt/SwissProt
Match: sp|P11369|LORF2_MOUSE (LINE-1 retrotransposable element ORF2 protein OS=Mus musculus OX=10090 GN=Pol PE=1 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 6.303e-7
Identity = 45/168 (26.79%), Postives = 74/168 (44.05%), Query Frame = -3
Query:   59 ISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIIT-----SLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEK 547
            I ++RPI++     +I  K+L           N + +  K IIHPD      FI       ++R+  N  +Y  K K     +  LD   AF  + H  +   LE+ G+    LN+ K +Y    +    N    + I +  G +QGCPLS  LF + ++ + + I +
Sbjct:  534 IENFRPISLMNIDAKILNKIL----------ANRIQEHIKAIIHPDQVG---FIPGMQGWFNIRKSINVIHYINKLKDKNHMIISLDAEKAFDKIQHPFMIKVLERSGIQGPYLNMIKAIYSKPVANIKVNGEKLEAIPLKSGTRQGCPLSPYLFNIVLEVLARAIRQ 688          
BLAST of SMED30024728 vs. TrEMBL
Match: A0A2A2JLL3 (Reverse transcriptase domain-containing protein OS=Diploscapter pachys OX=2018661 GN=WR25_19835 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 4.370e-32
Identity = 61/182 (33.52%), Postives = 103/182 (56.59%), Query Frame = -3
Query:    2 ISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 547
            I ++RPIA+  T  ++++  L RR + W      LS +QKG I   GC+EHNF + ++  + + + +++      + + +LDLA+AFGSLPH  L+  LE  GL+ T +   + LY    +       ++ PI V  GV QG PLS  LF L+I+ + +  +K +  +++   +++ LAYAD
Sbjct:  441 IGNWRPIALASTMGKLYSACLARRLLTWSSAHQRLSPAQKGFISVPGCTEHNFTLQTV--IADARRHRRN-----IAVAWLDLANAFGSLPHSALFDALEWTGLDQTAIGRIRELYTGTTTSVRTATGTTAPIPVEAGVLQGSPLSPILFNLAIEPMLRAAQKSSAGYSLYGHSVSVLAYAD 615          

HSP 2 Score: 51.6026 bits (122), Expect = 4.370e-32
Identity = 33/132 (25.00%), Postives = 53/132 (40.15%), Query Frame = -2
Query:  540 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENI------------------SIPVMDFDIYIP---HEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFL 872
             ++ L+    K AF ++T D+    +I   ++E +F+ I                   +P     +  P    E+ +  + SSDT PG D  +YS W+  DP    L   FN +      P  W+T  T  L
Sbjct:  301 RIQRLWRTNRKRAFREVTGDSSPGCTIDKADVESHFKQIHAVGSSLNPTPTPIPDPLPLPTNRNPLQPPFTSDEVWERLRRSSDTAPGPDALRYSHWRRFDPHSHILAAAFNAVHRLSHAPSNWKTSTTVLL 432          
BLAST of SMED30024728 vs. TrEMBL
Match: A0A2A2KBG9 (Reverse transcriptase domain-containing protein OS=Diploscapter pachys OX=2018661 GN=WR25_21044 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.656e-31
Identity = 60/182 (32.97%), Postives = 104/182 (57.14%), Query Frame = -3
Query:    2 ISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 547
            I ++RPI++  T  ++++  L RR + W      LS +QKG I   GC+EHNF + ++  + + + +++      + + +LDLA+AFGSLPH  L+  LE  GL+ T ++  + LY    +       ++ PI V  GV QG PLS  LF L+I+ + +  +K +  +++   +++ LAYAD
Sbjct:  386 IGNWRPISLASTMGKLYSACLARRLLTWSSAHQRLSPAQKGFISVPGCTEHNFPLQTV--IADARRHRRN-----IAVAWLDLANAFGSLPHSALFDALEWTGLDRTAISRIRELYTGTTTSVRTATGTTAPIPVEAGVLQGSPLSPILFNLAIEPMLRAAQKSSAGYSLYGHSVSVLAYAD 560          

HSP 2 Score: 51.6026 bits (122), Expect = 1.656e-31
Identity = 33/132 (25.00%), Postives = 53/132 (40.15%), Query Frame = -2
Query:  540 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENI----------SIPVMDFDI-----------YIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFL 872
             ++ L+    K AF ++T D+    +I   ++E +F+ I            P+ D              +   E+ +  + SSDT PG D  +YS W+  DP    L   FN +      P  W+T  T  L
Sbjct:  246 RIQRLWRTNRKRAFREVTGDSSPGCTIDKADVENHFKQIHAVGSSLNPTPTPIPDPLPLPTNPNPLQPPFTSDEVWERLRRSSDTAPGPDALRYSHWRRFDPHSHILAAAFNAVHRLSHAPSNWKTSTTVLL 377          
BLAST of SMED30024728 vs. TrEMBL
Match: A0A4Y2CJ97 (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 OS=Araneus ventricosus OX=182803 GN=PO21_19 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.118e-31
Identity = 59/181 (32.60%), Postives = 95/181 (52.49%), Query Frame = -3
Query:    2 YRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLC--YLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 538
            +RPIA+  T Y++F K L  R   W +  ++LSK QKG    DG  EHN+++         KN+    +  +  +C  +LD+ +AFGS+PH+ ++  L + G  +    L  ++Y N  +  + +   +K I V  GVKQGCP+S  +F + ID I + ++  N    I       LA+AD
Sbjct:  412 WRPIALSSTMYKMFTKCLAARLSAWCERYDVLSKCQKGFTPHDGVIEHNYVL---------KNFLDSARKDKTDVCIEWLDVTNAFGSIPHEAIFEMLSRSGAGLPFTELIHDIYSNSSTKILSDGGLTKDIPVLSGVKQGCPISGLIFDMCIDPIIRGVQAENRSHKI-------LAFAD 576          

HSP 2 Score: 63.929 bits (154), Expect = 2.118e-31
Identity = 38/128 (29.69%), Postives = 55/128 (42.97%), Query Frame = -2
Query:  528 LFDKKPKAAFDKITIDTIEHLSISLDNIEENFENI-----------------SIPVMDFDIYIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 860
            LF K P+ A   IT    E   I +  +E +F N+                  +P++D    +  E+    Q +++T PG D   YSDWK I   V+FL  +FN  +    IP  W+T  T  L  S 
Sbjct:  278 LFKKNPRKAVRAITKTDGERCKIPISTLEAHFSNVWGPSGFSPDFFRQCDDNRVPLLDTPFTV-REVKTKLQNAANTSPGPDRITYSDWKTIPASVKFLVTVFNACVHFRRIPPSWKTSTTVLLPKSG 404          
BLAST of SMED30024728 vs. TrEMBL
Match: A0A4Y2MDL3 (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 OS=Araneus ventricosus OX=182803 GN=PO21_38 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.354e-30
Identity = 53/181 (29.28%), Postives = 97/181 (53.59%), Query Frame = -3
Query:    2 SSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 544
            +++RPIA+  T Y++F K L  R   W +  ++LSK QKG    DG  EHN+++ +  +   R          ++ + +LD+ +AFGS+PH+ ++  L + G  +    L +++Y N  +  + +   ++ I +  GVKQGCP+S  +F + ID + + ++  N    +       LA+AD
Sbjct: 1176 NNWRPIALSSTMYKMFTKCLAARLSAWCERYDVLSKCQKGFTPHDGVIEHNYVLKNFLDSARRDK-------TDVCIAWLDVTNAFGSIPHEAIFEMLSRSGAGLPFTELIRDIYSNSSTKILSDGGLTRDIPILSGVKQGCPISGIIFDMCIDPVIRGVQAENQSHKV-------LAFAD 1342          

HSP 2 Score: 61.6178 bits (148), Expect = 1.354e-30
Identity = 39/132 (29.55%), Postives = 58/132 (43.94%), Query Frame = -2
Query:  528 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENI-----------------SIPVMDFDIYIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 872
            +L+ LF K P+ A   IT    E   I L  +E++F N+                  + ++D    +  EI    Q +++T PG D   Y+DWK I   V+FL  +FN  +    IP  W+T  T  L  S 
Sbjct: 1040 SLQILFKKNPRKAVRAITKTDGERCKIPLSTLEDHFNNVWGPSEFRPDFYRQCEDGRVALLDTPFTV-KEIKVKLQNAANTSPGPDRITYADWKTIPASVKFLVTVFNACVHFQRIPPSWKTSTTVLLPKSG 1170          
BLAST of SMED30024728 vs. TrEMBL
Match: A0A4Y2WJK9 (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 OS=Araneus ventricosus OX=182803 GN=PO21_26 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.732e-30
Identity = 53/181 (29.28%), Postives = 96/181 (53.04%), Query Frame = -3
Query:    2 SSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 544
            +++RPIA+  T Y++F K L  R   W +  ++LSK QKG    DG  EHN+++ +  +   R          ++ + +LD+ +AFGS+PH  ++  L + G  +    L +++Y N  +  + +   ++ I +  GVKQGCP+S  +F + ID + + ++  N    +       LA+AD
Sbjct: 1161 NNWRPIALSSTMYKMFTKCLAARLSAWCERYDVLSKCQKGFTPHDGVIEHNYVLKNFLDSARRDK-------TDVCIAWLDVTNAFGSIPHDAIFEMLSRSGAGLPFTELIRDIYSNSTTKILSDGGLTRDIPILSGVKQGCPISGIIFDMCIDPVIRGVQAENQSHKV-------LAFAD 1327          

HSP 2 Score: 62.003 bits (149), Expect = 1.732e-30
Identity = 39/132 (29.55%), Postives = 58/132 (43.94%), Query Frame = -2
Query:  528 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENF-----------------ENISIPVMDFDIYIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 872
            +L+ LF K P+ A   IT    E   I L  +E++F                 E   +P++D    +  E+    Q +++T PG D   Y+DWK I   V+FL  +FN  +    IP  W+T  T  L  S 
Sbjct: 1025 SLQILFKKNPRKAVRAITKTDGERCKIPLSTLEDHFTTVWGPSEFCPDFFRQCEEGRVPLLDTPFTV-KEVKIKLQNAANTSPGPDRITYADWKTIPASVKFLVTVFNACVHFQRIPPSWKTSTTVLLPKSG 1155          
BLAST of SMED30024728 vs. Ensembl Cavefish
Match: ENSAMXT00000034560.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000712.1:195631:202616:-1 gene:ENSAMXG00000042811.1 transcript:ENSAMXT00000034560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 6.314e-16
Identity = 49/187 (26.20%), Postives = 98/187 (52.41%), Query Frame = -3
Query:    2 ERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 562
            E L+ + ++RPI I     R+F+K++  R    +     ++  Q+G I   GC+E      +L+ +     + KK + ++L + ++D A AF S+ H+ +   L +  L+   + L ++ Y++C +  + +   S  I++  GVKQG  +S  LF L++D + + +E     + I   ++ +LA+AD
Sbjct:  496 EALEEVGNWRPITIGSLILRLFSKIMAER----LARACPINPRQRGFISAPGCAE------NLKVLQGLIGHCKKER-SQLAVVFVDFARAFDSISHEHILSALGQRQLDQHVIKLIQSAYVDCVTRIIMDGAKSPDILMKVGVKQGDSMSPILFNLAMDPLIQSLENLGSGYKIGGSSVTTLAFAD 671          
BLAST of SMED30024728 vs. Ensembl Cavefish
Match: ENSAMXT00000034831.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:16211297:16215948:1 gene:ENSAMXG00000034228.1 transcript:ENSAMXT00000034831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 2.211e-15
Identity = 46/161 (28.57%), Postives = 79/161 (49.07%), Query Frame = -3
Query:   71 ISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKS--QKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFK 547
            I  +RPI++     +IF  V+ RR   ++K  NL+  S  + GI    GC EHN +I    ++   +  KK     +LH+ +LDLA+AFGS+PH LLW       +      L K  + + +  +      +    +  G+  GC +S+  F ++++ I +
Sbjct:  444 IDQFRPISLLNVEGKIFFSVVARRLATYLKRNNLIDTSVQKAGIAGFSGCIEHNSMI--WHQIQTARAEKK-----DLHVVFLDLANAFGSVPHALLWKAFNFFRVPEEISRLVKAYFEDIQFCFSVGECVTSWQRLEIGIMAGCTISLLAFTMAMEVIIR 597          

HSP 2 Score: 28.4906 bits (62), Expect = 2.211e-15
Identity = 14/41 (34.15%), Postives = 23/41 (56.10%), Query Frame = -2
Query:  564 TVPGTDTTKYSDWKEIDPDV-EFLCFLFNFIIETGLIPEQW 683
            + PG +   Y  +K   PDV +FL  L   + + G+IP++W
Sbjct:  388 SAPGPNGVPYRSYKSA-PDVLKFLWKLMAIVWKKGIIPKEW 427          
BLAST of SMED30024728 vs. Ensembl Cavefish
Match: ENSAMXT00000048276.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:7857318:7859867:1 gene:ENSAMXG00000040121.1 transcript:ENSAMXT00000048276.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 4.330e-15
Identity = 50/176 (28.41%), Postives = 83/176 (47.16%), Query Frame = -3
Query:   59 LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEK 586
            ++L L  G+     SSYRP+++  T  ++FAKVL +R    I +  L+   Q G I     S++      LR + +   +     L    L  LD   AF  L    LW  L++ G     +++   LY N  +     HM S   ++ +G +QGCPLS  LF L+++ + + + +
Sbjct:  515 ISLLLKPGKDSTECSSYRPLSLLNTDVKVFAKVLAKRLDSVIPD--LIHSDQTGFIRSRLASDN------LRRLFHILEFAPSQMLGSAVLS-LDAEKAFDRLEWPFLWAVLKRFGFGSAFIHMIFTLYTNPSACVSTGHMISAKFLLERGTRQGCPLSPFLFALAVEPLAQAVRQ 681          
BLAST of SMED30024728 vs. Ensembl Cavefish
Match: ENSAMXT00000033573.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:31407009:31410218:-1 gene:ENSAMXG00000030324.1 transcript:ENSAMXT00000033573.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.404e-14
Identity = 51/167 (30.54%), Postives = 86/167 (51.50%), Query Frame = -3
Query:   62 KHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKS--QKGIIHPDGCSEHNFIITSL-REMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIE 553
            K+I  +R I++     +IF  +L RR   ++ + + +  S  + GI    GC EH  ++T L RE        ++NK  +L + +LDLA+A+GS+PHKL+  TLE+  +      L  N Y           ++S+   V  G+  GC +S+ LF L+++ + K  E
Sbjct:  327 KNIDQFRIISLLSVEGKIFFSILARRLTDFLSSNHYIDTSVQKGGIPGVPGCLEHTGVVTQLIRE-------ARENK-GDLAVLWLDLANAYGSIPHKLVQTTLERHHVPGQVAELIMNYYDQFSMRVSTGSITSEWHRVEVGIITGCTISVILFVLAMNMLVKSAE 485          

HSP 2 Score: 26.1794 bits (56), Expect = 1.404e-14
Identity = 18/66 (27.27%), Postives = 27/66 (40.91%), Query Frame = -2
Query:  561 PVMDFDIYIP--HEISDAFQTS-SDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWR 749
            P  +FD   P   E+ D  + + S + PG     Y  +K     +E L  +   I   G +  QWR
Sbjct:  248 PTKEFDGREPLLKEVQDVVKKARSSSAPGPSGVPYKVYKNCPLLLERLWKILKVIWRRGKVARQWR 313          
BLAST of SMED30024728 vs. Ensembl Cavefish
Match: ENSAMXT00000031340.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000052.1:450620:454069:1 gene:ENSAMXG00000031773.1 transcript:ENSAMXT00000031340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.446e-14
Identity = 50/183 (27.32%), Postives = 95/183 (51.91%), Query Frame = -3
Query:    2 SSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFN--PDFTIQNINLNSLAYAD 544
            ++YR I +     +IF  +LN R   ++   ++LSK+Q G +     S+H F + +L +    +N  K      +  C++D   AF S+ H  L++ L + G+   T ++ K++Y   K      ++ +     ++GV+QGC LS TLF L I+ + +++++ +  P  T+ +  +  L YAD
Sbjct:  573 NNYRGICVSSNLGKIFCSILNSRITQFLIEHDVLSKNQIGFLPNHRTSDHIFTLHTLIDKHVTQNKHK------IFTCFVDFQKAFDSIWHTGLFYKLIENGVGGRTYDVIKSMYSQSKCAVKIENLRTDFFPQSRGVRQGCSLSPTLFNLYINELAEKLDQSSNIPGLTLGDTEVKCLLYAD 749          
BLAST of SMED30024728 vs. Ensembl Medaka
Match: ENSORLT00000046723.1 (pep primary_assembly:ASM223467v1:1:20103273:20105072:1 gene:ENSORLG00000029093.1 transcript:ENSORLT00000046723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 3.221e-14
Identity = 52/195 (26.67%), Postives = 99/195 (50.77%), Query Frame = -3
Query:    2 LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 586
            L L+   G++L   +++R I +     ++F ++L  R +  I++       Q G +     ++H   I+++R +  +    +KN+   L++ ++DL  AF ++ H  LW  L+ +G+    ++LF  LY N +S    N   S    ++ GV+QGC  +  LF   ID +  R+ +  P+ ++ N +L  L YAD
Sbjct:   36 LPLWKGKGDKLT-CNNHRGITLLSIPGKLFTRILLNRALPAIRSSR--RPEQAGFMPNRSTTDH---ISAVRLLIEKTYEFRKNR--HLYMVFIDLKAAFDTVCHTSLWNILKTLGVPSKIVSLFGLLYSNAESCVRVNGKDSDWFPISSGVRQGCVAAPDLFNCIIDQLMSRVCEQVPEVSLGNYHLTDLEYAD 222          

HSP 2 Score: 24.2534 bits (51), Expect = 3.221e-14
Identity = 9/21 (42.86%), Postives = 14/21 (66.67%), Query Frame = -2
Query:  564 VEFLCFLFNFIIETGLIPEQW 626
            +E+L  +FN + E+G IP  W
Sbjct:   10 IEWLTNIFNEVWESGKIPRDW 30          
BLAST of SMED30024728 vs. Ensembl Medaka
Match: ENSORLT00000041934.1 (uncharacterized LOC111947977 [Source:NCBI gene;Acc:111947977])

HSP 1 Score: 72.0182 bits (175), Expect = 1.136e-13
Identity = 49/180 (27.22%), Postives = 87/180 (48.33%), Query Frame = -3
Query:    2 SYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 541
            +YR I++  T Y++F+ +LN R   +++   +L + Q G      C ++ ++++S+     +++           +C++D   AF S+   LL + L   G+N       K LY    +    N + +       GVKQG  LS TLF + ++ + + I+K N    I N NL+ L YAD
Sbjct:  570 NYRGISLLSTVYKVFSSILNNRLSEYLETNEVLVEEQNGFRRNRACIDNIYVLSSVVRARLQES-------KSTFVCFVDFKKAFDSIDRDLLQYKLLTYGINGQFYKAIKALYKAPLACVQVNDLKTGWFSTPFGVKQGDVLSPTLFSIYVNDLAQEIKKTNLGIDINNWNLSILLYAD 742          
BLAST of SMED30024728 vs. Ensembl Medaka
Match: ENSORLT00000046161.1 (pep primary_assembly:ASM223467v1:22:28139811:28142522:-1 gene:ENSORLG00000027405.1 transcript:ENSORLT00000046161.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.978e-12
Identity = 58/190 (30.53%), Postives = 83/190 (43.68%), Query Frame = -3
Query:   23 LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPD--GCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINL 586
            + L L  G+     SSYRPI++     +I  K L  R          L K    +IHPD  G  +     T++R + N  +Y   N   E  +  LD   AF  +  K L  TL K G   + +N  K LY +  +    N  +S    + +G +QGCPLS +LF L I+ +   I +      IQ  NL
Sbjct:  331 IILLLKPGKDPTSPSSYRPISLINADLKIICKALAGR----------LEKVVPSLIHPDQTGFIKGRHSSTNMRRLINLIDYTTTNN-REATILSLDAEKAFDRVNWKFLIATLNKFGFGKSFINWIKILYASPNARIRTNDQTSPSFNLQRGTRQGCPLSPSLFALFIEPLAAAIRQSRDIEGIQTKNL 509          
BLAST of SMED30024728 vs. Ensembl Medaka
Match: ENSORLT00000034407.1 (pep primary_assembly:ASM223467v1:14:1941665:1943152:-1 gene:ENSORLG00000028706.1 transcript:ENSORLT00000034407.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 3.607e-12
Identity = 58/190 (30.53%), Postives = 83/190 (43.68%), Query Frame = -3
Query:   23 LALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPD--GCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINL 586
            + L L  G+     SSYRPI++     +I  K L  R          L K    +IHPD  G  +     T++R + N  +Y   N   E  +  LD   AF  +  K L  TL K G   + +N  K LY +  +    N  +S    + +G +QGCPLS +LF L I+ +   I +      IQ  NL
Sbjct:   50 IILLLKPGKDPTSPSSYRPISLINADLKIICKALAGR----------LEKVVPSLIHPDQTGFIKGRHSSTNMRRLINLIDYTTINN-REATILSLDAEKAFDRVNWKFLIATLNKFGFGKSFINWIKILYASPNARIRTNDQTSPSFNLQRGTRQGCPLSPSLFALFIEPLAAAIRQSRDIEGIQTKNL 228          
BLAST of SMED30024728 vs. Ensembl Medaka
Match: ENSORLT00000038606.1 (pep primary_assembly:ASM223467v1:17:20000729:20001868:1 gene:ENSORLG00000029683.1 transcript:ENSORLT00000038606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.623e-12
Identity = 45/170 (26.47%), Postives = 81/170 (47.65%), Query Frame = -3
Query:   68 FLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKR 577
                G+R +  S+YR I +     +++A+VL RR +  ++    + + Q G     G  +  + ++ + E      Y        +H+C++DL  AF  +P  +LW  L + G+    L   ++LY   +S+       S   +V  G++Q CPLS+ LF + ID I +R
Sbjct:  199 LFRKGDR-RVCSNYRGITLLSLPGKVYARVLERRVLPIVEP--RIQEQQCGFRPGRGTVDQLYTLSRVLEGLWEFAYP-------VHMCFVDLEKAFDRVPRGILWRVLWEYGVRGALLRAVRSLYDRSRSLVRIAGRKSHLFLVQVGLRQVCPLSLVLFIVFIDRISRR 358          
BLAST of SMED30024728 vs. Planmine SMEST
Match: SMESG000074876.1 (SMESG000074876.1)

HSP 1 Score: 335.495 bits (859), Expect = 8.658e-133
Identity = 160/182 (87.91%), Postives = 172/182 (94.51%), Query Frame = -3
Query:    2 ISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 547
            ISSYRPIAI  TSYRIF KVLNRR +GWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKK+KLAELHLCYLDLADAFGSLPH+LLWFTL+K+GLN +TL LFKNLY +CKSV++ +HM+SKPI VTKGVKQGCPLSMTLFCLSIDFIFKRIEK NPDFT+QNINLNSLAYAD
Sbjct:  370 ISSYRPIAILDTSYRIFTKVLNRRLLGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKSKLAELHLCYLDLADAFGSLPHELLWFTLKKLGLNTSTLTLFKNLYTDCKSVFICDHMNSKPIKVTKGVKQGCPLSMTLFCLSIDFIFKRIEKLNPDFTLQNINLNSLAYAD 551          

HSP 2 Score: 157.532 bits (397), Expect = 8.658e-133
Identity = 81/129 (62.79%), Postives = 91/129 (70.54%), Query Frame = -2
Query:  528 LRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENISIPVMDFDIYIP---------------HEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 869
            LRDLFDKKPK AFDKIT+D  +HLSISLDNIEENFEN  IPV+D     P                EI  AFQ+SSDT PG+D+ KYSDW+EIDP+ EFL F FN+IIE GLIPEQWRTFKT  +I  N
Sbjct:  234 LRDLFDKKPKTAFDKITVDNNDHLSISLDNIEENFENKLIPVIDLASVFPIPYFAEDSMSSQMSAEEILLAFQSSSDTAPGSDSIKYSDWREIDPEFEFLTFFFNYIIEIGLIPEQWRTFKTLLIIKPN 362          
BLAST of SMED30024728 vs. Planmine SMEST
Match: SMESG000029188.1 (SMESG000029188.1)

HSP 1 Score: 327.02 bits (837), Expect = 2.110e-130
Identity = 156/182 (85.71%), Postives = 168/182 (92.31%), Query Frame = -3
Query:    2 ISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 547
            ISSYRPIAI  TSY IF KVLNRR +GWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKK+KLAELHLCYLDLADAFGSLPH+LLWFTL+ +GLN +TL LFKNLY +CKSV++ +HM+SKPI VTKGVKQGCPLSMTLFCLSIDFIFKRIE  NPDFT+QNINLNSL YAD
Sbjct:  921 ISSYRPIAILDTSYCIFTKVLNRRLLGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKSKLAELHLCYLDLADAFGSLPHELLWFTLKTLGLNTSTLTLFKNLYTDCKSVFICDHMNSKPIKVTKGVKQGCPLSMTLFCLSIDFIFKRIEILNPDFTLQNINLNSLEYAD 1102          

HSP 2 Score: 157.918 bits (398), Expect = 2.110e-130
Identity = 82/129 (63.57%), Postives = 91/129 (70.54%), Query Frame = -2
Query:  528 LRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENISIPVMDFDIYIP---------------HEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 869
            LRDLFDKKPK AFDKIT+D  +HLSISLDNIEENFEN  IPV+D     P                EI  AFQ+SSDT PG+D  KYSDW+EIDP+ EFL F FN+IIETGLIPEQWRTFKT  +I  N
Sbjct:  785 LRDLFDKKPKTAFDKITVDKNDHLSISLDNIEENFENKLIPVIDLASVFPIPYFAEDSISSQMSAEEILFAFQSSSDTAPGSDCIKYSDWREIDPEFEFLTFFFNYIIETGLIPEQWRTFKTLLIIKPN 913          

HSP 3 Score: 240.736 bits (613), Expect = 6.527e-72
Identity = 116/129 (89.92%), Postives = 121/129 (93.80%), Query Frame = -2
Query:  456 KAAFDKITIDTIEHLSISLDNIEENFENISIPVMDFDIYIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSNCNSCYELSYLCKSSKQTFYRLDQE 842
            KA+ + IT    +HLSISLDNIEENFEN+SIPV+DFDI IPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSNCNSCYELSYLCKSSKQT YRLDQE
Sbjct: 1409 KASHNIITSVNNKHLSISLDNIEENFENVSIPVIDFDICIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSNCNSCYELSYLCKSSKQTLYRLDQE 1537          

HSP 4 Score: 150.984 bits (380), Expect = 9.463e-41
Identity = 72/76 (94.74%), Postives = 75/76 (98.68%), Query Frame = -2
Query:  579 EHLSISLDNIEENFENISIPVMDFDIYIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGL 806
            +HLSISLDNIEENFEN+SIPV+DFDI IPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGL
Sbjct: 1545 KHLSISLDNIEENFENVSIPVIDFDICIPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGL 1620          

HSP 5 Score: 80.4925 bits (197), Expect = 1.508e-16
Identity = 40/58 (68.97%), Postives = 45/58 (77.59%), Query Frame = -3
Query:  470 KKLIQMLNFCVFSSTL*LKLALFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFI 643
            K++   + F  F     ++  LFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFI
Sbjct: 1599 KEIDPDVEFLCFLFNFIIETGLFLNNGERLKHISSYRPIAIHVTSYRIFAKVLNRRFI 1656          
BLAST of SMED30024728 vs. Planmine SMEST
Match: SMESG000074843.1 (SMESG000074843.1)

HSP 1 Score: 238.039 bits (606), Expect = 4.846e-108
Identity = 126/138 (91.30%), Postives = 129/138 (93.48%), Query Frame = -3
Query:  137 HISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTK 550
             ISSYRPIAI  TSYRIF KVLN R +GWIKNGNLLSK+QKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPH+LLWFTLEKMGLNITTLNLFKNLYLNCKSVYV NHMSSKPI V K
Sbjct:  492 EISSYRPIAILDTSYRIFTKVLNNRLLGWIKNGNLLSKAQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHELLWFTLEKMGLNITTLNLFKNLYLNCKSVYVCNHMSSKPINVAK 629          

HSP 2 Score: 172.555 bits (436), Expect = 4.846e-108
Identity = 88/130 (67.69%), Postives = 97/130 (74.62%), Query Frame = -2
Query:  528 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENISIPVMDFDIYIP---------------HEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 872
            NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFEN SIPV++     P                EI  AFQ+SSDT PG+D+ KYSDW+EIDP+ EFL F FN+IIETGLIPEQWRTFKT  +I  N
Sbjct:  356 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENKSIPVIELASVFPIPNFPEALLSSQMSAEEILFAFQSSSDTAPGSDSVKYSDWREIDPEFEFLTFFFNYIIETGLIPEQWRTFKTLLIIKPN 485          
BLAST of SMED30024728 vs. Planmine SMEST
Match: SMESG000029191.1 (SMESG000029191.1)

HSP 1 Score: 172.94 bits (437), Expect = 3.435e-63
Identity = 88/130 (67.69%), Postives = 97/130 (74.62%), Query Frame = -2
Query:  528 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENISIPVMDFDIYIP---------------HEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLISSN 872
            NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFEN SIPV++     P                EI  AFQ+SSDT PG+D+ KYSDW+EIDP+ EFL F FN+IIETGLIPEQWRTFKT  +I  N
Sbjct:  529 NLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENKSIPVIELASVFPIPNFPEALLSSQMSAEEILFAFQSSSDTAPGSDSVKYSDWREIDPEFEFLTFFFNYIIETGLIPEQWRTFKTLLIIKPN 658          

HSP 2 Score: 70.8626 bits (172), Expect = 3.435e-63
Identity = 33/41 (80.49%), Postives = 35/41 (85.37%), Query Frame = -3
Query:  428 HISSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQK 550
             ISSYRPIAI  TSYRIF KVLN R +GWIKNGNLLSK+QK
Sbjct:  665 EISSYRPIAILDTSYRIFTKVLNNRLLGWIKNGNLLSKAQK 705          

HSP 3 Score: 38.1206 bits (87), Expect = 3.435e-63
Identity = 19/20 (95.00%), Postives = 20/20 (100.00%), Query Frame = -1
Query:  373 KKVLFTLMDVVNITLSLQVL 432
            +KVLFTLMDVVNITLSLQVL
Sbjct:  704 QKVLFTLMDVVNITLSLQVL 723          
BLAST of SMED30024728 vs. Planmine SMEST
Match: SMESG000053822.1 (SMESG000053822.1)

HSP 1 Score: 179.104 bits (453), Expect = 2.702e-51
Identity = 91/181 (50.28%), Postives = 123/181 (67.96%), Query Frame = -3
Query:    2 SSYRPIAIHVTSYRIFAKVLNRRFIGWIKNGNLLSKSQKGIIHPDGCSEHNFIITSLREMTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLNLFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKRIEKFNPDFTIQNINLNSLAYAD 544
            SS+RP+AI  T+YRIFA +LN R + WIK GNL+S++QK I  PDGC+EH+    +L    +     KK    ELH+ +LD+ DAFGSLPH L+W+TLE MG+   T+ L K LY +  + +    M S+ + +TKGVKQGCPLSMTLFCLSID+I K +    P F + ++N++ LAYAD
Sbjct:  322 SSWRPLAIMDTAYRIFATLLNNRLLAWIKKGNLISQNQKAIGIPDGCAEHS---ATLHLAIDHARRMKK----ELHVVWLDITDAFGSLPHDLIWYTLEGMGMKKETVCLIKELYRDISTFFDCQGMISESVNITKGVKQGCPLSMTLFCLSIDYILKSVLIDCP-FHLHDMNISILAYAD 494          

HSP 2 Score: 41.9726 bits (97), Expect = 2.702e-51
Identity = 16/60 (26.67%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  534 ISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLIPEQWRTFKTHFLIS 713
            +S   +   +T PG D    +DWK I P    +  + N ++  G+ P++W+ F+T  ++ 
Sbjct:  252 MSHVMKQLDNTAPGMDLITVADWKIISPKHILITAICNNVLRNGVCPKKWKLFRTVLILK 311          
The following BLAST results are available for this feature:
BLAST of SMED30024728 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01033394.11.852e-1426.75pep chromosome:GRCz11:13:6032844:6038477:-1 gene:E... [more]
BX547930.43.280e-1427.64pep chromosome:GRCz11:20:12830448:12834749:1 gene:... [more]
CABZ01030017.14.375e-1228.04pep scaffold:GRCz11:KN150259.1:45362:50078:-1 gene... [more]
CU462878.35.891e-1227.11pep chromosome:GRCz11:17:8542203:8545189:1 gene:EN... [more]
CABZ01046949.19.564e-1228.19pep chromosome:GRCz11:12:37938792:37941733:-1 gene... [more]
back to top
BLAST of SMED30024728 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tlr28.909e-1632.37toll like receptor 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
cdkn2d1.384e-1532.37cyclin-dependent kinase inhibitor 2D [Source:Xenba... [more]
atp6v0d21.389e-1532.37ATPase, H+ transporting, lysosomal 38kDa, V0 subun... [more]
ENSXETT00000032562.11.419e-1532.37pep primary_assembly:Xenopus_tropicalis_v9.1:9:961... [more]
ctsf1.750e-1532.37cathepsin F [Source:Xenbase;Acc:XB-GENE-5876529][more]
back to top
BLAST of SMED30024728 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03278|PO21_NASVI5.727e-1025.41Retrovirus-related Pol polyprotein from type-1 ret... [more]
sp|P14381|YTX2_XENLA1.544e-826.14Transposon TX1 uncharacterized 149 kDa protein OS=... [more]
sp|P16423|POLR_DROME1.404e-725.00Retrovirus-related Pol polyprotein from type-2 ret... [more]
sp|Q03274|PO22_POPJA1.699e-725.87Retrovirus-related Pol polyprotein from type-1 ret... [more]
sp|P11369|LORF2_MOUSE6.303e-726.79LINE-1 retrotransposable element ORF2 protein OS=M... [more]
back to top
BLAST of SMED30024728 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2A2JLL34.370e-3233.52Reverse transcriptase domain-containing protein OS... [more]
A0A2A2KBG91.656e-3132.97Reverse transcriptase domain-containing protein OS... [more]
A0A4Y2CJ972.118e-3132.60Retrovirus-related Pol polyprotein from type-1 ret... [more]
A0A4Y2MDL31.354e-3029.28Retrovirus-related Pol polyprotein from type-1 ret... [more]
A0A4Y2WJK91.732e-3029.28Retrovirus-related Pol polyprotein from type-1 ret... [more]
back to top
BLAST of SMED30024728 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034560.16.314e-1626.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034831.12.211e-1528.57pep primary_assembly:Astyanax_mexicanus-2.0:3:1621... [more]
ENSAMXT00000048276.14.330e-1528.41pep primary_assembly:Astyanax_mexicanus-2.0:17:785... [more]
ENSAMXT00000033573.11.404e-1430.54pep primary_assembly:Astyanax_mexicanus-2.0:3:3140... [more]
ENSAMXT00000031340.11.446e-1427.32pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30024728 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024728 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046723.13.221e-1426.67pep primary_assembly:ASM223467v1:1:20103273:201050... [more]
ENSORLT00000041934.11.136e-1327.22uncharacterized LOC111947977 [Source:NCBI gene;Acc... [more]
ENSORLT00000046161.11.978e-1230.53pep primary_assembly:ASM223467v1:22:28139811:28142... [more]
ENSORLT00000034407.13.607e-1230.53pep primary_assembly:ASM223467v1:14:1941665:194315... [more]
ENSORLT00000038606.13.623e-1226.47pep primary_assembly:ASM223467v1:17:20000729:20001... [more]
back to top
BLAST of SMED30024728 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074876.18.658e-13387.91SMESG000074876.1[more]
SMESG000029188.12.110e-13085.71SMESG000029188.1[more]
SMESG000074843.14.846e-10891.30SMESG000074843.1[more]
SMESG000029191.13.435e-6367.69SMESG000029191.1[more]
SMESG000053822.12.702e-5150.28SMESG000053822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024728 ID=SMED30024728|Name=SMED30024728|organism=Schmidtea mediterranea sexual|type=transcript|length=876bp
CATCTGCATAAGCCAGAGAGTTTAGATTAATATTTTGTATTGTAAAGTCT
GGGTTAAACTTTTCGATCCGCTTGAAAATAAAATCTATTGAAAGGCAGAA
CAGAGTCATTGACAGAGGACATCCTTGCTTAACACCTTTTGTTACAATAA
TTGGTTTGGATGACATGTGATTGTATACATAAACACTTTTGCAGTTCAAG
TAAAGATTTTTGAAAAGATTTAAAGTCGTAATATTTAATCCCATCTTCTC
CAGAGTAAACCAAAGAAGTTTATGCGGTAATGAGCCAAAAGCATCTGCTA
AATCTAAATAACACAAGTGTAATTCAGCTAGCTTATTTTTCTTTTTATAA
TTTTTTCTATTCGTCATTTCTCTAAGACTTGTAATGATAAAGTTATGTTC
ACTACATCCATCAGGGTGAATAATACCTTTTTGAGATTTGGAGAGCAGGT
TACCATTCTTGATCCAACCTATAAAACGTCTGTTTAGAACTTTTGCAAAG
ATACGATAACTCGTAACATGAATTGCAATTGGACGATATGAGGAAATGTG
TTTTAAACGTTCTCCATTGTTCAGGAATAAGGCCAGTTTCAATTATAAAG
TTGAAGAGAAAACACAGAAATTCAACATCTGGATCAATTTCTTTCCAATC
CGAGTATTTTGTAGTATCAGTTCCAGGAACTGTGTCAGAACTAGTTTGAA
ATGCATCTGAAATTTCGTGGGGAATATAGATGTCAAAGTCCATAACTGGA
ATCGATATATTTTCAAAGTTTTCTTCAATATTATCTAACGAGATGGACAA
ATGTTCAATAGTGTCAATTGTTATTTTATCAAAAGCAGCTTTTGGTTTTT
TATCAAATAAATCTCTCAAATTGTCG
back to top

protein sequence of SMED30024728-orf-1

>SMED30024728-orf-1 ID=SMED30024728-orf-1|Name=SMED30024728-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MTNRKNYKKKNKLAELHLCYLDLADAFGSLPHKLLWFTLEKMGLNITTLN
LFKNLYLNCKSVYVYNHMSSKPIIVTKGVKQGCPLSMTLFCLSIDFIFKR
IEKFNPDFTIQNINLNSLAYAD
back to top

protein sequence of SMED30024728-orf-2

>SMED30024728-orf-2 ID=SMED30024728-orf-2|Name=SMED30024728-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
DNLRDLFDKKPKAAFDKITIDTIEHLSISLDNIEENFENISIPVMDFDIY
IPHEISDAFQTSSDTVPGTDTTKYSDWKEIDPDVEFLCFLFNFIIETGLI
PEQWRTFKTHFLISSNCNSCYELSYLCKSSKQTFYRLDQEW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom