Bax inhibitor 1

Overview
NameBax inhibitor 1
Smed IDSMED30024727
Length (bp)781
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bax inhibitor 1 (SMED30024727) t-SNE clustered cells

Violin plots show distribution of expression levels for Bax inhibitor 1 (SMED30024727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30024727 Contig2134_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30024727 Contig2134_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30024727 Contig2134_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30024727 SMED_33929_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30024727 SMED_33929_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30024727 SMED_05911_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30024727 SMED_05911_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bax inhibitor 1 vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 147.132 bits (370), Expect = 9.528e-43
Identity = 97/217 (44.70%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V +V  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 147.132 bits (370), Expect = 9.528e-43
Identity = 97/217 (44.70%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V +V  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 147.132 bits (370), Expect = 9.528e-43
Identity = 97/217 (44.70%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V +V  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 147.132 bits (370), Expect = 9.528e-43
Identity = 97/217 (44.70%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V +V  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Human
Match: TMBIM6 (transmembrane BAX inhibitor motif containing 6 [Source:HGNC Symbol;Acc:HGNC:11723])

HSP 1 Score: 146.747 bits (369), Expect = 5.127e-42
Identity = 97/217 (44.70%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V +V  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:   67 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL 283          
BLAST of Bax inhibitor 1 vs. Ensembl Fly
Match: BI-1 (gene:FBgn0035871 transcript:FBtr0076711)

HSP 1 Score: 99.7525 bits (247), Expect = 7.250e-25
Identity = 82/226 (36.28%), Postives = 132/226 (58.41%), Query Frame = 1
Query:   43 ISNDFQTFFNF--DHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREE 714
            I++ FQTF N   D  +   +EHL KVY  L     + A+G+++ +  +   G LA + ++  +  L F     +N + R+  L  FGF SG  LGP +     INP I+ +A+  T   F S S++ALL +   YLY+GG L+S++  + ++++ N+ F S  V   +LY+G+ V    +++DTQ I+EK + G+ D + HALDL  + +S+FRR+LIIL  +EE
Sbjct:    8 INDRFQTFMNGLGDRYEPYVREHLSKVYMVLGSTAAATAMGAMLQMRDFLDLGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLFFDVLSMFRRLLIILTQKEE 233          
BLAST of Bax inhibitor 1 vs. Ensembl Fly
Match: BI-1 (gene:FBgn0035871 transcript:FBtr0076712)

HSP 1 Score: 94.3597 bits (233), Expect = 6.183e-23
Identity = 80/224 (35.71%), Postives = 130/224 (58.04%), Query Frame = 1
Query:   43 ISNDFQTFFNF--DHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNR 708
            I++ FQTF N   D  +   +EHL KVY  L     + A+G+++ +  +   G LA + ++  +  L F     +N + R+  L  FGF SG  LGP +     INP I+ +A+  T   F S S++ALL +   YLY+GG L+S++  + ++++ N+ F S  V   +LY+G+ V    +++DTQ I+EK + G+ D + HALDL  + +S+FRR+LIIL  +
Sbjct:    8 INDRFQTFMNGLGDRYEPYVREHLSKVYMVLGSTAAATAMGAMLQMRDFLDLGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHALDLFFDVLSMFRRLLIILTQK 231          
BLAST of Bax inhibitor 1 vs. Ensembl Zebrafish
Match: tegt (testis enhanced gene transcript (BAX inhibitor 1) [Source:ZFIN;Acc:ZDB-GENE-030826-10])

HSP 1 Score: 157.918 bits (398), Expect = 2.772e-47
Identity = 105/216 (48.61%), Postives = 149/216 (68.98%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F   F F  I +STQ+HL+ VYA+LA+  L A  GS + V      G L +LGS+A + +L  T  + Q    R+  L  F FF+G+GLGP +  +  I+P I+ TA L TS IF  F+++AL  + RSYL++GGTLM+ L +L++++I N+FFGSVL++K  LYLGL+V C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR+++I+L
Sbjct:    9 NFDALFKFSQISRSTQQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAMTPHSPQTEKKRLAILAAFAFFTGLGLGPLMDYAISIDPSIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVLLLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLVILL 224          
BLAST of Bax inhibitor 1 vs. Ensembl Zebrafish
Match: tegt (testis enhanced gene transcript (BAX inhibitor 1) [Source:ZFIN;Acc:ZDB-GENE-030826-10])

HSP 1 Score: 146.362 bits (368), Expect = 9.320e-43
Identity = 99/216 (45.83%), Postives = 143/216 (66.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F   F F  I +STQ+HL+ VYA+LA+  L A  GS + V      G L +LGS+A + +L  T  + Q    R+  L  F FF+G      + +   +  +I+ TA L TS IF  F+++AL  + RSYL++GGTLM+ L +L++++I N+FFGSVL++K  LYLGL+V C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR+++I+L
Sbjct:    9 NFDALFKFSQISRSTQQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAMTPHSPQTEKKRLAILAAFAFFTG------VCVCVCVLLRIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVLLLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLVILL 218          
BLAST of Bax inhibitor 1 vs. Ensembl Xenopus
Match: siah1 (siah E3 ubiquitin protein ligase 1 [Source:Xenbase;Acc:XB-GENE-1014415])

HSP 1 Score: 148.673 bits (374), Expect = 2.114e-43
Identity = 103/224 (45.98%), Postives = 153/224 (68.30%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL-MNREEN 717
            +F     F HI  STQ+HL++VY++ A+  L AA G+ V VV  + Q  +L+  GS+  + +LM T  T ++   R+  L  F FFSG+GLGP + +   INP I+PTA L T+ IF  FS++AL  + RS+L++GG LMS L LL++ ++ NL  GSVL++K+ +Y+GL+V C  VLFDTQLIIEK + GD DY+WH +DL ++ ++IFR++++IL MN +E 
Sbjct:    9 NFNALLKFSHISSSTQQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKKRLGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMSALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDFITIFRKLMVILAMNEKEK 232          
BLAST of Bax inhibitor 1 vs. Ensembl Xenopus
Match: siah1 (siah E3 ubiquitin protein ligase 1 [Source:Xenbase;Acc:XB-GENE-1014415])

HSP 1 Score: 144.05 bits (362), Expect = 9.692e-42
Identity = 101/215 (46.98%), Postives = 150/215 (69.77%), Query Frame = 1
Query:   79 HIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL-MNREEN 717
            HI  STQ+HL++VY++ A+  L AA G+ V VV  + Q  +L+  GS+  + +LM T  T ++   R+  L  F FFSG+GLGP + +   INP I+PTA L T+ IF  FS++AL  + RS+L++GG LMS L LL++ ++ NL  GSVL++K+ +Y+GL+V C  VLFDTQLIIEK + GD DY+WH +DL ++ ++IFR++++IL MN +E 
Sbjct:   11 HISSSTQQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKKRLGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMSALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDFITIFRKLMVILAMNEKEK 225          
BLAST of Bax inhibitor 1 vs. Ensembl Xenopus
Match: siah1 (siah E3 ubiquitin protein ligase 1 [Source:Xenbase;Acc:XB-GENE-1014415])

HSP 1 Score: 137.117 bits (344), Expect = 4.002e-39
Identity = 98/210 (46.67%), Postives = 147/210 (70.00%), Query Frame = 1
Query:   94 TQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL-MNREEN 717
            TQ+HL++VY++ A+  L AA G+ V VV  + Q  +L+  GS+  + +LM T  T ++   R+  L  F FFSG+GLGP + +   INP I+PTA L T+ IF  FS++AL  + RS+L++GG LMS L LL++ ++ NL  GSVL++K+ +Y+GL+V C  VLFDTQLIIEK + GD DY+WH +DL ++ ++IFR++++IL MN +E 
Sbjct:   17 TQQHLKRVYSSFAICMLVAAAGAYVNVVLKFLQGSFLSFAGSLGMMIWLMSTPHTYESEKKRLGILAGFAFFSGIGLGPALNLCIAINPSIIPTAFLGTAMIFICFSLSALYAQRRSFLFLGGILMSALSLLLLSSLVNLLVGSVLLFKMHMYIGLLVMCGFVLFDTQLIIEKAEQGDKDYVWHCVDLFLDFITIFRKLMVILAMNEKEK 226          
BLAST of Bax inhibitor 1 vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 145.976 bits (367), Expect = 1.700e-42
Identity = 102/223 (45.74%), Postives = 151/223 (67.71%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN 717
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+A + +LM T  + +    R+  L  F F +G+GLGP + +   +NP I+PTA + T+ IF  FS++AL  + RSYL++GG LMS + L+++ ++ NLFFGS+ +++  LYLGL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL   E++
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLILAFNEKD 231          
BLAST of Bax inhibitor 1 vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 143.665 bits (361), Expect = 1.410e-41
Identity = 101/217 (46.54%), Postives = 148/217 (68.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+A + +LM T  + +    R+  L  F F +G+GLGP + +   +NP I+PTA + T+ IF  FS++AL  + RSYL++GG LMS + L+++ ++ NLFFGS+ +++  LYLGL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 143.665 bits (361), Expect = 1.410e-41
Identity = 101/217 (46.54%), Postives = 148/217 (68.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+A + +LM T  + +    R+  L  F F +G+GLGP + +   +NP I+PTA + T+ IF  FS++AL  + RSYL++GG LMS + L+++ ++ NLFFGS+ +++  LYLGL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 143.665 bits (361), Expect = 1.410e-41
Identity = 101/217 (46.54%), Postives = 148/217 (68.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+A + +LM T  + +    R+  L  F F +G+GLGP + +   +NP I+PTA + T+ IF  FS++AL  + RSYL++GG LMS + L+++ ++ NLFFGS+ +++  LYLGL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Mouse
Match: Tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:MGI Symbol;Acc:MGI:99682])

HSP 1 Score: 143.665 bits (361), Expect = 1.410e-41
Identity = 101/217 (46.54%), Postives = 148/217 (68.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+A + +LM T  + +    R+  L  F F +G+GLGP + +   +NP I+PTA + T+ IF  FS++AL  + RSYL++GG LMS + L+++ ++ NLFFGS+ +++  LYLGL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLIL 225          
BLAST of Bax inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q9IA79|BI1_PAROL (Probable Bax inhibitor 1 OS=Paralichthys olivaceus OX=8255 GN=tmbim6 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.625e-44
Identity = 100/217 (46.08%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F + F F  I  STQ HL+ VY++LA+    AA GS V VV   +Q G L++LGS+  +F+L  T    +    R+  L  F F +G+GL P +     INP I+ TA L TS IF  F+++AL  K RSYL++GGTLMS L +L +M++ N+FFGSV+++K  +YLGL++ C  VL DTQLIIEK + GD DY+WH++DL ++ ++IFR++++IL
Sbjct:    9 NFDSLFKFSQISHSTQVHLKNVYSSLAVCMFVAAAGSYVHVVTRLFQGGMLSVLGSLGMMFWLAMTPHNSETEKKRLAILAGFAFLTGVGLCPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLMSMMNMFFGSVMLFKAHMYLGLLIMCGFVLXDTQLIIEKAENGDKDYVWHSVDLFLDFITIFRKLMVIL 225          
BLAST of Bax inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q5R7R1|BI1_PONAB (Bax inhibitor 1 OS=Pongo abelii OX=9601 GN=TMBIM6 PE=2 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 2.376e-42
Identity = 98/217 (45.16%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCITVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITLFRKLMMIL 225          
BLAST of Bax inhibitor 1 vs. UniProt/SwissProt
Match: sp|P55061|BI1_HUMAN (Bax inhibitor 1 OS=Homo sapiens OX=9606 GN=TMBIM6 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 4.576e-42
Identity = 97/217 (44.70%), Postives = 146/217 (67.28%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V +V  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP +     +NP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS L LL++ ++ N+FFGS+ +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ +++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL 225          
BLAST of Bax inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q0V882|BI1_BOVIN (Bax inhibitor 1 OS=Bos taurus OX=9913 GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.206e-41
Identity = 101/221 (45.70%), Postives = 149/221 (67.42%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNRE 711
            +F   F F HI  STQ+HL+KVYA+ AL    AA G+ + VV  + Q G L+ LGS+  + +LM T  + +    R+  L  F F +G+GLGP + +   INP I+PTA + T+ IF  F+++AL  + RSYL++GG LMS + L+++ ++ NLFFGSV +++  LY+GL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL   E
Sbjct:    9 NFDALFKFSHITPSTQQHLKKVYASFALCMFVAAAGAYIHVVTHFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSVWLFQANLYMGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTLFRKLMMILAMNE 229          
BLAST of Bax inhibitor 1 vs. UniProt/SwissProt
Match: sp|Q9D2C7|BI1_MOUSE (Bax inhibitor 1 OS=Mus musculus OX=10090 GN=Tmbim6 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.863e-41
Identity = 101/217 (46.54%), Postives = 148/217 (68.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F     F HI  STQ+HL+KVYA+ AL    AA G+ V VV  + Q G L+ LGS+A + +LM T  + +    R+  L  F F +G+GLGP + +   +NP I+PTA + T+ IF  FS++AL  + RSYL++GG LMS + L+++ ++ NLFFGS+ +++  LYLGL+V C  VLFDTQLIIEK + GD DYIWH +DL ++ V++FR++++IL
Sbjct:    9 NFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCVDLFLDFVTLFRKLMLIL 225          
BLAST of Bax inhibitor 1 vs. TrEMBL
Match: V4ABN5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_191852 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.715e-48
Identity = 102/226 (45.13%), Postives = 155/226 (68.58%), Query Frame = 1
Query:   49 NDF--QTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVY-GYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN 717
            N+F     F FD++++  Q+HL+ VY  L +G L+AAVG+ V ++    Q G L  +GS+  + +L     + + V  RM     F F SG+ LGP + ++  I+P I+P+A+L T+ IF SF++AAL N +R++LY+GG ++S L  L+V ++ANLFF S +++ + LY GLI+FC  VL+DTQLIIEKR+MGD D++WHA+DL I+ + IFRR+LIIL  +EE+
Sbjct:    5 NEFLPAALFKFDNLEEYVQKHLKNVYGCLGIGMLTAAVGAYVHLFTNLMQAGLLTAIGSIGLMIWLASIHHSKETVGKRMAIFSGFTFLSGISLGPLLDMAMTIDPSIIPSALLGTAVIFISFTLAALYNNNRTFLYLGGFILSGLSFLMVSSLANLFFRSQMLYDLNLYGGLIIFCAFVLYDTQLIIEKRRMGDEDFVWHAVDLFIDFIQIFRRLLIILSKKEED 230          
BLAST of Bax inhibitor 1 vs. TrEMBL
Match: A0A1S3HKX4 (probable Bax inhibitor 1 OS=Lingula unguis OX=7574 GN=LOC106155696 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.954e-45
Identity = 106/232 (45.69%), Postives = 154/232 (66.38%), Query Frame = 1
Query:   28 MSTAIISNDFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVY-GYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALL-NKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN 717
            M+ A  +   +T F+F  ++K  Q HL+ VY+ LA+  L+AAVG  V V+ G  Q G L L+G +  +  L  T  T +N   R+  L  F FFSGM LGP + +  +INP I+PTA L T  IF  FS++ALL    R YLY+GG L S L ++++M++ NL  G  L++++ LYLGLI+ C  VL+DTQLI+EKR+ GDTD+IWH++DL ++ ++IFRR+LIIL ++E+ 
Sbjct:    1 MADADFNAQVRTLFDFSRLEKPVQLHLKNVYSCLAICMLAAAVGGYVHVFTGLMQAGLLTLIGVIGLMIALSMTANTPENQPKRLAMLGGFAFFSGMSLGPLLDVVIEINPSIIPTAFLGTCVIFACFSLSALLAGDQRKYLYLGGMLFSGLSIMMLMSLVNLLLGIRLIFELNLYLGLIIMCGFVLYDTQLIVEKRRRGDTDFIWHSVDLFLDFINIFRRLLIILASKEDR 232          
BLAST of Bax inhibitor 1 vs. TrEMBL
Match: A0A140LGF6 (Testis-enhanced gene transcript (BAX inhibitor 1) OS=Danio rerio OX=7955 GN=tegt PE=3 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 6.203e-44
Identity = 105/216 (48.61%), Postives = 149/216 (68.98%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F   F F  I +STQ+HL+ VYA+LA+  L A  GS + V      G L +LGS+A + +L  T  + Q    R+  L  F FF+G+GLGP +  +  I+P I+ TA L TS IF  F+++AL  + RSYL++GGTLM+ L +L++++I N+FFGSVL++K  LYLGL+V C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR+++I+L
Sbjct:    9 NFDALFKFSQISRSTQQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAMTPHSPQTEKKRLAILAAFAFFTGLGLGPLMDYAISIDPSIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVLLLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLVILL 224          
BLAST of Bax inhibitor 1 vs. TrEMBL
Match: R7UAK1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_158085 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.573e-43
Identity = 98/224 (43.75%), Postives = 151/224 (67.41%), Query Frame = 1
Query:   28 MSTAIISNDFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            MS+   +   QT  +F+H++KS  +HL+KVY+ L +  + AAVG+ V ++  +Q G L+ +GS+  +  LM +  + +    R+  L  F   SGMGLGP +     INP I+PTA+++TS IF  FS++ALL+  R ++Y+GG+L S L +L++M++AN+F  S  +  I LYLGL V C  +L+DTQLI+EKR+MG  DYIWH+++L ++ V++FR ILIIL
Sbjct:    1 MSSPSFNVRLQTLLSFNHLEKSVHDHLKKVYSALTICTILAAVGAYVHLFNIFQAGILSTIGSIGLMVLLMTSSHSKETEQKRLAYLAGFALCSGMGLGPLLDNVIHINPSILPTALMLTSAIFVCFSLSALLSNDRKWIYLGGSLSSGLSILLIMSLANMFMRSSFLLDINLYLGLFVMCGFILYDTQLIVEKRRMGSDDYIWHSVELFVDMVNVFRYILIIL 224          
BLAST of Bax inhibitor 1 vs. TrEMBL
Match: A0A0P7VBQ5 (Uncharacterized protein OS=Scleropages formosus OX=113540 GN=Z043_108434 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.738e-43
Identity = 102/217 (47.00%), Postives = 152/217 (70.05%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F   F F  I +STQ HL+ VY++LA+  L AA G+ V VV   +Q G+++LLGS+  + +L  T    +    R+  L  F FF+G+GLGP +     +NP I+ TA L TS IF  F+++AL  + RSY+++GGTLMS L++++++++ANLF GSV+++K+ +YLGL V C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR++++IL
Sbjct:    9 NFDALFKFSQISRSTQHHLKNVYSSLAVCMLVAAAGAYVHVVTRLFQGGFVSLLGSLGMMAWLAMTPHNPETEKKRLAILAGFAFFTGVGLGPTMDFVIAVNPSIIVTAFLGTSIIFLCFTLSALYAQRRSYIFLGGTLMSGLIIMLLLSLANLFVGSVMLFKVHMYLGLAVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Cavefish
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:103036156])

HSP 1 Score: 150.214 bits (378), Expect = 3.042e-44
Identity = 102/217 (47.00%), Postives = 148/217 (68.20%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F   F F  I +STQ+HL+ VYA+LA+    AA G+ V VV   +Q G L++LGS+A + +L  T  + Q    R+  L  F F +G+GLGP +     INP I+ TA L TS IF  F+++AL  + RSYL++GGTLMS L +L++++  N+F GSV+++K  +Y+GL + C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR++++IL
Sbjct:    9 NFDALFKFSQISRSTQQHLKNVYASLAVCMFVAAAGAYVHVVTRIFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLGILAGFAFCTGVGLGPVMDYVITINPSIIITAFLATSVIFTCFTLSALYAQRRSYLFLGGTLMSGLSILLLLSFLNIFVGSVMLFKAHVYIGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVIL 225          
BLAST of Bax inhibitor 1 vs. Ensembl Cavefish
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:103036156])

HSP 1 Score: 140.969 bits (354), Expect = 1.380e-40
Identity = 98/206 (47.57%), Postives = 143/206 (69.42%), Query Frame = 1
Query:   85 DKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
             +STQ+HL+ VYA+LA+    AA G+ V VV   +Q G L++LGS+A + +L  T  + Q    R+  L  F F +G+GLGP +     INP I+ TA L TS IF  F+++AL  + RSYL++GGTLMS L +L++++  N+F GSV+++K  +Y+GL + C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR++++IL
Sbjct:   33 SRSTQQHLKNVYASLAVCMFVAAAGAYVHVVTRIFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLGILAGFAFCTGVGLGPVMDYVITINPSIIITAFLATSVIFTCFTLSALYAQRRSYLFLGGTLMSGLSILLLLSFLNIFVGSVMLFKAHVYIGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVIL 238          
BLAST of Bax inhibitor 1 vs. Ensembl Cavefish
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:103036156])

HSP 1 Score: 137.502 bits (345), Expect = 1.532e-39
Identity = 93/217 (42.86%), Postives = 137/217 (63.13%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL 699
            +F   F F  I +STQ+HL+ VYA+LA+    AA G+ V VV   +Q G L++LGS+A + +L  T  + Q    R+  L                    +N  I+ TA L TS IF  F+++AL  + RSYL++GGTLMS L +L++++  N+F GSV+++K  +Y+GL + C  VLFDTQLIIEK +MGD DYIWH +DL ++ V+IFR++++IL
Sbjct:    9 NFDALFKFSQISRSTQQHLKNVYASLAVCMFVAAAGAYVHVVTRIFQGGLLSMLGSLAMMAWLAMTPHSPQTEKKRLGILAGLLKMHI------------LNCIIIITAFLATSVIFTCFTLSALYAQRRSYLFLGGTLMSGLSILLLLSFLNIFVGSVMLFKAHVYIGLAIMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLMVIL 213          
BLAST of Bax inhibitor 1 vs. Ensembl Sea Lamprey
Match: tegt (testis enhanced gene transcript (BAX inhibitor 1) [Source:ZFIN;Acc:ZDB-GENE-030826-10])

HSP 1 Score: 147.517 bits (371), Expect = 3.520e-44
Identity = 99/210 (47.14%), Postives = 143/210 (68.10%), Query Frame = 1
Query:   91 STQEHLQKVYATLALGWLSAAVGSLVVVY-GYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN 717
             T++HL+ VYATLA+  L AA G+ V +Y  + Q  +L  L SM  + +LMFT    QN   R+  L  F F  G+GLGP +     INP I+ TA + TS IF  F+++AL  + RSYLY+GGTLMS L  L++M++ N+F+GS L++K ++YLGL+V C  VLFDTQLI+EK + GD D+IWH++DL ++ + IFR+++IIL   E++
Sbjct:    2 DTRQHLKNVYATLAICMLVAAAGAYVHLYTAFLQGNFLMTLVSMGLLMWLMFTPRNGQNDAKRLGILCGFAFTVGLGLGPLLDFVIAINPSIIATAFMGTSLIFGCFTLSALYARRRSYLYLGGTLMSGLSFLLMMSLFNMFYGSALLFKAQMYLGLVVMCGFVLFDTQLIVEKCRAGDKDFIWHSVDLFLDFIHIFRKLMIILTMNEKD 211          
BLAST of Bax inhibitor 1 vs. Ensembl Nematostella
Match: EDO45792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRN6])

HSP 1 Score: 129.413 bits (324), Expect = 1.291e-36
Identity = 85/217 (39.17%), Postives = 138/217 (63.59%), Query Frame = 1
Query:   70 NFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVY-GYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN 717
            +F  +D  T+ HL+ VY+ LA   ++AAVGS V ++    + G+L+ + S+  +  L  T    +N   R   L+ F    G+ LGP + +  +++P IV TA   T  IF  F+++AL  + RS LY+GGTL S L +L+++   N+F GS  ++++ LY GL++FC  V++DTQLI+EK + GD D+IWH++DL ++ ++IFRRI+IIL   +E+
Sbjct:   17 DFSKLDNPTRHHLKNVYSCLAASMMAAAVGSSVHLFTSILKGGFLSGIASLGLLIALAVTPNNGKNQSKRFGILMGFALCCGLSLGPLMDLVIEVDPSIVVTAFFATVMIFACFTVSALWAEQRSVLYLGGTLASGLSILLLLGFVNIFVGSFFIYQLHLYGGLLLFCGFVMYDTQLIVEKHRNGDKDFIWHSVDLFLDFINIFRRIMIILAQNKES 233          
BLAST of Bax inhibitor 1 vs. Ensembl Medaka
Match: tegt (transmembrane BAX inhibitor motif containing 6 [Source:NCBI gene;Acc:101168541])

HSP 1 Score: 151.754 bits (382), Expect = 6.706e-45
Identity = 106/226 (46.90%), Postives = 149/226 (65.93%), Query Frame = 1
Query:   46 SNDFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLV-VVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIIL-MNREEN 717
            S +    F    I  STQ HL+ VY++LAL  + AA GS V VV   ++ G L+LLGS+  +F+L  T    +    R+  L  F F +G+GLGP +     INP I+ TA L TS IF  F+++AL  K RSYL++GGTLMS L +L + ++ N+FFGS++++K  +YLGL++ C  VLFDTQLIIEK + GD DYIWH +DL ++ V+IFR+++IIL MN +E 
Sbjct:    7 SINIDALFKLSQISHSTQVHLKNVYSSLALSMIVAAAGSYVHVVTRLFEGGVLSLLGSVGLMFWLAMTPHNPETEKKRLAILAGFAFLTGVGLGPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLFSVMNMFFGSLMLFKAHMYLGLLIMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTIFRKLMIILAMNDKEK 232          
BLAST of Bax inhibitor 1 vs. Planmine SMEST
Match: SMESG000038559.1 (SMESG000038559.1)

HSP 1 Score: 188.348 bits (477), Expect = 3.010e-59
Identity = 110/222 (49.55%), Postives = 157/222 (70.72%), Query Frame = 1
Query:   52 DFQTFFNFDHIDKSTQEHLQKVYATLALGWLSAAVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMXXXXXXXXXXXXXXXPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSXXXXXXXXXXXXXXXIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLIIEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN 717
            + ++ F FDH+ K  Q+HL+ VY+TLA+G ++AAVG+ V V+  +Q G L+ + S   +F ++ T    +N+  R+     FGF  GM LGP I +   I+P I+PTA+L TS IF SFS++AL N+SRSYLYMGG L+S L +L+VM+  N F GS ++   ELYLGL +FCL +LFDTQLI+EK+++GD D+IWH+LDL ++ VSIFRRI+++L  R E 
Sbjct:   11 NLESAFKFDHLGKEVQQHLKNVYSTLAIGIIAAAVGAYVHVFSIFQAGLLSFILSFGLLFAILLTEHKKENIPMRLAFFTGFGFAIGMNLGPLISVVGTIDPTILPTALLSTSVIFISFSLSALFNRSRSYLYMGGMLLSGLNILVVMSFLNFFIGSKMIMSAELYLGLAIFCLFILFDTQLIVEKKRLGDNDFIWHSLDLFLDIVSIFRRIMMLLAKRNER 232          
The following BLAST results are available for this feature:
BLAST of Bax inhibitor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMBIM69.528e-4344.70transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM69.528e-4344.70transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM69.528e-4344.70transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM69.528e-4344.70transmembrane BAX inhibitor motif containing 6 [So... [more]
TMBIM65.127e-4244.70transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BI-17.250e-2536.28gene:FBgn0035871 transcript:FBtr0076711[more]
BI-16.183e-2335.71gene:FBgn0035871 transcript:FBtr0076712[more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tegt2.772e-4748.61testis enhanced gene transcript (BAX inhibitor 1) ... [more]
tegt9.320e-4345.83testis enhanced gene transcript (BAX inhibitor 1) ... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
siah12.114e-4345.98siah E3 ubiquitin protein ligase 1 [Source:Xenbase... [more]
siah19.692e-4246.98siah E3 ubiquitin protein ligase 1 [Source:Xenbase... [more]
siah14.002e-3946.67siah E3 ubiquitin protein ligase 1 [Source:Xenbase... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmbim61.700e-4245.74transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim61.410e-4146.54transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim61.410e-4146.54transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim61.410e-4146.54transmembrane BAX inhibitor motif containing 6 [So... [more]
Tmbim61.410e-4146.54transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IA79|BI1_PAROL3.625e-4446.08Probable Bax inhibitor 1 OS=Paralichthys olivaceus... [more]
sp|Q5R7R1|BI1_PONAB2.376e-4245.16Bax inhibitor 1 OS=Pongo abelii OX=9601 GN=TMBIM6 ... [more]
sp|P55061|BI1_HUMAN4.576e-4244.70Bax inhibitor 1 OS=Homo sapiens OX=9606 GN=TMBIM6 ... [more]
sp|Q0V882|BI1_BOVIN2.206e-4145.70Bax inhibitor 1 OS=Bos taurus OX=9913 GN=TMBIM6 PE... [more]
sp|Q9D2C7|BI1_MOUSE9.863e-4146.54Bax inhibitor 1 OS=Mus musculus OX=10090 GN=Tmbim6... [more]
back to top
BLAST of Bax inhibitor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4ABN58.715e-4845.13Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HKX42.954e-4545.69probable Bax inhibitor 1 OS=Lingula unguis OX=7574... [more]
A0A140LGF66.203e-4448.61Testis-enhanced gene transcript (BAX inhibitor 1) ... [more]
R7UAK11.573e-4343.75Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0P7VBQ51.738e-4347.00Uncharacterized protein OS=Scleropages formosus OX... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tegt3.042e-4447.00transmembrane BAX inhibitor motif containing 6 [So... [more]
tegt1.380e-4047.57transmembrane BAX inhibitor motif containing 6 [So... [more]
tegt1.532e-3942.86transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tegt3.520e-4447.14testis enhanced gene transcript (BAX inhibitor 1) ... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO457921.291e-3639.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bax inhibitor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tegt6.706e-4546.90transmembrane BAX inhibitor motif containing 6 [So... [more]
back to top
BLAST of Bax inhibitor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000038559.13.010e-5949.55SMESG000038559.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024727 ID=SMED30024727|Name=Bax inhibitor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=781bp
AAGAAATTCAATAAAAACATTGGCGCTATGTCTACTGCAATTATCAGCAA
TGATTTTCAAACTTTTTTCAATTTTGACCACATTGACAAATCTACACAGG
AACATCTACAGAAGGTATACGCAACTTTGGCCTTAGGTTGGTTGTCGGCT
GCCGTTGGTTCTCTTGTTGTAGTCTATGGATATTATCAATTTGGCTGGCT
AGCACTTCTAGGGTCGATGGCATGCATTTTTTATCTCATGTTTACAGTAC
CGACGGATCAGAACGTATTTCCAAGGATGTTCGCGCTACTTTTATTCGGA
TTCTTCTCAGGTATGGGACTTGGGCCATTTATAATCATTTCAACTCAAAT
TAATCCACAAATCGTACCAACAGCTATTTTAATTACAAGTGGAATTTTCT
TCTCATTTTCAATGGCAGCTTTACTCAACAAAAGCCGAAGTTATCTTTAT
ATGGGAGGAACACTTATGTCTCTGCTCCTGCTTTTGATAGTTATGAATAT
TGCAAATTTATTTTTTGGCTCCGTCCTGGTTTGGAAAATCGAGCTTTATC
TTGGATTGATTGTTTTTTGCTTGTTGGTGCTCTTCGATACTCAGTTAATA
ATCGAGAAACGGAAAATGGGGGACACCGATTACATTTGGCATGCATTGGA
TCTATTAATTAATAGTGTATCTATTTTCAGAAGAATTCTTATCATTTTAA
TGAACAGAGAGGAAAATTGATCATTTGATAAAACAAATTTGTTCATTCGA
TAATAAATCATCATCTAACCTGGAAAAAAAA
back to top

protein sequence of SMED30024727-orf-1

>SMED30024727-orf-1 ID=SMED30024727-orf-1|Name=SMED30024727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
KKFNKNIGAMSTAIISNDFQTFFNFDHIDKSTQEHLQKVYATLALGWLSA
AVGSLVVVYGYYQFGWLALLGSMACIFYLMFTVPTDQNVFPRMFALLLFG
FFSGMGLGPFIIISTQINPQIVPTAILITSGIFFSFSMAALLNKSRSYLY
MGGTLMSLLLLLIVMNIANLFFGSVLVWKIELYLGLIVFCLLVLFDTQLI
IEKRKMGDTDYIWHALDLLINSVSIFRRILIILMNREEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0033119negative regulation of RNA splicing
GO:0034620cellular response to unfolded protein
GO:0006914autophagy
GO:0006915apoptotic process
GO:0006986response to unfolded protein
GO:0010523negative regulation of calcium ion transport into cytosol
GO:0032091negative regulation of protein binding
GO:0032469endoplasmic reticulum calcium ion homeostasis
GO:0034976response to endoplasmic reticulum stress
GO:0043066negative regulation of apoptotic process
GO:0051025negative regulation of immunoglobulin secretion
GO:0060702negative regulation of endoribonuclease activity
GO:0070059intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:1902065response to L-glutamate
GO:1902236negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1903298negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway
GO:1904721negative regulation of mRNA endonucleolytic cleavage involved in unfolded protein response
GO:1990441negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
GO:2001234negative regulation of apoptotic signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006214Bax_inhibitor_1-related
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031966mitochondrial membrane
Vocabulary: molecular function
TermDefinition
GO:0019899enzyme binding
GO:0031625ubiquitin protein ligase binding
GO:0060698endoribonuclease inhibitor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006214Bax inhibitor 1-relatedPFAMPF01027Bax1-Icoord: 34..233
e-value: 1.3E-36
score: 126.4
IPR006214Bax inhibitor 1-relatedPANTHERPTHR23291BAX INHIBITOR-RELATEDcoord: 14..236
NoneNo IPR availablePANTHERPTHR23291:SF34BAX INHIBITOR 1coord: 14..236
NoneNo IPR availableCDDcd10430BI-1coord: 25..238
e-value: 1.26268E-70
score: 213.238
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 156..178
NoneNo IPR availableTMHMMTMhelixcoord: 66..83
NoneNo IPR availableTMHMMTMhelixcoord: 182..201
NoneNo IPR availableTMHMMTMhelixcoord: 121..143
NoneNo IPR availableTMHMMTMhelixcoord: 95..117