Protein lin-7 homolog

Overview
NameProtein lin-7 homolog
Smed IDSMED30024725
Length (bp)722
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein lin-7 homolog (SMED30024725) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein lin-7 homolog (SMED30024725) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein lin-7 homolog (SMED30024725) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein lin-7 homolog (SMED30024725) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024725

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024725h1SMcG0013581 Contig5190GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30024725h1SMcG0013581 dd_Smed_v4_1009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024725h1SMcG0013581 dd_Smed_v4_1009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024725h1SMcG0013581 dd_Smed_v4_1009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024725h1SMcG0013581 dd_Smed_v4_1009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024725h1SMcG0013581 dd_Smed_v4_1009_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein lin-7 homolog vs. Ensembl Human
Match: LIN7B (lin-7 homolog B, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17788])

HSP 1 Score: 285.419 bits (729), Expect = 7.679e-98
Identity = 145/190 (76.32%), Postives = 173/190 (91.05%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+RD+SRAVELLE LQ+  +L P+KL  LQ++LQS FC+ +REVYE +Y+T+DI GSAE+RA+ATAKATVAAF ASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR+GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQG+VKLVVRYTP+VL+EMEARF+K ++ RR
Sbjct:    4 LVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARR 193          
BLAST of Protein lin-7 homolog vs. Ensembl Human
Match: LIN7C (lin-7 homolog C, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17789])

HSP 1 Score: 283.108 bits (723), Expect = 5.796e-97
Identity = 149/194 (76.80%), Postives = 174/194 (89.69%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT 635
            + EP+ L+RDI RA+ELLE LQ+  ++ P+KL  LQ++LQS+FCN VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG VKLVVRYTPKVL+EME+RF+K ++ +R   T
Sbjct:    4 LGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT 197          
BLAST of Protein lin-7 homolog vs. Ensembl Human
Match: LIN7A (lin-7 homolog A, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17787])

HSP 1 Score: 261.536 bits (667), Expect = 5.432e-88
Identity = 138/193 (71.50%), Postives = 168/193 (87.05%), Query Frame = 3
Query:   45 TF*MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            T  + +PLTL RD++RA+ELLE LQ+  ++   KL  L+K+LQS+FC  +REVY++++ET+ + G  E RA ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:   16 TLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARR 208          
BLAST of Protein lin-7 homolog vs. Ensembl Human
Match: LIN7C (lin-7 homolog C, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17789])

HSP 1 Score: 246.128 bits (627), Expect = 7.264e-83
Identity = 121/194 (62.37%), Postives = 146/194 (75.26%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT 635
            + EP+ L+RDI RA+ELLE LQ+  ++ P+KL  LQ++LQS+FCN VRE     +                          SEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG VKLVVRYTPKVL+EME+RF+K ++ +R   T
Sbjct:    4 LGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREATVAAFAA------------------------SEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT 173          
BLAST of Protein lin-7 homolog vs. Ensembl Human
Match: LIN7A (lin-7 homolog A, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17787])

HSP 1 Score: 189.889 bits (481), Expect = 1.703e-60
Identity = 102/151 (67.55%), Postives = 129/151 (85.43%), Query Frame = 3
Query:   45 TF*MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENE 497
            T  + +PLTL RD++RA+ELLE LQ+  ++   KL  L+K+LQS+FC  +REVY++++ET+ + G  E RA ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+ + ++
Sbjct:   10 TLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVLLRSQ 160          
BLAST of Protein lin-7 homolog vs. Ensembl Celegans
Match: lin-7 (pep chromosome:WBcel235:II:14346877:14348792:-1 gene:WBGene00002996.1 transcript:Y54G11A.10a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-7)

HSP 1 Score: 234.572 bits (597), Expect = 3.936e-78
Identity = 124/183 (67.76%), Postives = 158/183 (86.34%), Query Frame = 3
Query:   69 TLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKAR 617
             L+RD+ R +EL+E +QK  ++   KL  LQ++LQS+F   VREVYE +YE++D + + E++A ATAKATVAAFAA+EGHAHPR+VE+PKT++GLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQL++VNG++VE E HEKAVDLLK+A G+VKLV+RY PK+LDEME RF++Q+ R
Sbjct:    8 NLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDADTTPEIKAAATAKATVAAFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLKSAVGSVKLVIRYMPKLLDEMERRFERQRIR 190          
BLAST of Protein lin-7 homolog vs. Ensembl Celegans
Match: lin-7 (pep chromosome:WBcel235:II:14347162:14348792:-1 gene:WBGene00002996.1 transcript:Y54G11A.10b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-7)

HSP 1 Score: 229.18 bits (583), Expect = 5.834e-76
Identity = 124/183 (67.76%), Postives = 157/183 (85.79%), Query Frame = 3
Query:   69 TLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKAR 617
             L+RD+ R +EL+E +QK  ++   KL  LQ++LQS+F   VREVYE +YE++D + + E++A ATAKATVAAFAA+EGHAHPR+VE+PKT++GLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQL++VNG +VE E HEKAVDLLK+A G+VKLV+RY PK+LDEME RF++Q+ R
Sbjct:    8 NLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDADTTPEIKAAATAKATVAAFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNG-NVEAECHEKAVDLLKSAVGSVKLVIRYMPKLLDEMERRFERQRIR 189          
BLAST of Protein lin-7 homolog vs. Ensembl Celegans
Match: dlg-1 (Disks large homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECY0])

HSP 1 Score: 87.8113 bits (216), Expect = 1.062e-19
Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = 3
Query:  315 PRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDK 605
            PR V++ K + GLGFN++GG E N PIYIS ++PGGVAD  G +K GD LL VNG+ + N  H++A + L+ A   V L ++Y P+     E++ +K
Sbjct:  508 PRPVQLVKGQNGLGFNIVGG-EDNEPIYISFVLPGGVADLSGNVKTGDVLLEVNGVVLRNATHKEAAEALRNAGNPVYLTLQYRPQEYQIFESKIEK 603          

HSP 2 Score: 54.299 bits (129), Expect = 2.609e-8
Identity = 30/85 (35.29%), Postives = 54/85 (63.53%), Query Frame = 3
Query:  321 VVEIPKTEEGLGFNVMGGK-----EQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVR 560
            V+++ K   GLGF++ GG+     + ++ IY+++II  G A+  G L+ GD++L V+  S+ N  HE AV++LK     V+L+++
Sbjct:  361 VIDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVLKNTGNRVRLLIQ 445          

HSP 3 Score: 54.299 bits (129), Expect = 2.915e-8
Identity = 29/82 (35.37%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  330 IPKTEEGLGFNVMGGKEQ-----NSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVR 560
            + K   GLGF++ GG +Q     ++ IY++ II GG A   G +++ D + +VN  + EN  HE AV+ LK++   V L ++
Sbjct:  205 LEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLK 286          
BLAST of Protein lin-7 homolog vs. Ensembl Celegans
Match: stn-2 (SynTrophiN [Source:UniProtKB/TrEMBL;Acc:Q5WRR6])

HSP 1 Score: 65.855 bits (159), Expect = 3.020e-12
Identity = 37/88 (42.05%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  306 HAHPRVVEIPKTEEGLGFNVMGGKE--QNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRY 563
            +A  +VV + K + G G ++ GG E  QN PI IS+I  G  AD  G L  GD ++ VNGIS+E + H++ V++LK++   V L VR+
Sbjct:   61 NATRQVVIVKKPDSGFGLSIKGGSENAQNMPIVISKIFKGLPADECGELFIGDAIVEVNGISIEGQSHDEVVNMLKSSGDQVTLGVRH 148          
BLAST of Protein lin-7 homolog vs. Ensembl Celegans
Match: stn-2 (SynTrophiN [Source:UniProtKB/TrEMBL;Acc:Q5WRR6])

HSP 1 Score: 65.855 bits (159), Expect = 3.112e-12
Identity = 37/88 (42.05%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  306 HAHPRVVEIPKTEEGLGFNVMGGKE--QNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRY 563
            +A  +VV + K + G G ++ GG E  QN PI IS+I  G  AD  G L  GD ++ VNGIS+E + H++ V++LK++   V L VR+
Sbjct:   61 NATRQVVIVKKPDSGFGLSIKGGSENAQNMPIVISKIFKGLPADECGELFIGDAIVEVNGISIEGQSHDEVVNMLKSSGDQVTLGVRH 148          
BLAST of Protein lin-7 homolog vs. Ensembl Fly
Match: veli (gene:FBgn0039269 transcript:FBtr0084787)

HSP 1 Score: 278.87 bits (712), Expect = 1.106e-95
Identity = 150/189 (79.37%), Postives = 166/189 (87.83%), Query Frame = 3
Query:   57 AEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            AEPLTL RD+ R++ELLE LQ   D    KL  LQK+L SDF   VREVYEH+YETVDI+GS +VRA+ATAKATVAAFAASEGHAHPRVVE+PKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNG+SVE E+HEKAV+LLK A G+VKLVVRYTPKVL+EME RFDKQ+  RR
Sbjct:    5 AEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYETVDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDKQRNTRR 193          
BLAST of Protein lin-7 homolog vs. Ensembl Fly
Match: veli (gene:FBgn0039269 transcript:FBtr0301664)

HSP 1 Score: 252.677 bits (644), Expect = 1.061e-84
Identity = 150/240 (62.50%), Postives = 166/240 (69.17%), Query Frame = 3
Query:   57 AEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEG---------------------------------------------------LGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            AEPLTL RD+ R++ELLE LQ   D    KL  LQK+L SDF   VREVYEH+YETVDI+GS +VRA+ATAKATVAAFAASEGHAHPRVVE+PKTEEG                                                   LGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNG+SVE E+HEKAV+LLK A G+VKLVVRYTPKVL+EME RFDKQ+  RR
Sbjct:    5 AEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYETVDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGKTRPYELRIEGIPLYHKTNTLIVKVYRPRIYVSIIHLIWKALSIFNFCFSGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDKQRNTRR 244          
BLAST of Protein lin-7 homolog vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073488)

HSP 1 Score: 85.5001 bits (210), Expect = 9.088e-19
Identity = 47/102 (46.08%), Postives = 64/102 (62.75%), Query Frame = 3
Query:  315 PRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFD--KQKA 614
            PR + I K  +GLGFN++GG E    IY+S I+ GG AD    LKRGDQLLSVN +++ +  HE+A   LK + G V L+ +Y P+  +  EAR    KQ+A
Sbjct:  504 PRTITIQKGPQGLGFNIVGG-EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQA 604          

HSP 2 Score: 48.521 bits (114), Expect = 2.755e-6
Identity = 37/95 (38.95%), Postives = 56/95 (58.95%), Query Frame = 3
Query:  315 PRVVEIP--KTEEGLGFNVMGG-KEQNSP----IYISRIIPGGVADRYGGLKRGDQLLSV--NGI--SVENEHHEKAVDLLKAAQGTVKLVVRYT 566
            P+V+EI   K  +GLGF++ GG   Q+ P    IY+++++ GG A   G L  GD+L++V  NG   ++EN  HE AV  LK+    V L++  T
Sbjct:  326 PKVIEIDLVKGGKGLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKT 420          
BLAST of Protein lin-7 homolog vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0301288)

HSP 1 Score: 85.5001 bits (210), Expect = 1.021e-18
Identity = 47/102 (46.08%), Postives = 64/102 (62.75%), Query Frame = 3
Query:  315 PRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFD--KQKA 614
            PR + I K  +GLGFN++GG E    IY+S I+ GG AD    LKRGDQLLSVN +++ +  HE+A   LK + G V L+ +Y P+  +  EAR    KQ+A
Sbjct:  742 PRTITIQKGPQGLGFNIVGG-EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQA 842          

HSP 2 Score: 48.521 bits (114), Expect = 2.425e-6
Identity = 37/95 (38.95%), Postives = 56/95 (58.95%), Query Frame = 3
Query:  315 PRVVEIP--KTEEGLGFNVMGG-KEQNSP----IYISRIIPGGVADRYGGLKRGDQLLSV--NGI--SVENEHHEKAVDLLKAAQGTVKLVVRYT 566
            P+V+EI   K  +GLGF++ GG   Q+ P    IY+++++ GG A   G L  GD+L++V  NG   ++EN  HE AV  LK+    V L++  T
Sbjct:  564 PKVIEIDLVKGGKGLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKT 658          
BLAST of Protein lin-7 homolog vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073490)

HSP 1 Score: 85.5001 bits (210), Expect = 1.084e-18
Identity = 47/102 (46.08%), Postives = 64/102 (62.75%), Query Frame = 3
Query:  315 PRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFD--KQKA 614
            PR + I K  +GLGFN++GG E    IY+S I+ GG AD    LKRGDQLLSVN +++ +  HE+A   LK + G V L+ +Y P+  +  EAR    KQ+A
Sbjct:  445 PRTITIQKGPQGLGFNIVGG-EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQELKQQA 545          

HSP 2 Score: 48.521 bits (114), Expect = 2.777e-6
Identity = 37/95 (38.95%), Postives = 56/95 (58.95%), Query Frame = 3
Query:  315 PRVVEIP--KTEEGLGFNVMGG-KEQNSP----IYISRIIPGGVADRYGGLKRGDQLLSV--NGI--SVENEHHEKAVDLLKAAQGTVKLVVRYT 566
            P+V+EI   K  +GLGF++ GG   Q+ P    IY+++++ GG A   G L  GD+L++V  NG   ++EN  HE AV  LK+    V L++  T
Sbjct:  267 PKVIEIDLVKGGKGLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKT 361          
BLAST of Protein lin-7 homolog vs. Ensembl Zebrafish
Match: lin7c (lin-7 homolog C (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-041011-2])

HSP 1 Score: 282.722 bits (722), Expect = 4.983e-97
Identity = 151/195 (77.44%), Postives = 176/195 (90.26%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDK-QKARRRGPNT 635
            + EP+ L+RDISRA+ELL+ LQ+  ++ P+KL  LQ++LQS+FC  VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQGTVKLVVRYTPKVL+EME+RF+K + A+RR  N 
Sbjct:    4 LGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCKAVREVYEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEEMESRFEKLRSAKRRQQNN 198          
BLAST of Protein lin-7 homolog vs. Ensembl Zebrafish
Match: lin7c (lin-7 homolog C (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-041011-2])

HSP 1 Score: 282.337 bits (721), Expect = 9.132e-97
Identity = 150/198 (75.76%), Postives = 176/198 (88.89%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXX---XXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDK-QKARRRGPNT 635
            + EP+ L+RDISRA+ELL+ LQ+  ++ P+KL  LQ++LQS+FC  VREVYEH+YETVDI  S EVRANATA   +ATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQGTVKLVVRYTPKVL+EME+RF+K + A+RR  N 
Sbjct:    4 LGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCKAVREVYEHVYETVDINSSPEVRANATAKVSQATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEEMESRFEKLRSAKRRQQNN 201          
BLAST of Protein lin-7 homolog vs. Ensembl Zebrafish
Match: lin7b (lin-7 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-041011-1])

HSP 1 Score: 273.092 bits (697), Expect = 5.440e-93
Identity = 148/197 (75.13%), Postives = 170/197 (86.29%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPNT*Y 641
            M EPL L+RD+ R +ELL+ LQ+   L P KL  LQ++LQS FC  +REVYE +Y+T+DI G  EVRA ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG+VKLVVRYTPKVL+EMEARF+K + ARRR  +T Y
Sbjct:   17 MTEPLCLERDVCRVIELLDRLQRSGQLPPPKLQALQRVLQSKFCAAIREVYEQLYDTLDIIGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPKVLEEMEARFEKMRSARRRQQHTSY 213          
BLAST of Protein lin-7 homolog vs. Ensembl Zebrafish
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 260.766 bits (665), Expect = 4.910e-88
Identity = 137/188 (72.87%), Postives = 167/188 (88.83%), Query Frame = 3
Query:   60 EPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            +PLTL+RD++RA+ELLE LQ+  D+   KL  L+K+LQS+FC  +REVY++++ET+ + G  E +A ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:    7 QPLTLERDVTRAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARR 194          
BLAST of Protein lin-7 homolog vs. Ensembl Zebrafish
Match: lin7b (lin-7 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-041011-1])

HSP 1 Score: 194.897 bits (494), Expect = 9.614e-63
Identity = 106/143 (74.13%), Postives = 122/143 (85.31%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGI 482
            M EPL L+RD+ R +ELL+ LQ+   L P KL  LQ++LQS FC  +REVYE +Y+T+DI G  EVRA ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR GGLKRGDQLLSVNG+
Sbjct:   17 MTEPLCLERDVCRVIELLDRLQRSGQLPPPKLQALQRVLQSKFCAAIREVYEQLYDTLDIIGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGV 159          
BLAST of Protein lin-7 homolog vs. Ensembl Xenopus
Match: ENSXETT00000028683.1 (lin-7 homolog B [Source:NCBI gene;Acc:100491827])

HSP 1 Score: 280.026 bits (715), Expect = 1.056e-95
Identity = 147/190 (77.37%), Postives = 172/190 (90.53%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+RD+ RA+ELLE LQ+  ++ P+KL  LQ++LQS FC+ VREVYE +Y+T+DI GSAE+RA+ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQGTVKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:    4 LPEPLGLERDVCRAIELLERLQRSGEVPPQKLQALQRVLQSKFCSAVREVYEQLYDTLDITGSAEIRAHATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGTVKLVVRYTPKVLEEMEARFEKMRTARR 193          
BLAST of Protein lin-7 homolog vs. Ensembl Xenopus
Match: ralbp1 (ralA binding protein 1 [Source:Xenbase;Acc:XB-GENE-1016073])

HSP 1 Score: 279.641 bits (714), Expect = 1.077e-95
Identity = 149/194 (76.80%), Postives = 173/194 (89.18%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPN 632
            + EP+ L+RD+ RA+ELLE LQ+  ++ P KL  LQ++LQSDFC  VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG VKLVVRYTP+VL+EME+RF+K + A+RR  N
Sbjct:    4 VGEPIRLERDVHRAIELLEKLQRSGEVPPHKLHALQRVLQSDFCTAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPRVLEEMESRFEKMRSAKRRQQN 197          
BLAST of Protein lin-7 homolog vs. Ensembl Xenopus
Match: lin7a (lin-7 homolog A [Source:NCBI gene;Acc:100144984])

HSP 1 Score: 263.848 bits (673), Expect = 3.803e-88
Identity = 139/190 (73.16%), Postives = 167/190 (87.89%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + +PLTL RD+SRA+ELLE L+   +L  +KL  L+K+LQS+FC  +REVY++++ET+ + G  E RA ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVLDEMEARF+K +  RR
Sbjct:   65 VVQPLTLDRDVSRAIELLEKLETSGELPVQKLQSLKKVLQSEFCTAIREVYQYMHETIPVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLDEMEARFEKLRTARR 254          
BLAST of Protein lin-7 homolog vs. Ensembl Xenopus
Match: lin7a (lin-7 homolog A [Source:NCBI gene;Acc:100144984])

HSP 1 Score: 251.906 bits (642), Expect = 6.179e-84
Identity = 134/181 (74.03%), Postives = 160/181 (88.40%), Query Frame = 3
Query:   81 DISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            D+SRA+ELLE L+   +L  +KL  L+K+LQS+FC  +REVY++++ET+ + G  E RA ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVLDEMEARF+K +  RR
Sbjct:   48 DVSRAIELLEKLETSGELPVQKLQSLKKVLQSEFCTAIREVYQYMHETIPVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLDEMEARFEKLRTARR 228          
BLAST of Protein lin-7 homolog vs. Ensembl Xenopus
Match: ralbp1 (ralA binding protein 1 [Source:Xenbase;Acc:XB-GENE-1016073])

HSP 1 Score: 230.72 bits (587), Expect = 5.865e-77
Identity = 116/184 (63.04%), Postives = 137/184 (74.46%), Query Frame = 3
Query:   84 ISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPN 632
            + RA+ELLE LQ+  ++ P KL  LQ++LQSDFC  VRE     +                          SEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG VKLVVRYTP+VL+EME+RF+K + A+RR  N
Sbjct:    1 VHRAIELLEKLQRSGEVPPHKLHALQRVLQSDFCTAVREATVAAFAA------------------------SEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPRVLEEMESRFEKMRSAKRRQQN 160          
BLAST of Protein lin-7 homolog vs. Ensembl Mouse
Match: Lin7b (lin-7 homolog B (C. elegans) [Source:MGI Symbol;Acc:MGI:1330858])

HSP 1 Score: 288.5 bits (737), Expect = 4.163e-99
Identity = 147/190 (77.37%), Postives = 174/190 (91.58%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+RD+SRAVELLE LQ+  +L P+KL  LQ++LQS FC+ +REVYE +Y+T+DI GSAEVRA+ATAKATVAAF ASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG+VKLVVRYTP+VL+EMEARF+K ++ RR
Sbjct:    4 LVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEVRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARR 193          
BLAST of Protein lin-7 homolog vs. Ensembl Mouse
Match: Lin7c (lin-7 homolog C (C. elegans) [Source:MGI Symbol;Acc:MGI:1330839])

HSP 1 Score: 283.108 bits (723), Expect = 3.979e-97
Identity = 149/194 (76.80%), Postives = 174/194 (89.69%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT 635
            + EP+ L+RDI RA+ELLE LQ+  ++ P+KL  LQ++LQS+FCN VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG VKLVVRYTPKVL+EME+RF+K ++ +R   T
Sbjct:    4 LGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT 197          
BLAST of Protein lin-7 homolog vs. Ensembl Mouse
Match: Lin7a (lin-7 homolog A (C. elegans) [Source:MGI Symbol;Acc:MGI:2135609])

HSP 1 Score: 261.536 bits (667), Expect = 3.730e-88
Identity = 138/193 (71.50%), Postives = 168/193 (87.05%), Query Frame = 3
Query:   45 TF*MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            T  + +PLTL RD++RA+ELLE LQ+  ++   KL  L+K+LQS+FC  +REVY++++ET+ + G  E RA ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:   16 TLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARR 208          
BLAST of Protein lin-7 homolog vs. Ensembl Mouse
Match: Lin7a (lin-7 homolog A (C. elegans) [Source:MGI Symbol;Acc:MGI:2135609])

HSP 1 Score: 150.214 bits (378), Expect = 4.566e-46
Identity = 72/86 (83.72%), Postives = 81/86 (94.19%), Query Frame = 3
Query:  366 MGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            MGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:    1 MGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARR 86          
BLAST of Protein lin-7 homolog vs. Ensembl Mouse
Match: Lin7a (lin-7 homolog A (C. elegans) [Source:MGI Symbol;Acc:MGI:2135609])

HSP 1 Score: 150.214 bits (378), Expect = 4.566e-46
Identity = 72/86 (83.72%), Postives = 81/86 (94.19%), Query Frame = 3
Query:  366 MGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            MGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:    1 MGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARR 86          
BLAST of Protein lin-7 homolog vs. UniProt/SwissProt
Match: sp|Q9Z252|LIN7B_RAT (Protein lin-7 homolog B OS=Rattus norvegicus OX=10116 GN=Lin7b PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.444e-98
Identity = 147/190 (77.37%), Postives = 174/190 (91.58%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+RD+SRAVELLE LQ+  +L P+KL  LQ++LQS FC+ +REVYE +Y+T+DI GSAEVRA+ATAKATVAAF ASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG+VKLVVRYTP+VL+EMEARF+K ++ RR
Sbjct:    4 LVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEVRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARR 193          
BLAST of Protein lin-7 homolog vs. UniProt/SwissProt
Match: sp|O88951|LIN7B_MOUSE (Protein lin-7 homolog B OS=Mus musculus OX=10090 GN=Lin7b PE=1 SV=2)

HSP 1 Score: 288.5 bits (737), Expect = 2.912e-98
Identity = 147/190 (77.37%), Postives = 174/190 (91.58%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+RD+SRAVELLE LQ+  +L P+KL  LQ++LQS FC+ +REVYE +Y+T+DI GSAEVRA+ATAKATVAAF ASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG+VKLVVRYTP+VL+EMEARF+K ++ RR
Sbjct:    4 LVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEVRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARR 193          
BLAST of Protein lin-7 homolog vs. UniProt/SwissProt
Match: sp|Q9HAP6|LIN7B_HUMAN (Protein lin-7 homolog B OS=Homo sapiens OX=9606 GN=LIN7B PE=1 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 3.688e-97
Identity = 145/190 (76.32%), Postives = 173/190 (91.05%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+RD+SRAVELLE LQ+  +L P+KL  LQ++LQS FC+ +REVYE +Y+T+DI GSAE+RA+ATAKATVAAF ASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR+GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQG+VKLVVRYTP+VL+EMEARF+K ++ RR
Sbjct:    4 LVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARR 193          
BLAST of Protein lin-7 homolog vs. UniProt/SwissProt
Match: sp|Q2KIB6|LIN7B_BOVIN (Protein lin-7 homolog B OS=Bos taurus OX=9913 GN=LIN7B PE=2 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 1.787e-96
Identity = 144/190 (75.79%), Postives = 173/190 (91.05%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + EPL L+R++SRAVELLE LQ+  +L P+KL  LQ++LQS FC+ +REVYE +Y+T+DI GSAE+RA+ATAKATVAAF ASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR+GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQG+VKLVVRYTP+VL+EMEARF+K ++ RR
Sbjct:    4 LVEPLGLEREVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARR 193          
BLAST of Protein lin-7 homolog vs. UniProt/SwissProt
Match: sp|Q792I0|LIN7C_RAT (Protein lin-7 homolog C OS=Rattus norvegicus OX=10116 GN=Lin7c PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.784e-96
Identity = 149/194 (76.80%), Postives = 174/194 (89.69%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT 635
            + EP+ L+RDI RA+ELLE LQ+  ++ P+KL  LQ++LQS+FCN VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG VKLVVRYTPKVL+EME+RF+K ++ +R   T
Sbjct:    4 LGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT 197          
BLAST of Protein lin-7 homolog vs. TrEMBL
Match: A0A267GC45 (Protein lin-7 homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001331g3 PE=3 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.653e-105
Identity = 166/189 (87.83%), Postives = 177/189 (93.65%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARR 620
            MAEPLTLQ+DI RAVELLE LQ CPD++ EKL  L +ILQSDFCNMVREVYEH+YETVD+ GS EVRA+ATAKATVAAFAA+EGHAHPRVVE+PKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADR G LKRGDQLLSVNG+SVENEHHEKAVDLLKAAQGTVKLVVRYTP+VLDEMEARFDK KARR
Sbjct:    1 MAEPLTLQQDIQRAVELLEKLQSCPDVQHEKLAALSRILQSDFCNMVREVYEHVYETVDVGGSPEVRASATAKATVAAFAAAEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADREGSLKRGDQLLSVNGVSVENEHHEKAVDLLKAAQGTVKLVVRYTPRVLDEMEARFDKHKARR 189          
BLAST of Protein lin-7 homolog vs. TrEMBL
Match: A0A4S2JC47 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011423 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.470e-105
Identity = 161/193 (83.42%), Postives = 183/193 (94.82%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPN 632
            M+EPLTL+RDI+R +ELLE LQ+CP+++P KL+ LQKILQSDFCNMVREVYEH+Y TVDI GS EV+A+ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNG+SVE+EHHE+AV+LLK AQGTVKLVVRYTP++L+EMEARFDKQKARRR  N
Sbjct:    1 MSEPLTLRRDITRVIELLEILQRCPEIQPSKLVALQKILQSDFCNMVREVYEHVYATVDINGSEEVKASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVESEHHERAVELLKLAQGTVKLVVRYTPRILEEMEARFDKQKARRRQLN 193          
BLAST of Protein lin-7 homolog vs. TrEMBL
Match: A0A075A5C3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00613 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.470e-105
Identity = 161/193 (83.42%), Postives = 183/193 (94.82%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPN 632
            M+EPLTL+RDI+R +ELLE LQ+CP+++P KL+ LQKILQSDFCNMVREVYEH+Y TVDI GS EV+A+ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNG+SVE+EHHE+AV+LLK AQGTVKLVVRYTP++L+EMEARFDKQKARRR  N
Sbjct:    1 MSEPLTLRRDITRVIELLEILQRCPEIQPSKLVALQKILQSDFCNMVREVYEHVYATVDINGSEEVKASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVESEHHERAVELLKLAQGTVKLVVRYTPRILEEMEARFDKQKARRRQLN 193          
BLAST of Protein lin-7 homolog vs. TrEMBL
Match: C1LM76 (Lin-7 homolog B OS=Schistosoma japonicum OX=6182 GN=EWB00_010861 PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 2.653e-103
Identity = 158/190 (83.16%), Postives = 180/190 (94.74%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            MAE L+LQRDI+R +ELLE LQ+CP+++P KL  LQ+ILQSDFCNM+REVYEHIY TVDI GS EV+A+ATAKATVAAFAASEGHAHPRV+E+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNG+SVE+EHHE+AV+LLK AQGTVKLVVRYTP++L+EMEARFDKQKARRR
Sbjct:    1 MAESLSLQRDINRVLELLEILQRCPEIQPSKLAALQRILQSDFCNMIREVYEHIYTTVDINGSEEVKASATAKATVAAFAASEGHAHPRVIELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVESEHHERAVELLKLAQGTVKLVVRYTPRILEEMEARFDKQKARRR 190          
BLAST of Protein lin-7 homolog vs. TrEMBL
Match: A0A183QZ91 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.402e-102
Identity = 159/193 (82.38%), Postives = 180/193 (93.26%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPN 632
            MAE L+LQRDI+R +ELLE LQ+CP+++P KL  LQ+ILQSDFC+M+REVYEHIY TVDI GS EV+A+ATAKATVAAFAASEGHAHPRV+E+PKT EGLGFNVMGGKEQNSPIYISRIIPGGVADR+GGLKRGDQLLSVNGISVE+EHHE+AV+LLK AQGTVKLVVRYTP++L+EMEARFDKQKARRR  N
Sbjct:    1 MAESLSLQRDINRVLELLEILQRCPEIQPSKLAALQRILQSDFCDMIREVYEHIYTTVDINGSEEVKASATAKATVAAFAASEGHAHPRVIELPKTNEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGISVESEHHERAVELLKLAQGTVKLVVRYTPRILEEMEARFDKQKARRRQLN 193          
BLAST of Protein lin-7 homolog vs. Ensembl Cavefish
Match: lin7c (lin-7 homolog C (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-041011-2])

HSP 1 Score: 286.96 bits (733), Expect = 4.741e-98
Identity = 152/195 (77.95%), Postives = 178/195 (91.28%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPNT 635
            + EP+ L+RDISRA+ELL+ LQ+  ++ P+KL  LQ++LQS+FCN VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQGTVKLVVRYTPKVL+EME+RF+K + A+RR  N+
Sbjct:   51 LGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEEMESRFEKMRSAKRRQQNS 245          
BLAST of Protein lin-7 homolog vs. Ensembl Cavefish
Match: lin7b (lin-7 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-041011-1])

HSP 1 Score: 229.565 bits (584), Expect = 4.934e-76
Identity = 134/197 (68.02%), Postives = 158/197 (80.20%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDK-QKARRRGPNT*Y 641
            M+EPL L+R   + V             P  L G Q   Q+ + +++++VYE +Y+T+DI G  EVRA ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQG+VKLVVRYTPKVL+EMEARF+K + ARRR  +T Y
Sbjct:   17 MSEPLCLERGHKQMVRY----------SPSGLSGKQ---QNSWFHLLQQVYEQLYDTLDIVGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPKVLEEMEARFEKLRSARRRQQHTSY 200          
BLAST of Protein lin-7 homolog vs. Ensembl Cavefish
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 206.453 bits (524), Expect = 1.572e-66
Identity = 112/144 (77.78%), Postives = 132/144 (91.67%), Query Frame = 3
Query:  192 VREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            V +VY++++ET+ + G  E +A ATAKATVAAFAASEGH+HPRVVE+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ +VKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:   65 VSQVYQYMHETITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARR 208          
BLAST of Protein lin-7 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000041454.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002220.1:44047:49887:-1 gene:ENSAMXG00000032771.1 transcript:ENSAMXT00000041454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 3.325e-24
Identity = 56/92 (60.87%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  375 KEQNSPIYISRIIPGGVADRYGGLKRGDQLLS-VNGI-SVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDK-QKARRRGPNT*Y 641
            + QNSPIYISR+IPGGVADR    KR  QLL  VNG   VE EHHEKA            LVVRYTPKVL+EMEARF+K + ARRR  +T Y
Sbjct:    9 RSQNSPIYISRVIPGGVADRQVDWKRAHQLLCHVNGWGCVEGEHHEKA------------LVVRYTPKVLEEMEARFEKLRSARRRQQHTSY 88          
BLAST of Protein lin-7 homolog vs. Ensembl Cavefish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 79.337 bits (194), Expect = 1.336e-16
Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 3
Query:  315 PRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEAR 596
            PR + + K   GLGFN++GG E    I++S I+ GG AD  G L+RGDQ+LSVNGI +    HE+A   LK A  TV ++ +Y P+     EA+
Sbjct:  372 PRKIVLHKGSTGLGFNIVGG-EDGEGIFVSFILAGGPADLSGELRRGDQILSVNGIDLRGATHEQAAAALKGAGQTVTIIAQYRPEEYGRFEAK 464          

HSP 2 Score: 56.6102 bits (135), Expect = 6.862e-9
Identity = 31/84 (36.90%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQ-----NSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVR 560
            + + +   GLGF++ GG +      +  I+I++IIPGG A   G L+  D +L VN + V    H +AV+ LK A   V+L VR
Sbjct:  126 ITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSRAVEALKVAGSIVRLYVR 209          

HSP 3 Score: 55.0694 bits (131), Expect = 1.810e-8
Identity = 38/86 (44.19%), Postives = 52/86 (60.47%), Query Frame = 3
Query:  321 VVEIP--KTEEGLGFNVMGG-KEQNSP----IYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVV 557
            VVEI   K  +GLGF++ GG   Q+ P    IY+++II GG A + G L+ GD+LL VN  ++E   HE+AV +LK     V L V
Sbjct:  218 VVEIKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTADVVYLKV 303          
BLAST of Protein lin-7 homolog vs. Ensembl Sea Lamprey
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 270.011 bits (689), Expect = 6.237e-93
Identity = 144/180 (80.00%), Postives = 163/180 (90.56%), Query Frame = 3
Query:   84 ISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            I+RA+ELLE LQ+  ++  EKL  LQ++LQS+FC  +REVYEH+YETV I GSAEVRA+ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISRIIPGGVADR GGLKRGDQLLSVNG+SVE EHHEKAV+LLK AQGTVKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:    1 IARAIELLEKLQRSGEVPSEKLQALQRVLQSEFCTAIREVYEHVYETVGISGSAEVRASATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKQAQGTVKLVVRYTPKVLEEMEARFEKLRTARR 180          
BLAST of Protein lin-7 homolog vs. Ensembl Sea Lamprey
Match: LIN7B (lin-7 homolog B, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17788])

HSP 1 Score: 241.891 bits (616), Expect = 4.357e-82
Identity = 133/175 (76.00%), Postives = 156/175 (89.14%), Query Frame = 3
Query:  114 LQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPNT 635
            LQ+  ++    ++ LQK+LQSDFC +VREVYE+IYET+DI G+ E+RA ATAKATVAAFAAS+GHAHPRV E+PKT+EGLGFNVMGGKEQNSPIYISRIIPGGVADR GGLKRGDQLLSVNG+SVE EHHE+AV+LLK AQG+VKLVVRYTPKVL+EMEARF+K + A+RR  +T
Sbjct:    2 LQRSGEVPAHTILALQKVLQSDFCTVVREVYEYIYETLDITGNQEMRALATAKATVAAFAASDGHAHPRV-ELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHERAVELLKQAQGSVKLVVRYTPKVLEEMEARFEKMRTAKRRQQST 175          
BLAST of Protein lin-7 homolog vs. Ensembl Sea Lamprey
Match: gopc (golgi-associated PDZ and coiled-coil motif containing [Source:ZFIN;Acc:ZDB-GENE-030131-5086])

HSP 1 Score: 64.3142 bits (155), Expect = 1.489e-12
Identity = 40/105 (38.10%), Postives = 61/105 (58.10%), Query Frame = 3
Query:  318 RVVEIPKTEEGLGFNVM--GGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKL-VVRYTPKV-LDEMEARFDKQKARR 620
            +V+ +   +EGLG ++   GGKE   PI +S I PG  A+R GGL  GD +L+VNGI++ +  H +AV +L    G ++  VV   P V  D+  A ++ +  RR
Sbjct:  172 KVLLVKADDEGLGISITMKGGKEHGVPIIVSEIHPGLPAERCGGLYVGDAILAVNGINLRDTKHHEAVGILSQQVGEIEFEVVFVAPDVDSDDENAEYEDETGRR 276          
BLAST of Protein lin-7 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003180.1 (pep scaffold:Pmarinus_7.0:GL477326:20216:45383:1 gene:ENSPMAG00000002903.1 transcript:ENSPMAT00000003180.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.138e-12
Identity = 31/80 (38.75%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAA--QGTVKLVV 557
            + + + E G GF ++GG+E   PI I  I+PGG AD  G ++ GD+L+SV+GI V  + H   + L++ A   G V L +
Sbjct:  406 IHLRRQEAGFGFRILGGEELGQPIRIGAIVPGGSADLDGRMRSGDELVSVDGIPVSGKSHRSVIGLMQQAARNGLVALTI 485          

HSP 2 Score: 53.5286 bits (127), Expect = 1.512e-8
Identity = 24/70 (34.29%), Postives = 43/70 (61.43%), Query Frame = 3
Query:  321 VVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKA 530
            V E+ +   G GF++ GGKE +  ++I R+   G A R   ++ GDQ++ +NG S  +  H +A++L+K+
Sbjct:  706 VAELERGNTGFGFSIRGGKEYSMDLFILRVAEEGPAIRQSRMRVGDQIMEINGESTRDMMHARAIELIKS 775          
BLAST of Protein lin-7 homolog vs. Ensembl Sea Lamprey
Match: sntg2 (syntrophin, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-060526-196])

HSP 1 Score: 61.6178 bits (148), Expect = 2.291e-11
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  297 SEGHAHPRVVEIPKTE-EGLGFNVMGGKEQNSPIYISRIIPGGV--ADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKV 575
            S+  A  R V + + E  G G ++ GG E   P+ IS+I+      AD+ G L  GD +L +NGI+VEN  HE+ V +L+ A   V   VRY  K+
Sbjct:   63 SQCSAKERSVTLRRQEIGGFGLSIKGGAEYRVPVVISKIMKDQADPADQTGMLFIGDAILRINGINVENATHEEVVQVLQTAGDEVTFTVRYLRKI 158          
BLAST of Protein lin-7 homolog vs. Ensembl Nematostella
Match: EDO47722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN6])

HSP 1 Score: 273.478 bits (698), Expect = 5.839e-94
Identity = 142/189 (75.13%), Postives = 169/189 (89.42%), Query Frame = 3
Query:   57 AEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
             EPLTL RD++RAVELL+ LQ   ++ P KL  LQK+L+S+FC  +REVYEH+YETV+I+GS E+RA ATAKAT+AAFAASEGHAHPRVVE+PKT+EGLGFNVMGG+EQNSPIYISRIIPGGVADR GGLKRGDQLLSVNG+SVE E+HEKAVDLLK AQG+V+LVV+YTPK+L+EMEARF+ Q+  R+
Sbjct:    4 TEPLTLARDVNRAVELLQKLQNNGNIPPAKLQALQKVLESEFCQAIREVYEHVYETVEIQGSPELRAQATAKATIAAFAASEGHAHPRVVELPKTDEGLGFNVMGGREQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGSVRLVVKYTPKLLEEMEARFNSQRGSRK 192          
BLAST of Protein lin-7 homolog vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 72.0182 bits (175), Expect = 1.941e-14
Identity = 38/92 (41.30%), Postives = 55/92 (59.78%), Query Frame = 3
Query:  297 SEGHAHPRVVEIPKTEEGLGFNVMGGKEQ---NSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRY 563
            SE     +++E+ +  EGLGF+++GG      + PIY+  + P G A R G LKRGDQ+++VNG S+    HE AV  LK  +G + L V Y
Sbjct: 1742 SESPLQTKIIELERGPEGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTVLY 1833          

HSP 2 Score: 55.4546 bits (132), Expect = 6.426e-9
Identity = 35/97 (36.08%), Postives = 54/97 (55.67%), Query Frame = 3
Query:  318 RVVEIPKTEE-GLGFNVMGGKE-QNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRY-----TPKVLDEM 587
            RVVE+ +  E GLG ++ G K  Q   +++  ++      R G LK GDQ+L V+G  + N  HE+AV++++ A+  V+ VVR       P  LD M
Sbjct: 1228 RVVELRREPEVGLGISIAGNKRGQRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVVRTIQDKEDPLSLDTM 1324          

HSP 3 Score: 50.447 bits (119), Expect = 2.986e-7
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  348 GLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVV 557
            GLGF ++GG+  +S + I  I+PGGVAD+ G L+  DQ++ +  ++V     E+   +L+ A   V+LV+
Sbjct:  307 GLGFGIIGGR--SSGVSIKTILPGGVADKDGRLQEHDQIMQIGDVNVGGMGSEQVAQVLRDAGSHVRLVI 374          

HSP 4 Score: 50.0618 bits (118), Expect = 3.618e-7
Identity = 31/74 (41.89%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  348 GLGFNVMGGKEQNSP---IYISRIIPGGVADRYGGLKRGDQLLSVNGISVENE-HHEKAVDLLKAAQGTVKLVV 557
            GLGF+V+G K +N     I+I  I   GVA R G L+  DQ+LS++G  +++   HE+A+ LL+  +G V+L+V
Sbjct:  174 GLGFSVVGLKSENRGELGIFIQEIQEEGVAGRDGRLRESDQILSIDGQQLDSGISHEEAIVLLQKTRGEVELIV 247          

HSP 5 Score: 49.6766 bits (117), Expect = 4.803e-7
Identity = 33/94 (35.11%), Postives = 57/94 (60.64%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQNSP----IYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAA-QGTVKLVVRYTPKVLDEME 590
            VE+ K ++GLGF+++  ++ ++P    I I  ++ GGVA++ G L  GD+L+SVN +++E+   + AV  LK   +G V + V     V D+ E
Sbjct:  937 VELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRGNVIIGVAKPIPVPDDYE 1030          
BLAST of Protein lin-7 homolog vs. Ensembl Nematostella
Match: EDO46649 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA4])

HSP 1 Score: 67.781 bits (164), Expect = 2.888e-13
Identity = 38/90 (42.22%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  303 GHAHPRVVEIPKTE-EGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTP 569
            G   PR V + K + EGLG ++ GGKE   PI IS I  G  A R GGL  GD +L+VNGI +++  H  AV +L +  G + + V Y  
Sbjct:  268 GIGEPRTVIVNKDKTEGLGISITGGKEHGVPILISEIHDGMPAARCGGLYVGDAILAVNGIDLQDAKHNDAVKILSSIHGEITMEVLYVA 357          
BLAST of Protein lin-7 homolog vs. Ensembl Nematostella
Match: EDO42539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S157])

HSP 1 Score: 62.3882 bits (150), Expect = 2.862e-11
Identity = 30/79 (37.97%), Postives = 52/79 (65.82%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVR 560
            +E+ +  +G GF++ GG+E + PIY+ +I  GGVAD  G +K GD++L +NG S ++  H  A+ +++     V+LV+R
Sbjct: 1052 IELIRKNQGYGFSIRGGQEMDMPIYVLKIAEGGVADLDGRIKVGDEVLEINGRSTQHMLHTDAISMIRGGS-KVRLVLR 1129          

HSP 2 Score: 60.4622 bits (145), Expect = 1.268e-10
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAA--QGTVKLVVR 560
            + + + E G GF ++GGKE N+ + I  I+ G  A   G L+RGD++L V+G+SV + +H   + L+K+A   G V L VR
Sbjct:  685 ITLHRGESGFGFRIVGGKEDNTQVAIGTIVDGTPAAADGRLRRGDEILYVDGVSVIDGYHRDVISLMKSAAQNGQVTLGVR 765          

HSP 3 Score: 52.7582 bits (125), Expect = 5.343e-8
Identity = 25/69 (36.23%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKA 530
             E+ K   G GF ++GG +    + I  I+P G A + G L+ GD L+ VNG SV N+ H++ V + ++
Sbjct:  345 TELMKGFRGFGFTIIGGDQSGELLQIKSIVPDGAAAKDGKLRTGDALIKVNGRSVVNKTHQEVVSMFQS 413          
BLAST of Protein lin-7 homolog vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 59.6918 bits (143), Expect = 4.923e-11
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  324 VEIPKTEEGLGFNVMGGKEQ-----NSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLV 554
            + + +   GLGF++ GG +      +  IYI+++IPGG A + G L+  D +LSVNG +  +  H++AVD LKAA   V LV
Sbjct:    7 ITLERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLV 88          

HSP 2 Score: 57.3806 bits (137), Expect = 3.576e-10
Identity = 35/79 (44.30%), Postives = 52/79 (65.82%), Query Frame = 3
Query:  336 KTEEGLGFNVMGGK-EQNSP----IYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVV 557
            K  +GLGF++ GG   Q+ P    IYI++II GG A + G L+ GD+++SVN  ++E+  HE AV +LKA +  V +VV
Sbjct:  106 KGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVV 184          
BLAST of Protein lin-7 homolog vs. Ensembl Medaka
Match: lin7b (lin-7 homolog B, crumbs cell polarity complex component [Source:NCBI gene;Acc:101174999])

HSP 1 Score: 273.092 bits (697), Expect = 6.089e-93
Identity = 148/197 (75.13%), Postives = 171/197 (86.80%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPNT*Y 641
            MAEPL L+RD+ R +ELL+ LQ+  +L P KL  LQ++LQS FC  +REVYE +Y+T+DI G  EVRA ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQG+VKLVVRYTPKVL+EMEARF+K + ARRR  +T Y
Sbjct:   17 MAEPLCLERDVCRVIELLDRLQRTGELPPPKLQALQRVLQSKFCAAIREVYEQLYDTLDIVGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPKVLEEMEARFEKMRSARRRQQHTSY 213          
BLAST of Protein lin-7 homolog vs. Ensembl Medaka
Match: lin7a (lin-7 homolog A, crumbs cell polarity complex component [Source:NCBI gene;Acc:101166430])

HSP 1 Score: 263.462 bits (672), Expect = 3.167e-89
Identity = 139/190 (73.16%), Postives = 168/190 (88.42%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRR 623
            + +PLTL+RD++RA+ELLE LQ+  D+   KL  L+K+LQS+FC  +REVY++++ET+ + G  E +A ATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFNVMGGKEQNSPIYISRIIPGGVA+R+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAA+ TVKLVVRYTPKVL+EMEARF+K +  RR
Sbjct:    4 VVQPLTLERDVARAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDTVKLVVRYTPKVLEEMEARFEKLRTARR 193          
BLAST of Protein lin-7 homolog vs. Ensembl Medaka
Match: lin7b (lin-7 homolog B, crumbs cell polarity complex component [Source:NCBI gene;Acc:101174999])

HSP 1 Score: 253.447 bits (646), Expect = 1.802e-85
Identity = 139/183 (75.96%), Postives = 160/183 (87.43%), Query Frame = 3
Query:   96 VELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPNT*Y 641
            +ELL+ LQ+  +L P KL  LQ++LQS FC  +REVYE +Y+T+DI G  EVRA ATAKATVAAFAASEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQG+VKLVVRYTPKVL+EMEARF+K + ARRR  +T Y
Sbjct:   21 IELLDRLQRTGELPPPKLQALQRVLQSKFCAAIREVYEQLYDTLDIVGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPKVLEEMEARFEKMRSARRRQQHTSY 203          
BLAST of Protein lin-7 homolog vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 253.062 bits (645), Expect = 3.482e-84
Identity = 135/169 (79.88%), Postives = 156/169 (92.31%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVR 560
            + EP+ L+RDI+RA+ELL+ LQ+  ++ P+KL  LQ++LQS+FCN VREVYEH+YETVDI  S EVRANATAKATVAAFAASEGH+HPRVVE+PKTEEGLGFN+MGGKEQNSPIYISRIIPGG+ADR+GGLKRGDQLLSVNG+SVE EHHEKAV+LLKAAQGTVKLVVR
Sbjct:    4 LGEPVRLERDINRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVR 172          
BLAST of Protein lin-7 homolog vs. Ensembl Medaka
Match: lin7b (lin-7 homolog B, crumbs cell polarity complex component [Source:NCBI gene;Acc:101174999])

HSP 1 Score: 243.432 bits (620), Expect = 5.384e-82
Identity = 124/197 (62.94%), Postives = 145/197 (73.60%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQK-ARRRGPNT*Y 641
            MAEPL L+RD+ R +ELL+ LQ+  +L P KL  LQ++LQS FC  +RE     +                          SEGHAHPRVVE+PKT+EGLGFN+MGGKEQNSPIYISR+IPGGVADR GGLKRGDQLLSVNG+SVE E HEKAV+LLKAAQG+VKLVVRYTPKVL+EMEARF+K + ARRR  +T Y
Sbjct:    4 MAEPLCLERDVCRVIELLDRLQRTGELPPPKLQALQRVLQSKFCAAIREATVAAFAA------------------------SEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPKVLEEMEARFEKMRSARRRQQHTSY 176          
BLAST of Protein lin-7 homolog vs. Planmine SMEST
Match: SMESG000057909.1 (SMESG000057909.1)

HSP 1 Score: 362.459 bits (929), Expect = 6.478e-129
Identity = 193/194 (99.48%), Postives = 194/194 (100.00%), Query Frame = 3
Query:   54 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRXXXXXXXXXXXXXXSEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT 635
            MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRA+ATAKATVAAFAASEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT
Sbjct:    1 MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREVYEHIYETVDIEGSAEVRASATAKATVAAFAASEGHAHPRVVEIPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT 194          
BLAST of Protein lin-7 homolog vs. Planmine SMEST
Match: SMESG000005336.1 (SMESG000005336.1)

HSP 1 Score: 67.781 bits (164), Expect = 6.362e-13
Identity = 43/107 (40.19%), Postives = 60/107 (56.07%), Query Frame = 3
Query:  297 SEGHAHPRVVEIPKTEE-GLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKA 614
            S+ +   R++ I K E  GLG ++ GGKE   PI IS+I  G  AD+ G L  GD +LSVNG  + +  H++AV +LK A   V L V+Y    + E+   F K  A
Sbjct:   70 SDINGQKRMIRITKEESNGLGISIKGGKENKMPILISKIFKGMSADKTGELYVGDAILSVNGEDLRDATHDEAVKVLKKAGRIVDLEVKY----MHEVSPYFKKNSA 172          
BLAST of Protein lin-7 homolog vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.451e-12
Identity = 34/108 (31.48%), Postives = 63/108 (58.33%), Query Frame = 3
Query:  315 PRVVEIPKTEE--GLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPN 632
            PR+V + +  E  G GFN++GG++++  I++S IIP G+AD+ G +  GD++  VNG  +    H++A  LLK +  T++L++          E++F+    + +  N
Sbjct:  498 PRIVVLSRPNETVGFGFNIVGGEDEDG-IFVSFIIPSGIADKNGNIFVGDRIWQVNGTDISIATHDEAASLLKGSGKTLELLLTTDMNEYVAFESKFNWNTHKNKDNN 604          

HSP 2 Score: 62.7734 bits (151), Expect = 4.170e-11
Identity = 41/99 (41.41%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  315 PRVVE--IPKTEEGLGFNVMGGKEQ-----NSP-IYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEM 587
            P V+E  I K   G GF+V GG +      N P IY+++I PGG  D  G L   DQ+LSVNGI++    HE AV  LK A   + LV++  P +   M
Sbjct:  172 PIVMEAVILKGSTGFGFSVAGGIDNPYFHLNDPGIYVTKITPGGSVDLSGSLNIDDQILSVNGINMTYLTHEAAVSALKEAGDELHLVIQRDPTLKHRM 270          
BLAST of Protein lin-7 homolog vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.709e-12
Identity = 34/108 (31.48%), Postives = 63/108 (58.33%), Query Frame = 3
Query:  315 PRVVEIPKTEE--GLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPN 632
            PR+V + +  E  G GFN++GG++++  I++S IIP G+AD+ G +  GD++  VNG  +    H++A  LLK +  T++L++          E++F+    + +  N
Sbjct:  510 PRIVVLSRPNETVGFGFNIVGGEDEDG-IFVSFIIPSGIADKNGNIFVGDRIWQVNGTDISIATHDEAASLLKGSGKTLELLLTTDMNEYVAFESKFNWNTHKNKDNN 616          

HSP 2 Score: 62.7734 bits (151), Expect = 4.417e-11
Identity = 41/99 (41.41%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  315 PRVVE--IPKTEEGLGFNVMGGKEQ-----NSP-IYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVRYTPKVLDEM 587
            P V+E  I K   G GF+V GG +      N P IY+++I PGG  D  G L   DQ+LSVNGI++    HE AV  LK A   + LV++  P +   M
Sbjct:  184 PIVMEAVILKGSTGFGFSVAGGIDNPYFHLNDPGIYVTKITPGGSVDLSGSLNIDDQILSVNGINMTYLTHEAAVSALKEAGDELHLVIQRDPTLKHRM 282          
BLAST of Protein lin-7 homolog vs. Planmine SMEST
Match: SMESG000081127.1 (SMESG000081127.1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.126e-11
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  306 HAHPRVVEIPKTEEGLGFNVMGG-------KEQNSPIY-----ISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVV 557
            +  PRVV IPK++ G GFNV G        K  N  +Y     +S ++P G A++  GL + D++L VNG++VE   H++ VDL+K+   T+ L V
Sbjct:   16 YKKPRVVIIPKSQSGFGFNVRGQVGEGGQLKSINGELYAPLQQVSAVLPNGAAEK-AGLLKYDRILEVNGVNVEGATHKQVVDLIKSGGETLILTV 110          
The following BLAST results are available for this feature:
BLAST of Protein lin-7 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIN7B7.679e-9876.32lin-7 homolog B, crumbs cell polarity complex comp... [more]
LIN7C5.796e-9776.80lin-7 homolog C, crumbs cell polarity complex comp... [more]
LIN7A5.432e-8871.50lin-7 homolog A, crumbs cell polarity complex comp... [more]
LIN7C7.264e-8362.37lin-7 homolog C, crumbs cell polarity complex comp... [more]
LIN7A1.703e-6067.55lin-7 homolog A, crumbs cell polarity complex comp... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-73.936e-7867.76pep chromosome:WBcel235:II:14346877:14348792:-1 ge... [more]
lin-75.834e-7667.76pep chromosome:WBcel235:II:14347162:14348792:-1 ge... [more]
dlg-11.062e-1945.36Disks large homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
stn-23.020e-1242.05SynTrophiN [Source:UniProtKB/TrEMBL;Acc:Q5WRR6][more]
stn-23.112e-1242.05SynTrophiN [Source:UniProtKB/TrEMBL;Acc:Q5WRR6][more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
veli1.106e-9579.37gene:FBgn0039269 transcript:FBtr0084787[more]
veli1.061e-8462.50gene:FBgn0039269 transcript:FBtr0301664[more]
dlg19.088e-1946.08gene:FBgn0001624 transcript:FBtr0073488[more]
dlg11.021e-1846.08gene:FBgn0001624 transcript:FBtr0301288[more]
dlg11.084e-1846.08gene:FBgn0001624 transcript:FBtr0073490[more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin7c4.983e-9777.44lin-7 homolog C (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
lin7c9.132e-9775.76lin-7 homolog C (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
lin7b5.440e-9375.13lin-7 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
lin7a4.910e-8872.87lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
lin7b9.614e-6374.13lin-7 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000028683.11.056e-9577.37lin-7 homolog B [Source:NCBI gene;Acc:100491827][more]
ralbp11.077e-9576.80ralA binding protein 1 [Source:Xenbase;Acc:XB-GENE... [more]
lin7a3.803e-8873.16lin-7 homolog A [Source:NCBI gene;Acc:100144984][more]
lin7a6.179e-8474.03lin-7 homolog A [Source:NCBI gene;Acc:100144984][more]
ralbp15.865e-7763.04ralA binding protein 1 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lin7b4.163e-9977.37lin-7 homolog B (C. elegans) [Source:MGI Symbol;Ac... [more]
Lin7c3.979e-9776.80lin-7 homolog C (C. elegans) [Source:MGI Symbol;Ac... [more]
Lin7a3.730e-8871.50lin-7 homolog A (C. elegans) [Source:MGI Symbol;Ac... [more]
Lin7a4.566e-4683.72lin-7 homolog A (C. elegans) [Source:MGI Symbol;Ac... [more]
Lin7a4.566e-4683.72lin-7 homolog A (C. elegans) [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Protein lin-7 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z252|LIN7B_RAT2.444e-9877.37Protein lin-7 homolog B OS=Rattus norvegicus OX=10... [more]
sp|O88951|LIN7B_MOUSE2.912e-9877.37Protein lin-7 homolog B OS=Mus musculus OX=10090 G... [more]
sp|Q9HAP6|LIN7B_HUMAN3.688e-9776.32Protein lin-7 homolog B OS=Homo sapiens OX=9606 GN... [more]
sp|Q2KIB6|LIN7B_BOVIN1.787e-9675.79Protein lin-7 homolog B OS=Bos taurus OX=9913 GN=L... [more]
sp|Q792I0|LIN7C_RAT2.784e-9676.80Protein lin-7 homolog C OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of Protein lin-7 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GC451.653e-10587.83Protein lin-7 homolog OS=Macrostomum lignano OX=28... [more]
A0A4S2JC472.470e-10583.42Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A5C32.470e-10583.42Uncharacterized protein OS=Opisthorchis viverrini ... [more]
C1LM762.653e-10383.16Lin-7 homolog B OS=Schistosoma japonicum OX=6182 G... [more]
A0A183QZ911.402e-10282.38Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin7c4.741e-9877.95lin-7 homolog C (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
lin7b4.934e-7668.02lin-7 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
lin7a1.572e-6677.78lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000041454.13.325e-2460.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
dlg21.336e-1644.68discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin7a6.237e-9380.00lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
LIN7B4.357e-8276.00lin-7 homolog B, crumbs cell polarity complex comp... [more]
gopc1.489e-1238.10golgi-associated PDZ and coiled-coil motif contain... [more]
ENSPMAT00000003180.13.138e-1238.75pep scaffold:Pmarinus_7.0:GL477326:20216:45383:1 g... [more]
sntg22.291e-1138.54syntrophin, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477225.839e-9475.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337061.941e-1441.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466492.888e-1342.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425392.862e-1137.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460594.923e-1140.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein lin-7 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin7b6.089e-9375.13lin-7 homolog B, crumbs cell polarity complex comp... [more]
lin7a3.167e-8973.16lin-7 homolog A, crumbs cell polarity complex comp... [more]
lin7b1.802e-8575.96lin-7 homolog B, crumbs cell polarity complex comp... [more]
lin7c3.482e-8479.8860S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
lin7b5.384e-8262.94lin-7 homolog B, crumbs cell polarity complex comp... [more]
back to top
BLAST of Protein lin-7 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057909.16.478e-12999.48SMESG000057909.1[more]
SMESG000005336.16.362e-1340.19SMESG000005336.1[more]
SMESG000034854.16.451e-1231.48SMESG000034854.1[more]
SMESG000034854.16.709e-1231.48SMESG000034854.1[more]
SMESG000081127.12.126e-1138.54SMESG000081127.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024725 ID=SMED30024725|Name=Protein lin-7 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=722bp
GTTTTATTACAATTTAGAGTTTTTAAATAAACAATTATAAGGAAACTTTT
TAAATGGCTGAGCCATTAACACTACAAAGAGATATATCTAGGGCCGTTGA
ACTTCTTGAGTCATTACAGAAATGTCCGGATTTGAAACCAGAAAAGTTAA
TTGGTTTACAAAAAATTTTGCAGTCCGATTTCTGTAACATGGTCCGAGAA
GTTTATGAACATATTTATGAAACAGTAGATATTGAAGGGTCTGCTGAGGT
TAGAGCTAATGCAACTGCTAAAGCTACTGTAGCGGCTTTTGCTGCCAGTG
AAGGGCATGCACATCCAAGAGTGGTTGAAATTCCAAAAACTGAAGAAGGT
TTAGGCTTTAATGTTATGGGTGGAAAAGAACAAAATTCTCCAATTTATAT
CAGTAGAATTATTCCAGGAGGTGTAGCTGACAGATATGGTGGATTAAAAC
GTGGTGATCAGCTTCTTTCTGTAAATGGAATATCTGTAGAAAATGAACAT
CATGAAAAGGCTGTGGATTTATTAAAAGCTGCTCAAGGAACTGTTAAATT
GGTTGTTCGCTACACTCCTAAAGTTTTGGATGAAATGGAAGCTCGGTTCG
ATAAACAAAAAGCAAGGAGACGCGGACCAAACACTTAATATTTTTAGAAA
TTTATTTTTTTTGCAAACATTGTGATTACCTTTTATCAGTAAATATATTG
TTTAGCTTTAAAAAAAAGATCG
back to top

protein sequence of SMED30024725-orf-1

>SMED30024725-orf-1 ID=SMED30024725-orf-1|Name=SMED30024725-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MAEPLTLQRDISRAVELLESLQKCPDLKPEKLIGLQKILQSDFCNMVREV
YEHIYETVDIEGSAEVRANATAKATVAAFAASEGHAHPRVVEIPKTEEGL
GFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHH
EKAVDLLKAAQGTVKLVVRYTPKVLDEMEARFDKQKARRRGPNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0097025MPP7-DLG1-LIN7 complex
GO:0005911cell-cell junction
GO:0016323basolateral plasma membrane
GO:0045202synapse
GO:0098793presynapse
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0015031protein transport
GO:0007269neurotransmitter secretion
GO:0045199maintenance of epithelial cell apical/basal polarity
GO:1903361protein localization to basolateral plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0097016L27 domain binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR017365LIN7
IPR036034PDZ_sf
IPR036892L27_dom_sf
IPR004172L27_dom
IPR001478PDZ
IPR014775L27_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 98..172
e-value: 4.0E-23
score: 92.8
IPR001478PDZ domainPFAMPF00595PDZcoord: 91..169
e-value: 7.7E-20
score: 71.0
IPR001478PDZ domainPROSITEPS50106PDZcoord: 90..172
score: 22.978
IPR004172L27 domainSMARTSM00569L27_neu3coord: 10..65
e-value: 2.4E-10
score: 50.4
IPR004172L27 domainPROSITEPS51022L27coord: 7..62
score: 16.482
IPR017365Protein lin-7PIRSFPIRSF038039UCP038039_Lin-7_homolcoord: 1..100
e-value: 4.3E-50
score: 168.0
coord: 98..191
e-value: 8.0E-56
score: 186.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.650coord: 5..61
e-value: 1.7E-29
score: 103.1
NoneNo IPR availablePANTHERPTHR14063FAMILY NOT NAMEDcoord: 2..190
NoneNo IPR availablePANTHERPTHR14063:SF5PROTEIN LIN-7 HOMOLOG Ccoord: 2..190
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 88..169
e-value: 3.24909E-29
score: 101.875
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 85..192
e-value: 3.0E-31
score: 109.8
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 85..178
IPR014775L27 domain, C-terminalPFAMPF02828L27coord: 11..63
e-value: 1.2E-18
score: 66.6
IPR036892L27 domain superfamilySUPERFAMILYSSF101288L27 domaincoord: 5..60