Regucalcin

Overview
NameRegucalcin
Smed IDSMED30024718
Length (bp)1049
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regucalcin (SMED30024718) t-SNE clustered cells

Violin plots show distribution of expression levels for Regucalcin (SMED30024718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regucalcin (SMED30024718) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regucalcin (SMED30024718) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30024718SMESG000076123.1 SmedASXL_005269SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30024718SMESG000076123.1 dd_Smed_v4_3808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024718SMESG000076123.1 dd_Smed_v4_3808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regucalcin vs. Ensembl Human
Match: RGN (regucalcin [Source:HGNC Symbol;Acc:HGNC:9989])

HSP 1 Score: 155.221 bits (391), Expect = 3.668e-44
Identity = 102/301 (33.89%), Postives = 153/301 (50.83%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQK--LLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEF--AGSVFRIPGSVHGSSGVAMNYY 967
            GE P W+E +  L  VD      + K+ RW+  TK ++   M      + P S            T    + +LN + Q   +L  VD DK  NRFND K D  G   AGTM++E++P V L  + G+L+     +      D   D+SNGLDW+ +    +++DS +  +  FDYD +   ISN+R          +    PDG+ +D++  LWVAC+  G V++ D  T + LQ + LP   TTSCCFGG  +++MYVT ++ G+  DP+  +    AG +F+I G   G  G+A   Y
Sbjct:   17 GESPVWEEVSNSLLFVDI----PAKKVCRWDSFTKQVQRVTM------DAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGALYSLFPDHHVKKYFDQ-VDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQI----PDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGM--DPEGLLRQPEAGGIFKITG--LGVKGIAPYSY 297          
BLAST of Regucalcin vs. Ensembl Human
Match: RGN (regucalcin [Source:HGNC Symbol;Acc:HGNC:9989])

HSP 1 Score: 155.221 bits (391), Expect = 3.668e-44
Identity = 102/301 (33.89%), Postives = 153/301 (50.83%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQK--LLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEF--AGSVFRIPGSVHGSSGVAMNYY 967
            GE P W+E +  L  VD      + K+ RW+  TK ++   M      + P S            T    + +LN + Q   +L  VD DK  NRFND K D  G   AGTM++E++P V L  + G+L+     +      D   D+SNGLDW+ +    +++DS +  +  FDYD +   ISN+R          +    PDG+ +D++  LWVAC+  G V++ D  T + LQ + LP   TTSCCFGG  +++MYVT ++ G+  DP+  +    AG +F+I G   G  G+A   Y
Sbjct:   17 GESPVWEEVSNSLLFVDI----PAKKVCRWDSFTKQVQRVTM------DAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGALYSLFPDHHVKKYFDQ-VDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQI----PDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGM--DPEGLLRQPEAGGIFKITG--LGVKGIAPYSY 297          
BLAST of Regucalcin vs. Ensembl Human
Match: RGN (regucalcin [Source:HGNC Symbol;Acc:HGNC:9989])

HSP 1 Score: 155.221 bits (391), Expect = 3.668e-44
Identity = 102/301 (33.89%), Postives = 153/301 (50.83%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQK--LLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEF--AGSVFRIPGSVHGSSGVAMNYY 967
            GE P W+E +  L  VD      + K+ RW+  TK ++   M      + P S            T    + +LN + Q   +L  VD DK  NRFND K D  G   AGTM++E++P V L  + G+L+     +      D   D+SNGLDW+ +    +++DS +  +  FDYD +   ISN+R          +    PDG+ +D++  LWVAC+  G V++ D  T + LQ + LP   TTSCCFGG  +++MYVT ++ G+  DP+  +    AG +F+I G   G  G+A   Y
Sbjct:   17 GESPVWEEVSNSLLFVDI----PAKKVCRWDSFTKQVQRVTM------DAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGALYSLFPDHHVKKYFDQ-VDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQI----PDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGM--DPEGLLRQPEAGGIFKITG--LGVKGIAPYSY 297          
BLAST of Regucalcin vs. Ensembl Human
Match: RGN (regucalcin [Source:HGNC Symbol;Acc:HGNC:9989])

HSP 1 Score: 80.1073 bits (196), Expect = 8.041e-17
Identity = 41/100 (41.00%), Postives = 62/100 (62.00%), Query Frame = 2
Query:  674 LPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEF--AGSVFRIPGSVHGSSGVAMNYY 967
            +PDG+ +D++  LWVAC+  G V++ D  T + LQ + LP   TTSCCFGG  +++MYVT ++ G+  DP+  +    AG +F+I G   G  G+A   Y
Sbjct:  130 IPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGM--DPEGLLRQPEAGGIFKITG--LGVKGIAPYSY 225          
BLAST of Regucalcin vs. Ensembl Fly
Match: smp-30 (gene:FBgn0038257 transcript:FBtr0083017)

HSP 1 Score: 126.331 bits (316), Expect = 1.826e-33
Identity = 92/300 (30.67%), Postives = 142/300 (47.33%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSI-VSNKNETFQVDWESLNHENQ--KLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKG-NSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSS-KFGVGGDPDKGIEFAGSVFRIPG-SVHGSSGVAM 958
            GE P+WD   Q L  VD  +   +   F+ N    +    E +  ASF +P  ++     V     T  V W+ ++   +  + LF V  D   NR NDAK D  G    GTM+D    G +     G L+ ++ G    AI    G  +SNGL W+    K +F+D+   ++  +DY+     +SN +V  D           PDG+T+D+  +++VA F  G V + +  T +IL +I +PT   TS  FGG     +YVT++ KF    D  K    AG+ F++ G +  G +GV +
Sbjct:   16 GEGPHWDVDRQSLYYVDLESAGINRYDFKQNKV--YRAKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQWDGVSAVAKVTRTLFEVQPDLKENRLNDAKTDPNGRFYGGTMADS---GDIFTQWKGELYSWQAGGQPNAIRSKVG--ISNGLAWDVKAKKFYFIDTNNHEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVNPSTGKILLEIKIPTTQITSVAFGGPNLDILYVTTANKF----DQPKP---AGTTFQVTGLNAKGYAGVNL 301          
BLAST of Regucalcin vs. Ensembl Fly
Match: smp-30 (gene:FBgn0038257 transcript:FBtr0336878)

HSP 1 Score: 126.331 bits (316), Expect = 1.826e-33
Identity = 92/300 (30.67%), Postives = 142/300 (47.33%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSI-VSNKNETFQVDWESLNHENQ--KLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKG-NSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSS-KFGVGGDPDKGIEFAGSVFRIPG-SVHGSSGVAM 958
            GE P+WD   Q L  VD  +   +   F+ N    +    E +  ASF +P  ++     V     T  V W+ ++   +  + LF V  D   NR NDAK D  G    GTM+D    G +     G L+ ++ G    AI    G  +SNGL W+    K +F+D+   ++  +DY+     +SN +V  D           PDG+T+D+  +++VA F  G V + +  T +IL +I +PT   TS  FGG     +YVT++ KF    D  K    AG+ F++ G +  G +GV +
Sbjct:   16 GEGPHWDVDRQSLYYVDLESAGINRYDFKQNKV--YRAKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQWDGVSAVAKVTRTLFEVQPDLKENRLNDAKTDPNGRFYGGTMADS---GDIFTQWKGELYSWQAGGQPNAIRSKVG--ISNGLAWDVKAKKFYFIDTNNHEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVNPSTGKILLEIKIPTTQITSVAFGGPNLDILYVTTANKF----DQPKP---AGTTFQVTGLNAKGYAGVNL 301          
BLAST of Regucalcin vs. Ensembl Fly
Match: smp-30 (gene:FBgn0038257 transcript:FBtr0083016)

HSP 1 Score: 126.331 bits (316), Expect = 1.826e-33
Identity = 92/300 (30.67%), Postives = 142/300 (47.33%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSI-VSNKNETFQVDWESLNHENQ--KLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKG-NSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSS-KFGVGGDPDKGIEFAGSVFRIPG-SVHGSSGVAM 958
            GE P+WD   Q L  VD  +   +   F+ N    +    E +  ASF +P  ++     V     T  V W+ ++   +  + LF V  D   NR NDAK D  G    GTM+D    G +     G L+ ++ G    AI    G  +SNGL W+    K +F+D+   ++  +DY+     +SN +V  D           PDG+T+D+  +++VA F  G V + +  T +IL +I +PT   TS  FGG     +YVT++ KF    D  K    AG+ F++ G +  G +GV +
Sbjct:   16 GEGPHWDVDRQSLYYVDLESAGINRYDFKQNKV--YRAKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQWDGVSAVAKVTRTLFEVQPDLKENRLNDAKTDPNGRFYGGTMADS---GDIFTQWKGELYSWQAGGQPNAIRSKVG--ISNGLAWDVKAKKFYFIDTNNHEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVNPSTGKILLEIKIPTTQITSVAFGGPNLDILYVTTANKF----DQPKP---AGTTFQVTGLNAKGYAGVNL 301          
BLAST of Regucalcin vs. Ensembl Fly
Match: smp-30 (gene:FBgn0038257 transcript:FBtr0336877)

HSP 1 Score: 125.946 bits (315), Expect = 2.576e-33
Identity = 92/300 (30.67%), Postives = 142/300 (47.33%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSI-VSNKNETFQVDWESLNHENQ--KLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKG-NSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSS-KFGVGGDPDKGIEFAGSVFRIPG-SVHGSSGVAM 958
            GE P+WD   Q L  VD  +   +   F+ N    +    E +  ASF +P  ++     V     T  V W+ ++   +  + LF V  D   NR NDAK D  G    GTM+D    G +     G L+ ++ G    AI    G  +SNGL W+    K +F+D+   ++  +DY+     +SN +V  D           PDG+T+D+  +++VA F  G V + +  T +IL +I +PT   TS  FGG     +YVT++ KF    D  K    AG+ F++ G +  G +GV +
Sbjct:   19 GEGPHWDVDRQSLYYVDLESAGINRYDFKQNKV--YRAKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQWDGVSAVAKVTRTLFEVQPDLKENRLNDAKTDPNGRFYGGTMADS---GDIFTQWKGELYSWQAGGQPNAIRSKVG--ISNGLAWDVKAKKFYFIDTNNHEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVNPSTGKILLEIKIPTTQITSVAFGGPNLDILYVTTANKF----DQPKP---AGTTFQVTGLNAKGYAGVNL 304          
BLAST of Regucalcin vs. Ensembl Fly
Match: regucalcin (gene:FBgn0030362 transcript:FBtr0073575)

HSP 1 Score: 125.176 bits (313), Expect = 5.150e-33
Identity = 82/277 (29.60%), Postives = 133/277 (48.01%), Query Frame = 2
Query:   53 LANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCS--DQRYSIVSNKNETFQVDWESLNHENQ--KLLFAVDIDKPLNRFNDAKCDKKGVLVAGTM---SDESSPGVVLNPNGGSLFKYKKGNSEAIVM-DTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSS 859
            L + +   GE P+WD   Q L  VD    +GS   + +     +    E +  A F +P     Q +++   +     V+W+ ++   +  + LF V      NR NDAK D +G    GTM    DE           G L++++ G   +++  D G  +SNGL W+    K +++D+   ++  +DYD E    SN +V  +    S  D  LPDGLT+D++ +L+VA F    + + +  T +IL +I  PTK  TS  FGG     +YVT++
Sbjct:    8 LPDSYAGLGEGPHWDVARQSLYYVD--LEAGSLLRYDYAQNKVYKTKIEGETLAGFVLPVEGRPQEFAVGCGRRVVI-VNWDGVSPSAKVVRTLFEVQPLMEKNRLNDAKVDPRGRFFGGTMRYIGDE------FEFRHGELYRWEAGGQVSVIKGDVG--ISNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPKVIFNLRKNSPKDHLLPDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKFPTKQITSAAFGGPNLDILYVTTA 273          
BLAST of Regucalcin vs. Ensembl Zebrafish
Match: rgn (regucalcin [Source:NCBI gene;Acc:403070])

HSP 1 Score: 160.614 bits (405), Expect = 1.962e-46
Identity = 96/286 (33.57%), Postives = 145/286 (50.70%), Query Frame = 2
Query:   74 TGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDI-DKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
             GE P W+E++  L  VD        K+ RW+  TK ++S   +K     +P     Y I      TF VDW       + +    ++ +KP  RFND K D  G   AGTMS +  P VV      +L+  +  +S     D  + LSNGLDW+ +    +++DS A  +  FDYD +   +SN+R           D G+PDG+ +D++  LWVACF  G V++ D +T + LQ + LP +  TSCCFGG  ++D+Y+TS+  G+  +       AG  F++ G
Sbjct:   16 VGESPVWEEKDSSLLYVDIT----GQKVSRWSSLTKQIESMNTEKLVGCVVPRQAGGYVIAEGTRFTF-VDWV-----KRSITAVAEVNEKPNTRFNDGKVDPAGRFFAGTMSMDMKPDVV----DAALYNLQPDHSVVRHFDQVH-LSNGLDWSLDHRVFYYIDSLAFMVEAFDYDIQTGGLSNRRTVYKMEK----DEGIPDGMCIDTEGKLWVACFNGGRVLRIDPQTGKRLQTVKLPAERITSCCFGGKDYSDLYITSAYIGMDAEALAKQPEAGCTFKVTG 282          
BLAST of Regucalcin vs. Ensembl Zebrafish
Match: rgn (regucalcin [Source:NCBI gene;Acc:403070])

HSP 1 Score: 159.073 bits (401), Expect = 8.578e-46
Identity = 95/286 (33.22%), Postives = 144/286 (50.35%), Query Frame = 2
Query:   74 TGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDI-DKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
             GE P W+E++  L  VD        K+ RW+  TK ++S   +K     +P     Y I       F VDW       + +    ++ +KP  RFND K D  G   AGTMS +  P VV      +L+  +  +S     D  + LSNGLDW+ +    +++DS A  +  FDYD +   +SN+R           D G+PDG+ +D++  LWVACF  G V++ D +T + LQ + LP +  TSCCFGG  ++D+Y+TS+  G+  +       AG  F++ G
Sbjct:   16 VGESPVWEEKDSSLLYVDIT----GQKVSRWSSLTKQIESMNTEKLVGCVVPRQAGGYVIAEGTRFAF-VDWV-----KRSITAVAEVNEKPNTRFNDGKVDPAGRFFAGTMSMDMKPDVV----DAALYNLQPDHSVVRHFDQVH-LSNGLDWSLDHRVFYYIDSLAFMVEAFDYDIQTGGLSNRRTVYKMEK----DEGIPDGMCIDTEGKLWVACFNGGRVLRIDPQTGKRLQTVKLPAERITSCCFGGKDYSDLYITSAYIGMDAEALAKQPEAGCTFKVTG 282          
BLAST of Regucalcin vs. Ensembl Xenopus
Match: jade3 (jade family PHD finger 3 [Source:NCBI gene;Acc:779948])

HSP 1 Score: 172.555 bits (436), Expect = 7.920e-51
Identity = 109/308 (35.39%), Postives = 165/308 (53.57%), Query Frame = 2
Query:   38 NMEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVA 955
             +E V++  ++  GE P W+E++  L  VD        K+ RW+P TK ++S  ++      +      Y  V     TF     +LN ++Q +  L  VD DKP NRFND K D +G  +AGTMS E  P VV   N GSLF     +S     D   D+SNGLDW+ +   ++++DS + ++   DYD +    SN+R           D G+PDG+ +D++  LWVAC+  G V++ D ET + +Q + LP   TTSCCFGG  +++MYVTS+  G+  +  K    +G +++I G   G  G+A
Sbjct:    7 KIECVVSETYK-IGESPVWEEKDGTLLFVDIT----GQKVCRWDPGTKKVQSVSLEAPVGSVVLRKSGGY--VMAMGNTFS----ALNWQDQSVTTLTCVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPAVV-ERNQGSLFTLYPDHSVVKHFDM-VDISNGLDWSLDHKTLYYIDSLSFKVDALDYDMKTGKSSNRRTLYKLQQ----DEGIPDGMCIDAEGKLWVACYNGGRVIRIDPETGKQIQTVKLPVDKTTSCCFGGPDYSEMYVTSACEGMDEEWKKRQPQSGGIYKITG--LGVKGIA 295          
BLAST of Regucalcin vs. Ensembl Xenopus
Match: jade3 (jade family PHD finger 3 [Source:NCBI gene;Acc:779948])

HSP 1 Score: 169.859 bits (429), Expect = 8.758e-50
Identity = 105/300 (35.00%), Postives = 163/300 (54.33%), Query Frame = 2
Query:   41 MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQV----DWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRI 922
            +E V++  ++  GE P W+E++  L  VD        K+ RW+P TK ++S       S   P      S+V  K+  + +     + +LN ++Q +  L  VD DKP NRFND K D +G  +AGTMS E  P VV   N GSLF     +S     D   D+SNGLDW+ +   ++++DS + ++   DYD +    SN+R           D G+PDG+ +D++  LWVAC+  G V++ D ET + +Q + LP   TTSCCFGG  +++MYVTS+  G+  +  K    +G ++++
Sbjct:    6 IECVVSETYK-IGESPVWEEKDGTLLFVDIT----GQKVCRWDPGTKKVQS------VSLEAPVG----SVVLRKSGGYVMAMGNTFSALNWQDQSVTTLTCVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPAVV-ERNQGSLFTLYPDHSVVKHFDM-VDISNGLDWSLDHKTLYYIDSLSFKVDALDYDMKTGKSSNRRTLYKLQQ----DEGIPDGMCIDAEGKLWVACYNGGRVIRIDPETGKQIQTVKLPVDKTTSCCFGGPDYSEMYVTSACEGMDEEWKKRQPQSGGIYKV 284          
BLAST of Regucalcin vs. Ensembl Xenopus
Match: jade3 (jade family PHD finger 3 [Source:NCBI gene;Acc:779948])

HSP 1 Score: 169.474 bits (428), Expect = 1.119e-49
Identity = 105/300 (35.00%), Postives = 163/300 (54.33%), Query Frame = 2
Query:   41 MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQV----DWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRI 922
            +E V++  ++  GE P W+E++  L  VD        K+ RW+P TK ++S       S   P      S+V  K+  + +     + +LN ++Q +  L  VD DKP NRFND K D +G  +AGTMS E  P VV   N GSLF     +S     D   D+SNGLDW+ +   ++++DS + ++   DYD +    SN+R           D G+PDG+ +D++  LWVAC+  G V++ D ET + +Q + LP   TTSCCFGG  +++MYVTS+  G+  +  K    +G ++++
Sbjct:    8 IECVVSETYK-IGESPVWEEKDGTLLFVDIT----GQKVCRWDPGTKKVQS------VSLEAPVG----SVVLRKSGGYVMAMGNTFSALNWQDQSVTTLTCVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPAVV-ERNQGSLFTLYPDHSVVKHFDM-VDISNGLDWSLDHKTLYYIDSLSFKVDALDYDMKTGKSSNRRTLYKLQQ----DEGIPDGMCIDAEGKLWVACYNGGRVIRIDPETGKQIQTVKLPVDKTTSCCFGGPDYSEMYVTSACEGMDEEWKKRQPQSGGIYKV 286          
BLAST of Regucalcin vs. Ensembl Xenopus
Match: commd2 (COMM domain containing 2 [Source:Xenbase;Acc:XB-GENE-955244])

HSP 1 Score: 110.923 bits (276), Expect = 1.439e-27
Identity = 80/292 (27.40%), Postives = 131/292 (44.86%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVD--ACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTM--SDESSPGVV--LNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDW--NANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQ-FDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIP 925
            GE   W  R Q L  VD  AC      ++ RW P     + +   +  S  +    Q   ++      F + ++       + L   + D+  NRFND KCD +G   AG+M  + E+  G +  L+P+G               +D G+ ++NG  W    +G  ++F D+     Y + +D      SNK + + +      ++GLPDG+T D++  LWVA  W GA V   D  T + L ++ LP    T+C FGG     +++T+++ G+          AG VF +P
Sbjct:   11 GEGLLWSVREQTLYWVDILAC------QLHRWKPADGTCQHWTFAEEIS-ALAERAQAPGLIVTLRRGFAL-FDPATDTAPRYLHQPEPDRTRNRFNDGKCDAQGRFWAGSMDFAGEAPTGALYRLDPDG-----------RCTRVDDGFTVTNGPTWAYGPHGPALYFNDTAQGHTYRYAFDPATGTASNKTLWMHW----PPEVGLPDGMTADAEGRLWVA-HWGGACVTCHDPVTTQELARVPLPVSQVTNCTFGGPDLRTLFITTARTGLTPQQRAAEPLAGGVFAVP 278          
BLAST of Regucalcin vs. Ensembl Xenopus
Match: jade3 (jade family PHD finger 3 [Source:NCBI gene;Acc:779948])

HSP 1 Score: 93.2041 bits (230), Expect = 4.344e-20
Identity = 67/193 (34.72%), Postives = 101/193 (52.33%), Query Frame = 2
Query:   41 MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQV----DWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYD 601
            +E V++  ++  GE P W+E++  L  VD        K+ RW+P TK ++S       S   P      S+V  K+  + +     + +LN ++Q +  L  VD DKP NRFND K D +G  +AGTMS E  P VV   N GSLF     +S     D   D+SNGLDW+ +   ++++DS + ++   DYD
Sbjct:  665 IECVVSETYK-IGESPVWEEKDGTLLFVDI----TGQKVCRWDPGTKKVQS------VSLEAPVG----SVVLRKSGGYVMAMGNTFSALNWQDQSVTTLTCVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPAVV-ERNQGSLFTLYPDHSVVKHFDM-VDISNGLDWSLDHKTLYYIDSLSFKVDALDYD 840          
BLAST of Regucalcin vs. Ensembl Mouse
Match: Rgn (regucalcin [Source:MGI Symbol;Acc:MGI:108024])

HSP 1 Score: 166.392 bits (420), Expect = 1.416e-48
Identity = 105/299 (35.12%), Postives = 156/299 (52.17%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVAMNYY 967
            GE P W+E +Q L  VD      S  I RW+  +  ++        + + P S      +     T    + +LN ENQ +  L  VD DK  NRFND K D  G   AGTM++E++P V L  + GSL+     +S     D   D+SNGLDW+ +    +++DS +  +  FDYD +   ISN+R+          D  +PDG+ +D++  LWVAC+  G V++ D ET + LQ + LP   TTSCCFGG  +++MYVT ++ G+  +       AG++F+I G   G  G+A   Y
Sbjct:   17 GESPVWEEASQSLLFVDI----PSKIICRWDTVSNQVQR------VAVDAPVSSVALRQLGGYVATIGTKFCALNWENQSVFVLAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGSLYSLFPDHSVKKYFDQ-VDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLQTGQISNRRIVYKMEK----DEQIPDGMCIDAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGLNAEGLLRQPDAGNIFKITG--LGVKGIAPYSY 297          
BLAST of Regucalcin vs. UniProt/SwissProt
Match: sp|Q9I922|RGN_XENLA (Regucalcin OS=Xenopus laevis OX=8355 GN=rgn PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.293e-51
Identity = 111/308 (36.04%), Postives = 165/308 (53.57%), Query Frame = 2
Query:   38 NMEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVA 955
             +E V++  ++  GE P W+E+   L  VD        K+ RW+P+TK ++S  ++  A        +    V     TF     +LN E+Q +  L  VD DKP NRFND K D +G  +AGTMS E  P VV   N GSLF     +S     D   D+SNGLDW+ +   ++++DS + ++   DYD +    SN+R           D G+PDG+ +D++  LWVAC+  G V++ D ET + +Q + LP   TTSCCFGG  +++MYVTS+  G+  D  K    +G +++I G   G  G+A
Sbjct:    5 KIECVVSETYK-IGESPVWEEKEGTLLFVDIT----GQKVCRWDPSTKKVQSVSVE--APIGSVALRKSGGYVLAMGNTFS----ALNWEDQSVTTLARVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPAVV-ERNQGSLFTLYPDHSVVKHFDM-VDISNGLDWSLDHKTLYYIDSLSFKVDALDYDMKTGKSSNRRTLYKLQQ----DEGIPDGMCIDAEGKLWVACYNGGRVIRIDPETGKQIQTVKLPIDKTTSCCFGGPDYSEMYVTSACDGMDEDWKKRQPQSGGIYKITG--LGVKGIA 293          
BLAST of Regucalcin vs. UniProt/SwissProt
Match: sp|Q6DF62|RGN_XENTR (Regucalcin OS=Xenopus tropicalis OX=8364 GN=rgn PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.690e-50
Identity = 109/308 (35.39%), Postives = 165/308 (53.57%), Query Frame = 2
Query:   38 NMEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVA 955
             +E V++  ++  GE P W+E++  L  VD        K+ RW+P TK ++S  ++      +      Y  V     TF     +LN ++Q +  L  VD DKP NRFND K D +G  +AGTMS E  P VV   N GSLF     +S     D   D+SNGLDW+ +   ++++DS + ++   DYD +    SN+R           D G+PDG+ +D++  LWVAC+  G V++ D ET + +Q + LP   TTSCCFGG  +++MYVTS+  G+  +  K    +G +++I G   G  G+A
Sbjct:    5 KIECVVSETYK-IGESPVWEEKDGTLLFVDIT----GQKVCRWDPGTKKVQSVSLEAPVGSVVLRKSGGY--VMAMGNTFS----ALNWQDQSVTTLTCVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPAVV-ERNQGSLFTLYPDHSVVKHFDM-VDISNGLDWSLDHKTLYYIDSLSFKVDALDYDMKTGKSSNRRTLYKLQQ----DEGIPDGMCIDAEGKLWVACYNGGRVIRIDPETGKQIQTVKLPVDKTTSCCFGGPDYSEMYVTSACEGMDEEWKKRQPQSGGIYKITG--LGVKGIA 293          
BLAST of Regucalcin vs. UniProt/SwissProt
Match: sp|Q9TTJ6|RGN_RABIT (Regucalcin OS=Oryctolagus cuniculus OX=9986 GN=RGN PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.882e-48
Identity = 102/286 (35.66%), Postives = 146/286 (51.05%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E +  L  VD        K  RWNP TK ++   M      + P +            T    + +LN E+Q +  L  VD DK  NRFND K D  G   AGTM++E++P V L  + GSL+     +      D   D+SNGLDW+ +    +++DS A  +  FDYD +   ISN+R          +    PDG+ +D++  LWVAC+  G V++ D ET + LQ + LP   TTSCCFGG  +++MYVT ++ G+  D       AG +F+I G
Sbjct:   17 GESPVWEEASGSLLFVDI----PGKKFCRWNPLTKAVQRMTM------DAPVTSVALRKSGGYVATVGTKFCALNLEDQSVVALATVDKDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGSLYALFPDHQVKKYFDQ-VDISNGLDWSLDHKIFYYIDSLAYSVDAFDYDLQTGQISNRRSIYKLEKEEQI----PDGMCIDTEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGLDPDSLSRQPEAGGIFKITG 286          
BLAST of Regucalcin vs. UniProt/SwissProt
Match: sp|Q64374|RGN_MOUSE (Regucalcin OS=Mus musculus OX=10090 GN=Rgn PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 9.904e-48
Identity = 105/299 (35.12%), Postives = 156/299 (52.17%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVAMNYY 967
            GE P W+E +Q L  VD      S  I RW+  +  ++        + + P S      +     T    + +LN ENQ +  L  VD DK  NRFND K D  G   AGTM++E++P V L  + GSL+     +S     D   D+SNGLDW+ +    +++DS +  +  FDYD +   ISN+R+          D  +PDG+ +D++  LWVAC+  G V++ D ET + LQ + LP   TTSCCFGG  +++MYVT ++ G+  +       AG++F+I G   G  G+A   Y
Sbjct:   17 GESPVWEEASQSLLFVDI----PSKIICRWDTVSNQVQR------VAVDAPVSSVALRQLGGYVATIGTKFCALNWENQSVFVLAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGSLYSLFPDHSVKKYFDQ-VDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLQTGQISNRRIVYKMEK----DEQIPDGMCIDAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGLNAEGLLRQPDAGNIFKITG--LGVKGIAPYSY 297          
BLAST of Regucalcin vs. UniProt/SwissProt
Match: sp|Q06AA3|RGN_PIG (Regucalcin OS=Sus scrofa OX=9823 GN=RGN PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.526e-45
Identity = 100/288 (34.72%), Postives = 150/288 (52.08%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQK--LLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEF--AGSVFRIPG 928
            GE P W E +  L  VD      + K+ RWN  +K ++        + + P S            T    + +LN E++   +L AVD DK  NRFND K D  G   AGTM++E++P V L  + GSL+     +      D   D+SNGLDW+ +    +++DS +  +  FDYD +   ISN+R          +    PDG+ +D++  LWVAC+  G V++ D ET + LQ + LP   TTSCCFGG  +++MYVT ++ G+  DP   ++   AG +F+I G
Sbjct:   17 GESPVWGEASNSLLFVDI----PAKKVCRWNALSKQVQR------VTLDAPVSSVALRQAGGYVATVGTKFCALNWEDESAVVLAAVDKDKKNNRFNDGKVDPAGRYFAGTMAEETAPAV-LERHQGSLYALFADHHVEKYFDQ-VDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGKISNRRSIYKMEKEEHI----PDGMCIDTEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGL--DPQGLLQQPEAGGIFKITG 286          
BLAST of Regucalcin vs. TrEMBL
Match: K1QCP2 (Regucalcin OS=Crassostrea gigas OX=29159 GN=CGI_10015437 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 5.615e-58
Identity = 118/314 (37.58%), Postives = 170/314 (54.14%), Query Frame = 2
Query:   38 NMEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPL-NRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNG--GSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVAMNYYQ 970
            ++EVV+ N  +  GE P+WD+R   L  VD      S+ + RW+P T   +   +     F +PC    Y IV        VDW+S     +K+    ++DK   NRFND KCD +G + AGTM  ES P    NP    GSLF+     S    ++   ++SNGL W A+   M+++DS  R++Y FDYD E  NISN+RV +DF   +   LG PDG+ +D+++ +WVAC+ A  +V+FD  T + L+ + +P   TTSCCFGG  F ++YVT    G   +  +     GSVFR+ G   G  G   N Y+
Sbjct:    2 SVEVVVKNSCQSIGEGPHWDDRTNSLLYVDIL----SNDVHRWSPDTGNDEKIHLDDSVGFVVPCRKGGY-IVGLGRSLSHVDWDS-----RKITKLHEVDKGTKNRFNDGKCDPRGRVWAGTMGYESEPA---NPERERGSLFRLDVDGSLHACVNK-INISNGLAWTADNKTMYYIDSLPRKVYGFDYDIETGNISNQRVVVDFGEGTIPTLGYPDGMCIDTEDKIWVACYGAAKIVRFDPTTGKQLKTVDIPAIRTTSCCFGGKNFDELYVTCGVQGSTEEEREKYPMTGSVFRVTGL--GVRGRPANVYE 299          
BLAST of Regucalcin vs. TrEMBL
Match: V4C5A2 (SGL domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_207903 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.226e-56
Identity = 105/305 (34.43%), Postives = 171/305 (56.07%), Query Frame = 2
Query:   29 IKSNMEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWES----LNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIE-FAGSVFRIPG 928
            +   +EVV+ +  +  GE P+W ++ Q L  VD      S+ +  WNP T    S    +  +  +P       I+S  ++  ++ W S    + HE    +          R+ND KCD +G L+AGTM  E++P V L P  G+L+       +   + +   LSNGL W A+  K +F+DS  R++Y+FDY+++N   +N+R  IDF +Y   DLGLPDG+ +D+++ +W+AC+ AG VV+FD ET+++L+ + +  K TTS CFGG    ++YVTS+  G+  +  K  +  AGS+F++ G
Sbjct:    1 MTEKVEVVVKHAAKTVGEGPHWVDKTQSLLYVDIF----SNDLHHWNPATNKTSSLHFDEYVTLVVPTEKDDEYIISQGSKLAKLQWSSKKVEVLHEAGAGV----------RYNDGKCDPRGRLLAGTMGLETAPAV-LPPGMGNLYSLDI-QGKVTKLASNITLSNGLAWTADTKKFYFIDSTPRKVYLFDYNADNGQATNQRTVIDFADYD--DLGLPDGMAIDTEDKIWIACYSAGKVVRFDPETKKLLKVVKIDAKQTTSVCFGGPNLDELYVTSAAMGLTEEELKAKDPLAGSIFKVTG 287          
BLAST of Regucalcin vs. TrEMBL
Match: A0A3Q3XQZ0 (Regucalcin OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.872e-56
Identity = 113/284 (39.79%), Postives = 146/284 (51.41%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E  Q L  VD        KI RW+PTT  ++S        F +P     Y +         VDW +   +    L  VD DKP NR ND K D  G L+AGTM+ E  P VV    G SLF    G +    +D   D+SNGLDW+++    F++DS +  +  FDYDS   +I N+RV            GLPDG+T+D K +LWVAC+  G V+  D  T   LQ +SLP   TTSCCFGG  +TD+YVTS+  G+     K    AG  FR+ G
Sbjct:   17 GEGPVWEESGQTLLFVDIA----GQKIHRWDPTTNRIQSVATGDMVGFAVPRRSGGY-VAGVGRSIVAVDWST---QMMTSLAEVDEDKPNNRLNDGKVDPTGRLLAGTMAKEVRPAVVERQQG-SLFSVTSGLTVTKHLDE-VDISNGLDWSSDHKTFFYIDSLSLTVDAFDYDSNTGHIGNRRVVYRMEEGE----GLPDGMTVDVKGNLWVACYDGGRVINIDPATGVRLQTVSLPVMKTTSCCFGGRDYTDLYVTSASVGLNQSEWKHQPLAGDTFRVTG 286          
BLAST of Regucalcin vs. TrEMBL
Match: A0A3Q0T7M0 (Regucalcin OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 7.476e-55
Identity = 108/286 (37.76%), Postives = 146/286 (51.05%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKL--LFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E +Q L  VD        KI RW+PTT  ++S E      F +P     Y +         VDW +     QK+  L  VD DKP NR ND K D  G L+ GTM     PG       G+LF     +   I   +  D+SNG+DW+ +    F++DS +  +  FDYD    +I N+RV            GLPDG+T+D++ HLWVAC+  G V+  DL T   LQ ISLP   TTSCCFGG  ++++YVTS+  G+     +    AG+ FR+ G
Sbjct:   17 GEGPVWEESDQTLLFVDIA----GQKIHRWSPTTNQIQSMETADTVGFAVPRRSGGY-VAGVGRSIVAVDWSA-----QKVNSLVEVDKDKPNNRLNDGKADPSGRLLTGTMLKNEQPG---QQKQGALFSVAS-DLTVIKHLSKVDISNGMDWSQDQKTFFYIDSLSLTVDAFDYDPNTGHIGNRRVVYHMEEGE----GLPDGMTLDAEGHLWVACYNGGRVISIDLATGVRLQTISLPATKTTSCCFGGPDYSELYVTSASLGLNQSELRQQPLAGNTFRVTG 284          
BLAST of Regucalcin vs. TrEMBL
Match: A0A1A8S7Q3 (Regucalcin OS=Nothobranchius rachovii OX=451742 GN=RGN PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.617e-54
Identity = 108/286 (37.76%), Postives = 150/286 (52.45%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMD--TGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E  Q L  VD        KI RW+PTT  ++S E      F +P     Y +         +DW +   E    L  +D DKP NR ND K D  G L+AGTM  E  P  V    G SL+     NSE +V    +  D+SNGL+W+ +    F++DS A  +  FDY+S   ++SN+RV            GLPDG+T+D++ +LWVAC+  G V++ D  T + LQ +SLP   TTSCCFGG  ++D+YVTS+  G+          +G+ FR+ G
Sbjct:   18 GEGPVWEESKQTLLFVDIA----GQKIHRWSPTTCQIQSIETDDTVGFAVPRKSSGY-VAGVGRSIVAIDWST---EVMTSLVDIDEDKPNNRLNDGKVDPMGRLLAGTMGKEEQPAQVQKKQG-SLYSV---NSEYLVTKHLSKVDISNGLEWSLDQKTFFYIDSLALSVDAFDYNSSTGHLSNRRVVYHMEEGE----GLPDGMTIDAEGNLWVACYNGGRVIRIDPTTGKRLQTVSLPVMKTTSCCFGGPDYSDLYVTSASLGLSKSERNQQPLSGNTFRVKG 287          
BLAST of Regucalcin vs. Ensembl Cavefish
Match: rgn (regucalcin [Source:NCBI gene;Acc:103028139])

HSP 1 Score: 161.77 bits (408), Expect = 5.558e-47
Identity = 100/284 (35.21%), Postives = 140/284 (49.30%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E++  L  VD        +I RW+  T  ++S   +      +P     Y I+        VDW+  +    K    VD DK   RFND K D  G   AGTM  E  P VV     GSL+     +S     D   DLSNGLDW+ +    +++DS    +  FDYD +   ISN+R+          D G+PDG+ +D++  LWVAC+    V++ D +T   LQ + LP   TTSCCFGG  +TD+YVTS+  G+  +       AG +FR+ G
Sbjct:   17 GESPVWEEKDSTLLYVDIY----GLRISRWSSLTNQIESMPTEAYVGCVVPRRSGGY-IIGEGTRFAAVDWQKRSITTIK---HVDTDKGNTRFNDGKVDPAGRFFAGTMGIEVRPAVV-EMKQGSLYSLHPDHSVVRHFDQ-VDLSNGLDWSPDHRFFYYIDSLKYTVDAFDYDIQTGGISNRRMVYRLEK----DEGIPDGMCIDAEGKLWVACYSGARVIRIDPQTGTRLQTVKLPAAKTTSCCFGGKDYTDLYVTSAYKGMDEESRAQQPEAGCIFRVSG 286          
BLAST of Regucalcin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005962.1 (pep scaffold:Pmarinus_7.0:GL487933:5047:7237:1 gene:ENSPMAG00000005393.1 transcript:ENSPMAT00000005962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 5.370e-7
Identity = 30/109 (27.52%), Postives = 44/109 (40.37%), Query Frame = 2
Query:   74 TGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAG 400
             GE P W+     L  VD      +  + RW+P T  ++   +       +P   +    V+       +DW+         + AVD D+P NRFND K D  G   AG
Sbjct:   16 VGEGPVWEGATGTLLYVDVL----AQDVCRWHPHTGTVEKVHLDGTVGCAVPRRGRAGYAVACGTTFGLLDWDERRFTP---VAAVDKDRPNNRFNDGKVDPAGRFFAG 117          
BLAST of Regucalcin vs. Ensembl Nematostella
Match: EDO43634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY47])

HSP 1 Score: 139.043 bits (349), Expect = 1.017e-38
Identity = 97/292 (33.22%), Postives = 137/292 (46.92%), Query Frame = 2
Query:   50 VLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSC-ARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRI 922
            VL   F   GE P+WDE++ +L  VD    S    +  ++  T    S   K  A  N         I +     F +   S       LL A D  KP NRFND KCD  G   AG M  E     V+ P  GSLF     +      D+   +SNGL W+ +   M+F+DS  AR +Y +D+D    +ISN+R+ +  +       G+PDG+++DS   LWVA +  G VV++D    + L  I  P   TTSCC+ G  +  + VTS +  +  +       AGSVFR+
Sbjct:    6 VLEGCFAQLGEAPHWDEQSSKLVYVDILGKS----VHLYDAATGKHASISRKLRAHRNFGDHSGALLIATKYVIVFLLFVISY----VSLLLAED--KPNNRFNDGKCDPAGRFWAGNMGPEPRATEVV-PEQGSLFCLH-ADGAVTKHDSKITISNGLGWSPDNKTMYFIDSIPARCVYAYDFDMPTGSISNRRIAVQVDPL----YGVPDGMSVDSDGMLWVAMYNGGKVVRYDPSNGKELSVIEFPVSKTTSCCWMGPDYDQLIVTSERCRLSQEEKDAQPLAGSVFRV 281          
BLAST of Regucalcin vs. Ensembl Nematostella
Match: EDO36541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIB2])

HSP 1 Score: 111.694 bits (278), Expect = 4.368e-30
Identity = 53/137 (38.69%), Postives = 80/137 (58.39%), Query Frame = 2
Query:  512 LSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRI 922
            +SNGL W+ +G  +++VDS  R +  FDYD  + N+SN+RV I          G PDG+T+D    LW+A +  G VV+FD  T   LQ +S P   TTSCC+ G  + ++ VT+++ G+     +    AGS+FR+
Sbjct:    3 ISNGLAWSNDGKTLYYVDSIPRTVSAFDYDVASGNLSNRRVAIQL----PPSRGEPDGMTIDKDGMLWIAIWDEGKVVRFDPNTGEELQSVSFPVARTTSCCWAGPNYDELIVTTARIGLTPSQLRDQPLAGSIFRV 135          
BLAST of Regucalcin vs. Ensembl Medaka
Match: rgn (regucalcin [Source:NCBI gene;Acc:101159881])

HSP 1 Score: 167.162 bits (422), Expect = 4.922e-49
Identity = 102/286 (35.66%), Postives = 142/286 (49.65%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIV--MDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E  Q L  VD        KI RW+ T+  ++S E      F +P     Y +         VDW S   +    L  VD DK   R ND K D  G L+AGTM+ ES  G +    G SL+     NS+  V  + +  D+SNGL+W+ +    F++DS +  +  FDY+  + +++N+RV            GLPDG+T D    LWVAC+  G V+  D  T   LQ +SLP    TSCCFGG  F+D++VTS+  G+          AG+ FR+ G
Sbjct:   17 GEGPVWEESEQTLLFVDIA----GEKIHRWSSTSNQIQSVETGDTVGFVVPRESGGY-VAGVGRSILAVDWSS---QMMTPLAKVDEDKLNTRLNDGKVDPFGRLLAGTMAKESPHGQIERKQG-SLYSV---NSDLAVTRLLSQVDISNGLEWSLDQRTFFYIDSLSLTVDAFDYEPTSGSLANRRVVYRMKEGE----GLPDGMTTDVDGRLWVACYNGGRVIHIDPTTGVQLQTVSLPVTKVTSCCFGGPDFSDLFVTSASLGLDQSEKSQQPLAGNTFRVRG 286          
BLAST of Regucalcin vs. Ensembl Medaka
Match: rgn (regucalcin [Source:NCBI gene;Acc:101159881])

HSP 1 Score: 166.777 bits (421), Expect = 1.356e-48
Identity = 102/286 (35.66%), Postives = 142/286 (49.65%), Query Frame = 2
Query:   77 GECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIV--MDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPG 928
            GE P W+E  Q L  VD        KI RW+ T+  ++S E      F +P     Y +         VDW S   +    L  VD DK   R ND K D  G L+AGTM+ ES  G +    G SL+     NS+  V  + +  D+SNGL+W+ +    F++DS +  +  FDY+  + +++N+RV            GLPDG+T D    LWVAC+  G V+  D  T   LQ +SLP    TSCCFGG  F+D++VTS+  G+          AG+ FR+ G
Sbjct:   33 GEGPVWEESEQTLLFVDIA----GEKIHRWSSTSNQIQSVETGDTVGFVVPRESGGY-VAGVGRSILAVDWSS---QMMTPLAKVDEDKLNTRLNDGKVDPFGRLLAGTMAKESPHGQIERKQG-SLYSV---NSDLAVTRLLSQVDISNGLEWSLDQRTFFYIDSLSLTVDAFDYEPTSGSLANRRVVYRMKEGE----GLPDGMTTDVDGRLWVACYNGGRVIHIDPTTGVQLQTVSLPVTKVTSCCFGGPDFSDLFVTSASLGLDQSEKSQQPLAGNTFRVRG 302          
BLAST of Regucalcin vs. Planmine SMEST
Match: SMESG000076123.1 (SMESG000076123.1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 310/311 (99.68%), Query Frame = 2
Query:   41 MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHGSSGVAMNYYQC 973
            MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGV GDPDKGIEFAGSVFRIPGSVHGSSGVAMNYYQC
Sbjct:    1 MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMKSFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDIDKPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAIVMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCIDFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISLPTKCTTSCCFGGSKFTDMYVTSSKFGVAGDPDKGIEFAGSVFRIPGSVHGSSGVAMNYYQC 311          
The following BLAST results are available for this feature:
BLAST of Regucalcin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RGN3.668e-4433.89regucalcin [Source:HGNC Symbol;Acc:HGNC:9989][more]
RGN3.668e-4433.89regucalcin [Source:HGNC Symbol;Acc:HGNC:9989][more]
RGN3.668e-4433.89regucalcin [Source:HGNC Symbol;Acc:HGNC:9989][more]
RGN8.041e-1741.00regucalcin [Source:HGNC Symbol;Acc:HGNC:9989][more]
back to top
BLAST of Regucalcin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regucalcin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smp-301.826e-3330.67gene:FBgn0038257 transcript:FBtr0083017[more]
smp-301.826e-3330.67gene:FBgn0038257 transcript:FBtr0336878[more]
smp-301.826e-3330.67gene:FBgn0038257 transcript:FBtr0083016[more]
smp-302.576e-3330.67gene:FBgn0038257 transcript:FBtr0336877[more]
regucalcin5.150e-3329.60gene:FBgn0030362 transcript:FBtr0073575[more]
back to top
BLAST of Regucalcin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rgn1.962e-4633.57regucalcin [Source:NCBI gene;Acc:403070][more]
rgn8.578e-4633.22regucalcin [Source:NCBI gene;Acc:403070][more]
back to top
BLAST of Regucalcin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jade37.920e-5135.39jade family PHD finger 3 [Source:NCBI gene;Acc:779... [more]
jade38.758e-5035.00jade family PHD finger 3 [Source:NCBI gene;Acc:779... [more]
jade31.119e-4935.00jade family PHD finger 3 [Source:NCBI gene;Acc:779... [more]
commd21.439e-2727.40COMM domain containing 2 [Source:Xenbase;Acc:XB-GE... [more]
jade34.344e-2034.72jade family PHD finger 3 [Source:NCBI gene;Acc:779... [more]
back to top
BLAST of Regucalcin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rgn1.416e-4835.12regucalcin [Source:MGI Symbol;Acc:MGI:108024][more]
back to top
BLAST of Regucalcin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I922|RGN_XENLA5.293e-5136.04Regucalcin OS=Xenopus laevis OX=8355 GN=rgn PE=2 S... [more]
sp|Q6DF62|RGN_XENTR3.690e-5035.39Regucalcin OS=Xenopus tropicalis OX=8364 GN=rgn PE... [more]
sp|Q9TTJ6|RGN_RABIT3.882e-4835.66Regucalcin OS=Oryctolagus cuniculus OX=9986 GN=RGN... [more]
sp|Q64374|RGN_MOUSE9.904e-4835.12Regucalcin OS=Mus musculus OX=10090 GN=Rgn PE=1 SV... [more]
sp|Q06AA3|RGN_PIG1.526e-4534.72Regucalcin OS=Sus scrofa OX=9823 GN=RGN PE=2 SV=1[more]
back to top
BLAST of Regucalcin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QCP25.615e-5837.58Regucalcin OS=Crassostrea gigas OX=29159 GN=CGI_10... [more]
V4C5A21.226e-5634.43SGL domain-containing protein OS=Lottia gigantea O... [more]
A0A3Q3XQZ02.872e-5639.79Regucalcin OS=Mola mola OX=94237 PE=4 SV=1[more]
A0A3Q0T7M07.476e-5537.76Regucalcin OS=Amphilophus citrinellus OX=61819 PE=... [more]
A0A1A8S7Q31.617e-5437.76Regucalcin OS=Nothobranchius rachovii OX=451742 GN... [more]
back to top
BLAST of Regucalcin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rgn5.558e-4735.21regucalcin [Source:NCBI gene;Acc:103028139][more]
back to top
BLAST of Regucalcin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005962.15.370e-727.52pep scaffold:Pmarinus_7.0:GL487933:5047:7237:1 gen... [more]
back to top
BLAST of Regucalcin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regucalcin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO436341.017e-3833.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365414.368e-3038.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regucalcin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rgn4.922e-4935.66regucalcin [Source:NCBI gene;Acc:101159881][more]
rgn1.356e-4835.66regucalcin [Source:NCBI gene;Acc:101159881][more]
back to top
BLAST of Regucalcin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000076123.10.000e+099.68SMESG000076123.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024718 ID=SMED30024718|Name=Regucalcin|organism=Schmidtea mediterranea sexual|type=transcript|length=1049bp
CGATCTATAAGGTCATCCAGGATTCAAAATCAAATCAAACATGGAAGTTG
TACTAGCAAATTTGTTCGAATGGACTGGAGAGTGTCCATATTGGGATGAA
CGCAATCAAGAACTGAGTCTTGTTGATGCATGTACGACCTCAGGCTCCTC
GAAAATATTCCGATGGAATCCTACAACAAAATTTATGAAATCATTTGAAA
TGAAAAAATGTGCAAGTTTCAACATTCCATGCTCCGATCAAAGGTACAGC
ATCGTATCCAATAAAAACGAAACATTTCAAGTTGACTGGGAATCACTGAA
TCATGAAAATCAAAAACTACTTTTCGCAGTTGACATAGACAAACCATTAA
ATAGATTTAATGATGCCAAATGTGACAAAAAAGGAGTTTTGGTTGCTGGC
ACAATGAGTGACGAGAGCAGCCCTGGCGTTGTACTAAATCCAAATGGAGG
ATCATTATTCAAGTATAAAAAAGGCAATTCAGAGGCAATAGTGATGGATA
CTGGTTATGATCTCAGTAACGGTTTAGATTGGAACGCAAATGGTGACAAA
ATGTTCTTTGTCGACTCTTGTGCAAGGCAGATTTATGTTTTTGATTATGA
TAGTGAAAATAGCAATATTTCCAATAAAAGAGTTTGCATTGACTTTAACA
ATTATTCCTCTGTGGACCTTGGTCTCCCAGATGGCCTTACAATGGATTCC
AAAAATCATTTGTGGGTTGCTTGTTTTTGGGCCGGCGCAGTTGTTCAGTT
CGACTTAGAAACGGAACGCATACTTCAAAAAATTAGTTTACCTACTAAAT
GTACAACGTCTTGCTGTTTCGGTGGCAGCAAGTTTACAGATATGTATGTT
ACAAGTTCAAAATTTGGGGTTGGAGGTGACCCCGATAAAGGAATAGAATT
TGCTGGATCTGTTTTCAGAATTCCTGGATCTGTCCATGGTTCAAGTGGTG
TAGCTATGAATTATTATCAATGCTAATAAAACTATTAAGTTAAAAAAATG
TTTAATATCACAGTTGTGATGTGATTTTTTAAGCTAAAAATTGTTTACG
back to top

protein sequence of SMED30024718-orf-1

>SMED30024718-orf-1 ID=SMED30024718-orf-1|Name=SMED30024718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MEVVLANLFEWTGECPYWDERNQELSLVDACTTSGSSKIFRWNPTTKFMK
SFEMKKCASFNIPCSDQRYSIVSNKNETFQVDWESLNHENQKLLFAVDID
KPLNRFNDAKCDKKGVLVAGTMSDESSPGVVLNPNGGSLFKYKKGNSEAI
VMDTGYDLSNGLDWNANGDKMFFVDSCARQIYVFDYDSENSNISNKRVCI
DFNNYSSVDLGLPDGLTMDSKNHLWVACFWAGAVVQFDLETERILQKISL
PTKCTTSCCFGGSKFTDMYVTSSKFGVGGDPDKGIEFAGSVFRIPGSVHG
SSGVAMNYYQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039096SMP-30/CGR1
IPR005511SMP-30
IPR013658SGL
IPR0110426-blade_b-propeller_TolB-like
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030234enzyme regulator activity
Vocabulary: biological process
TermDefinition
GO:0050790regulation of catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005511Senescence marker protein-30 (SMP-30)PRINTSPR01790SMP30FAMILYcoord: 97..118
score: 46.13
coord: 13..30
score: 43.0
coord: 255..273
score: 46.2
coord: 145..167
score: 24.48
coord: 168..188
score: 28.22
coord: 212..229
score: 47.33
IPR013658SMP-30/Gluconolactonase/LRE-like regionPFAMPF08450SGLcoord: 13..273
e-value: 2.7E-61
score: 207.3
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 1..310
e-value: 3.8E-74
score: 251.3
IPR039096SMP-30/CGR1PANTHERPTHR10907REGUCALCINcoord: 12..308
NoneNo IPR availableSUPERFAMILYSSF63829Calcium-dependent phosphotriesterasecoord: 12..299