Pyruvate carboxylase

Overview
NamePyruvate carboxylase
Smed IDSMED30024713
Length (bp)3655
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyruvate carboxylase (SMED30024713) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyruvate carboxylase (SMED30024713) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyruvate carboxylase (SMED30024713) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyruvate carboxylase (SMED30024713) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024713

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024713SMESG000077941.1 Contig1099uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024713SMESG000077941.1 Contig1099uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30024713SMESG000077941.1 Contig1099uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024713SMESG000077941.1 Contig1099newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024713SMESG000077941.1 Contig1099newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30024713SMESG000077941.1 Contig1099newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024713SMESG000064914.1 Contig1099uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024713SMESG000064914.1 Contig1099uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30024713SMESG000064914.1 Contig1099uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024713SMESG000064914.1 Contig1099newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024713SMESG000064914.1 Contig1099newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30024713SMESG000064914.1 Contig1099newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30024713SMESG000077941.1 dd_Smed_v4_2393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024713SMESG000077941.1 dd_Smed_v4_2393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024713SMESG000077941.1 dd_Smed_v4_2393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30024713SMESG000077941.1 dd_Smed_v4_2393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024713SMESG000077941.1 dd_Smed_v4_2393_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyruvate carboxylase vs. Ensembl Human
Match: PC (pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:8636])

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 743/1149 (64.66%), Postives = 922/1149 (80.24%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VAIYSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNI FL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI    P G+RDIL++ GP+ FA+AVR HPG L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A DSMSG+TSQPSMGA+VAC + TPLDT + +E+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   + GRPG  L   D +A + EL D    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SP++G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPP-PAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Human
Match: PC (pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:8636])

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 743/1149 (64.66%), Postives = 922/1149 (80.24%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VAIYSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNI FL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI    P G+RDIL++ GP+ FA+AVR HPG L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A DSMSG+TSQPSMGA+VAC + TPLDT + +E+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   + GRPG  L   D +A + EL D    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SP++G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPP-PAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Human
Match: PC (pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:8636])

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 743/1149 (64.66%), Postives = 922/1149 (80.24%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VAIYSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNI FL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI    P G+RDIL++ GP+ FA+AVR HPG L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A DSMSG+TSQPSMGA+VAC + TPLDT + +E+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   + GRPG  L   D +A + EL D    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SP++G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPP-PAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Human
Match: PC (pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:8636])

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 743/1149 (64.66%), Postives = 922/1149 (80.24%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VAIYSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNI FL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI    P G+RDIL++ GP+ FA+AVR HPG L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A DSMSG+TSQPSMGA+VAC + TPLDT + +E+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   + GRPG  L   D +A + EL D    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SP++G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPP-PAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Human
Match: PC (pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:8636])

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 743/1149 (64.66%), Postives = 922/1149 (80.24%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VAIYSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNI FL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI    P G+RDIL++ GP+ FA+AVR HPG L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A DSMSG+TSQPSMGA+VAC + TPLDT + +E+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   + GRPG  L   D +A + EL D    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SP++G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPP-PAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Celegans
Match: pyc-1 (Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Prot;Acc:O17732])

HSP 1 Score: 1600.49 bits (4143), Expect = 0.000e+0
Identity = 774/1156 (66.96%), Postives = 945/1156 (81.75%), Query Frame = 3
Query:  114 NYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            NY ++ ++  ++  KV+VANRGEIAIRVFRA  E+   SVAIY+EQD   MHRLKADE+YL+GKGL PVAAYL I +II+ +  H++DAIHPGYGFLSERSDFAAAC  AGI FIGP  DV+ +MGDKV ARQAA++A V VVPG+PGPI T +EA+EF K+YG PIILKAAYGGGGRG+R V +LE + E F R+ SEA AAFG+G +F+EKF+ERPRHIEVQ+LGD  GN VHL+ERDCSVQRRHQK+VEIAPAP L   +R+K+L+DA++LA+ VGY+NAGTVEFL DQ    +YFIEVNARLQVEHTVTE++TGVDLV++QI IAEGKSL +L L+QE I++ G AIQCR+TTEDPA+ FQPDSGR+EVFRSGEGMGIRLDSASAFAG++ISP+YDSL++KVIA A N   A AKM+R+L++FR+RGVKTNIPFL NVL    FL+ SVDTYFIDEHP LFQFK SQNRAQKLL YLG + VNGP T LATDLKP++++P IP  P   + PTG RD+LV+ GP  FA+ VR  PGC+I DTTFRDAHQSLLATRVRTYDMA ISPFVAQ+F  LFSLENWGGATFDVSMRFL ECPWERL+TLRKLIPNIPFQ LLRGANA+GY+NYPDN++YKFC+LAV++GMD+FRVFD LNYLPN++VGM+AV KAGGVVEA+  Y+GD+TD ++ KY+L YYL LAD LVK  AHIL IKDMAGVLKP AA++LIG LR K+PDIPIH+H+HDT+GAGVA ML  A++G D+VD A+DSMSG+TSQPSMGA+VA LQ T  DTGL+L+ I  YS+YWE  R+LY PFEC TTM+SGNADVY ++IPGGQYTNLQFQ+FSLGL  QF+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +  +TLV++AD+LS PKSV++F QG+VG+P  GFPE LR+KV++    + GRPG++ K  D +A K EL +       ++D+MSY+++P VF EF+ FR+++GPV KL TR+FL G  IAEE+ V++E GKTL I+ LA   +   G REVFF+LNGQ+RS+ +VDKEASK I  RP+A   VRG +G+PMPG+VLE+K+KEGD V K Q L ++SAMKMEM ++SP+ G VK +H     K    DL++E+E
Sbjct:   21 NY-ANGVIKPREFNKVMVANRGEIAIRVFRALTELNKTSVAIYAEQDKNSMHRLKADEAYLVGKGLPPVAAYLTIDQIIETALKHNIDAIHPGYGFLSERSDFAAACQNAGIVFIGPSPDVMARMGDKVAARQAAIEAGVQVVPGTPGPITTADEAVEFAKQYGTPIILKAAYGGGGRGIRRVDKLEEVEEAFRRSYSEAQAAFGDGSLFVEKFVERPRHIEVQLLGDHHGNIVHLYERDCSVQRRHQKVVEIAPAPALPEGVREKILADALRLARHVGYQNAGTVEFLVDQ-KGNYYFIEVNARLQVEHTVTEEITGVDLVQAQIRIAEGKSLDDLKLSQETIQTTGSAIQCRVTTEDPAKGFQPDSGRIEVFRSGEGMGIRLDSASAFAGSVISPHYDSLMVKVIASARNHPNAAAKMIRALKKFRIRGVKTNIPFLLNVLRQPSFLDASVDTYFIDEHPELFQFKPSQNRAQKLLNYLGEVKVNGPTTPLATDLKPAVVSPPIPYIPAGAKPPTGLRDVLVQRGPTEFAKEVRSRPGCMITDTTFRDAHQSLLATRVRTYDMAAISPFVAQSFNGLFSLENWGGATFDVSMRFLHECPWERLQTLRKLIPNIPFQCLLRGANAMGYSNYPDNVIYKFCELAVKNGMDVFRVFDSLNYLPNLLVGMEAVGKAGGVVEAAIAYTGDVTDKSRDKYDLKYYLNLADQLVKAQAHILSIKDMAGVLKPEAAKLLIGALRDKFPDIPIHVHTHDTSGAGVAAMLECAKAGADVVDAAVDSMSGMTSQPSMGAIVASLQGTKHDTGLSLDDISKYSAYWESTRQLYAPFECATTMKSGNADVYKHEIPGGQYTNLQFQAFSLGLGPQFDEVKRMYREANLVLGDIIKVTPSSKIVGDLAQFMVQNNLTRETLVDRADDLSFPKSVVDFMQGNVGQPPYGFPEPLRTKVLRGKPKVDGRPGENAKPVDLDAVKVELEEKHGRTLSEEDVMSYSMFPTVFDEFETFRQQYGPVDKLPTRLFLTGLEIAEEVDVEIESGKTLAIQLLAEGKLNKRGEREVFFDLNGQMRSIFVVDKEASKEIVTRPRALPGVRGHIGAPMPGDVLELKIKEGDKVTKKQPLFVLSAMKMEMVIDSPIAGTVKAIHAPQGTKCSAGDLVVEVE 1174          
BLAST of Pyruvate carboxylase vs. Ensembl Celegans
Match: pyc-1 (Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Prot;Acc:O17732])

HSP 1 Score: 1600.49 bits (4143), Expect = 0.000e+0
Identity = 774/1156 (66.96%), Postives = 945/1156 (81.75%), Query Frame = 3
Query:  114 NYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            NY ++ ++  ++  KV+VANRGEIAIRVFRA  E+   SVAIY+EQD   MHRLKADE+YL+GKGL PVAAYL I +II+ +  H++DAIHPGYGFLSERSDFAAAC  AGI FIGP  DV+ +MGDKV ARQAA++A V VVPG+PGPI T +EA+EF K+YG PIILKAAYGGGGRG+R V +LE + E F R+ SEA AAFG+G +F+EKF+ERPRHIEVQ+LGD  GN VHL+ERDCSVQRRHQK+VEIAPAP L   +R+K+L+DA++LA+ VGY+NAGTVEFL DQ    +YFIEVNARLQVEHTVTE++TGVDLV++QI IAEGKSL +L L+QE I++ G AIQCR+TTEDPA+ FQPDSGR+EVFRSGEGMGIRLDSASAFAG++ISP+YDSL++KVIA A N   A AKM+R+L++FR+RGVKTNIPFL NVL    FL+ SVDTYFIDEHP LFQFK SQNRAQKLL YLG + VNGP T LATDLKP++++P IP  P   + PTG RD+LV+ GP  FA+ VR  PGC+I DTTFRDAHQSLLATRVRTYDMA ISPFVAQ+F  LFSLENWGGATFDVSMRFL ECPWERL+TLRKLIPNIPFQ LLRGANA+GY+NYPDN++YKFC+LAV++GMD+FRVFD LNYLPN++VGM+AV KAGGVVEA+  Y+GD+TD ++ KY+L YYL LAD LVK  AHIL IKDMAGVLKP AA++LIG LR K+PDIPIH+H+HDT+GAGVA ML  A++G D+VD A+DSMSG+TSQPSMGA+VA LQ T  DTGL+L+ I  YS+YWE  R+LY PFEC TTM+SGNADVY ++IPGGQYTNLQFQ+FSLGL  QF+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +  +TLV++AD+LS PKSV++F QG+VG+P  GFPE LR+KV++    + GRPG++ K  D +A K EL +       ++D+MSY+++P VF EF+ FR+++GPV KL TR+FL G  IAEE+ V++E GKTL I+ LA   +   G REVFF+LNGQ+RS+ +VDKEASK I  RP+A   VRG +G+PMPG+VLE+K+KEGD V K Q L ++SAMKMEM ++SP+ G VK +H     K    DL++E+E
Sbjct:   21 NY-ANGVIKPREFNKVMVANRGEIAIRVFRALTELNKTSVAIYAEQDKNSMHRLKADEAYLVGKGLPPVAAYLTIDQIIETALKHNIDAIHPGYGFLSERSDFAAACQNAGIVFIGPSPDVMARMGDKVAARQAAIEAGVQVVPGTPGPITTADEAVEFAKQYGTPIILKAAYGGGGRGIRRVDKLEEVEEAFRRSYSEAQAAFGDGSLFVEKFVERPRHIEVQLLGDHHGNIVHLYERDCSVQRRHQKVVEIAPAPALPEGVREKILADALRLARHVGYQNAGTVEFLVDQ-KGNYYFIEVNARLQVEHTVTEEITGVDLVQAQIRIAEGKSLDDLKLSQETIQTTGSAIQCRVTTEDPAKGFQPDSGRIEVFRSGEGMGIRLDSASAFAGSVISPHYDSLMVKVIASARNHPNAAAKMIRALKKFRIRGVKTNIPFLLNVLRQPSFLDASVDTYFIDEHPELFQFKPSQNRAQKLLNYLGEVKVNGPTTPLATDLKPAVVSPPIPYIPAGAKPPTGLRDVLVQRGPTEFAKEVRSRPGCMITDTTFRDAHQSLLATRVRTYDMAAISPFVAQSFNGLFSLENWGGATFDVSMRFLHECPWERLQTLRKLIPNIPFQCLLRGANAMGYSNYPDNVIYKFCELAVKNGMDVFRVFDSLNYLPNLLVGMEAVGKAGGVVEAAIAYTGDVTDKSRDKYDLKYYLNLADQLVKAQAHILSIKDMAGVLKPEAAKLLIGALRDKFPDIPIHVHTHDTSGAGVAAMLECAKAGADVVDAAVDSMSGMTSQPSMGAIVASLQGTKHDTGLSLDDISKYSAYWESTRQLYAPFECATTMKSGNADVYKHEIPGGQYTNLQFQAFSLGLGPQFDEVKRMYREANLVLGDIIKVTPSSKIVGDLAQFMVQNNLTRETLVDRADDLSFPKSVVDFMQGNVGQPPYGFPEPLRTKVLRGKPKVDGRPGENAKPVDLDAVKVELEEKHGRTLSEEDVMSYSMFPTVFDEFETFRQQYGPVDKLPTRLFLTGLEIAEEVDVEIESGKTLAIQLLAEGKLNKRGEREVFFDLNGQMRSIFVVDKEASKEIVTRPRALPGVRGHIGAPMPGDVLELKIKEGDKVTKKQPLFVLSAMKMEMVIDSPIAGTVKAIHAPQGTKCSAGDLVVEVE 1174          
BLAST of Pyruvate carboxylase vs. Ensembl Celegans
Match: pyc-1 (Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Prot;Acc:O17732])

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 403/615 (65.53%), Postives = 499/615 (81.14%), Query Frame = 3
Query: 1737 LIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            +I DTTFRDAHQSLLATRVRTYDMA ISPFVAQ+F  LFSLENWGGATFDVSMRFL ECPWERL+TLRKLIPNIPFQ LLRGANA+GY+NYPDN++YKFC+LAV++GMD+FRVFD LNYLPN++VGM+AV KAGGVVEA+  Y+GD+TD ++ KY+L YYL LAD LVK  AHIL IKDMAGVLKP AA++LIG LR K+PDIPIH+H+HDT+GAGVA ML  A++G D+VD A+DSMSG+TSQPSMGA+VA LQ T  DTGL+L+ I  YS+YWE  R+LY PFEC TTM+SGNADVY ++IPGGQYTNLQFQ+FSLGL  QF+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +  +TLV++AD+LS PKSV++F QG+VG+P  GFPE LR+KV++    + GRPG++ K  D +A K EL +       ++D+MSY+++P VF EF+ FR+++GPV KL TR+FL G  IAEE+ V++E GKTL I+ LA   +   G REVFF+LNGQ+RS+ +VDKEASK I  RP+A   VRG +G+PMPG+VLE+K+KEGD V K Q L ++SAMKMEM ++SP+ G VK +H     K    DL++E+E
Sbjct:    1 MITDTTFRDAHQSLLATRVRTYDMAAISPFVAQSFNGLFSLENWGGATFDVSMRFLHECPWERLQTLRKLIPNIPFQCLLRGANAMGYSNYPDNVIYKFCELAVKNGMDVFRVFDSLNYLPNLLVGMEAVGKAGGVVEAAIAYTGDVTDKSRDKYDLKYYLNLADQLVKAQAHILSIKDMAGVLKPEAAKLLIGALRDKFPDIPIHVHTHDTSGAGVAAMLECAKAGADVVDAAVDSMSGMTSQPSMGAIVASLQGTKHDTGLSLDDISKYSAYWESTRQLYAPFECATTMKSGNADVYKHEIPGGQYTNLQFQAFSLGLGPQFDEVKRMYREANLVLGDIIKVTPSSKIVGDLAQFMVQNNLTRETLVDRADDLSFPKSVVDFMQGNVGQPPYGFPEPLRTKVLRGKPKVDGRPGENAKPVDLDAVKVELEEKHGRTLSEEDVMSYSMFPTVFDEFETFRQQYGPVDKLPTRLFLTGLEIAEEVDVEIESGKTLAIQLLAEGKLNKRGEREVFFDLNGQMRSIFVVDKEASKEIVTRPRALPGVRGHIGAPMPGDVLELKIKEGDKVTKKQPLFVLSAMKMEMVIDSPIAGTVKAIHAPQGTKCSAGDLVVEVE 615          
BLAST of Pyruvate carboxylase vs. Ensembl Celegans
Match: mccc-1 (MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [Source:UniProtKB/TrEMBL;Acc:O45430])

HSP 1 Score: 362.073 bits (928), Expect = 1.537e-110
Identity = 208/454 (45.81%), Postives = 282/454 (62.11%), Query Frame = 3
Query:  144 KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAA--YLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARD-FQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH 1496
            + I++VLVANRGEIAIRV     +MGI +VA++S+ D   +   KAD++Y IG    P+AA  YLN+ +II  +      AIHPGYGFLSE + FA  C +AG+ FIGPPA  +R MG K  ++Q   DA V VV G  G  Q+     +   + G P++LKA YGGGG+GMR+        E    A++EA  +FGN EM +EKF+E+PRH+EVQ+ GD  GN VHL+ERDCSVQRRHQKI+E APAPN+    R K+   AV+ A  VGY  AGTVEF+ D    + YF+E+N RLQVEH V+E +TG DLV  Q+ +A+G+ LP   L Q EI   G+A +CR+  ED  +  F P +GRL      E    R+D+    +G  +S +YD ++ KV+    +  +A AK+  +L   R+ G+ TNI F+  VL +  F  G+V T FI +H
Sbjct:   17 RPIQRVLVANRGEIAIRVQNTARKMGIETVAVFSDADRNSLFVKKADKAYHIGP---PLAAESYLNMDKIINSALRSGAQAIHPGYGFLSENAGFAEKCAQAGLVFIGPPAQAIRDMGAKNVSKQIMEDAKVPVVKGFHGEDQSDANLKKKSAEIGYPVMLKAVYGGGGKGMRIAWNEAEFEEKLASARNEAKKSFGNDEMLVEKFVEKPRHVEVQVFGDHHGNYVHLWERDCSVQRRHQKIIEEAPAPNMEHDTRVKLGESAVRAAAAVGYVGAGTVEFIMDP-RGEFYFMEMNTRLQVEHPVSEAITGTDLVEWQLRVAQGEKLP---LKQSEIPLNGHAFECRVYAEDTRKGAFMPTAGRLNYVDFPEDA--RIDTG-VVSGDEVSIHYDPMIAKVVVWGQDRAVAAAKLESALARTRISGLPTNIDFVRRVLAHPEFAAGNVYTDFIPDH 460          
BLAST of Pyruvate carboxylase vs. Ensembl Celegans
Match: mccc-1 (MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [Source:UniProtKB/TrEMBL;Acc:O45430])

HSP 1 Score: 362.073 bits (928), Expect = 1.537e-110
Identity = 208/454 (45.81%), Postives = 282/454 (62.11%), Query Frame = 3
Query:  144 KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAA--YLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARD-FQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH 1496
            + I++VLVANRGEIAIRV     +MGI +VA++S+ D   +   KAD++Y IG    P+AA  YLN+ +II  +      AIHPGYGFLSE + FA  C +AG+ FIGPPA  +R MG K  ++Q   DA V VV G  G  Q+     +   + G P++LKA YGGGG+GMR+        E    A++EA  +FGN EM +EKF+E+PRH+EVQ+ GD  GN VHL+ERDCSVQRRHQKI+E APAPN+    R K+   AV+ A  VGY  AGTVEF+ D    + YF+E+N RLQVEH V+E +TG DLV  Q+ +A+G+ LP   L Q EI   G+A +CR+  ED  +  F P +GRL      E    R+D+    +G  +S +YD ++ KV+    +  +A AK+  +L   R+ G+ TNI F+  VL +  F  G+V T FI +H
Sbjct:   17 RPIQRVLVANRGEIAIRVQNTARKMGIETVAVFSDADRNSLFVKKADKAYHIGP---PLAAESYLNMDKIINSALRSGAQAIHPGYGFLSENAGFAEKCAQAGLVFIGPPAQAIRDMGAKNVSKQIMEDAKVPVVKGFHGEDQSDANLKKKSAEIGYPVMLKAVYGGGGKGMRIAWNEAEFEEKLASARNEAKKSFGNDEMLVEKFVEKPRHVEVQVFGDHHGNYVHLWERDCSVQRRHQKIIEEAPAPNMEHDTRVKLGESAVRAAAAVGYVGAGTVEFIMDP-RGEFYFMEMNTRLQVEHPVSEAITGTDLVEWQLRVAQGEKLP---LKQSEIPLNGHAFECRVYAEDTRKGAFMPTAGRLNYVDFPEDA--RIDTG-VVSGDEVSIHYDPMIAKVVVWGQDRAVAAAKLESALARTRISGLPTNIDFVRRVLAHPEFAAGNVYTDFIPDH 460          
BLAST of Pyruvate carboxylase vs. Ensembl Fly
Match: PCB (gene:FBgn0027580 transcript:FBtr0088455)

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 793/1175 (67.49%), Postives = 965/1175 (82.13%), Query Frame = 3
Query:   63 KCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHD-FDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALS-DIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K +P      +F N    Y S   +  K IR VLVANRGEIAIRVFRAC E+GI+SVA+YSEQD M MHR KADESY++GKGL PV AYLNI E+I++ K +DVDA+HPGYGFLSERSDFA A  +AG++FIGP  +VV+KMGDKV AR AA++A V +VPG+ GP+ T EEA+EF KK+GLP+I KAAYGGGGRGMRVV+++E + E+F RA SEA AAFGNG MFIEKFIERPRHIEVQ+LGDK GN VHL+ERDCSVQRRHQK+VEIAPAP L + IRDKM   AV+LA+ VGYENAGTVEFL D+ +   YFIEVNARLQVEHTVTE++TG+DLV+SQI +AEG +LPELG TQ++I   GYAIQCR+TTEDPA DFQP++GRLEVFRSGEGMGIRLDSASA+AGAIISPYYDSLL+KVI+HA++ + + +KM R+LREFR+RGVKTNIPFL NVLEN++FL+G +DTYFIDEHP LF+FK S NRAQKLL Y+G ++VNGP T LAT LKP+L++P +PE P+  E P G R++LV  GP+AFA+ VR     L+MDTTFRDAHQSLLATRVR++D+ +ISP+V   F NL+SLENWGGATFDV++RFL ECPWERLE +RK IPNIPFQMLLRGANAVGYT+YPDN+VYKFC+LAVQ+GMDIFRVFD LNYLPN+I+GM+A  KAGGVVEA+  Y+GD++DP +TKY+L YY  LAD+LVK G H+L IKDMAG+LKP +AR+LI  +R K+PDIPIH+H+HDT+GAGVA+MLA A +G D+VD A+DSMSG+TSQPSMGAVVA LQ TPLDT L+L  +  YS+YWEQ R LY PFECTTTMRSGNADVY N+IPGGQYTNLQFQ+FSLGL D FE+VK+ Y  AN LLGD+IKVTPSSK+VGDLAQFMVQN + A  ++E+A+ELS PKSV+E+ QG +G P+GGFPE LRS+V+K+   I GRPG +LK  DF+  K EL +  +H    ++D+MS ALYP V  +F  FRE++GPV KL TRIFL GP++ EE  V LE+GKTL +K LA+S D++P+G+REVFFELNGQLR+V I+DKEA K I V PKA KS +  VG+PMPG V++++VK GD V+KGQ L ++SAMKMEM V SP+ G VK + +A   K+EGEDL++ IE
Sbjct:   15 KTQPRVRLNAIFKNG---YSSK--VEYKPIRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCDE-SGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDEHPQLFKFKPSLNRAQKLLNYMGEVLVNGPQTPLATTLKPALVSPHVPEVPLVTEPPKGLREVLVCEGPEAFAKEVRNRKELLLMDTTFRDAHQSLLATRVRSHDLLKISPYVTHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKRIPNIPFQMLLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPKRTKYDLKYYTNLADELVKAGTHVLCIKDMAGLLKPESARLLITAIRDKHPDIPIHIHTHDTSGAGVASMLACANAGADVVDVAVDSMSGMTSQPSMGAVVASLQGTPLDTNLDLRTVSEYSAYWEQTRTLYAPFECTTTMRSGNADVYLNEIPGGQYTNLQFQAFSLGLGDFFEDVKKAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNDLTADQVLERAEELSFPKSVVEYLQGSIGIPHGGFPEPLRSRVLKDMPRIEGRPGAELKDLDFDKLKKELQE--SHTCVTNRDVMSAALYPQVTNDFLNFREKYGPVDKLDTRIFLTGPKVGEEFDVPLERGKTLSVKALAVSADLKPNGIREVFFELNGQLRAVHILDKEAVKEIHVHPKANKSNKSEVGAPMPGTVIDIRVKVGDKVEKGQPLVVLSAMKMEMVVQSPLAGVVKKLEIANGTKLEGEDLIMIIE 1181          
BLAST of Pyruvate carboxylase vs. Ensembl Fly
Match: PCB (gene:FBgn0027580 transcript:FBtr0088457)

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 793/1175 (67.49%), Postives = 965/1175 (82.13%), Query Frame = 3
Query:   63 KCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHD-FDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALS-DIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K +P      +F N    Y S   +  K IR VLVANRGEIAIRVFRAC E+GI+SVA+YSEQD M MHR KADESY++GKGL PV AYLNI E+I++ K +DVDA+HPGYGFLSERSDFA A  +AG++FIGP  +VV+KMGDKV AR AA++A V +VPG+ GP+ T EEA+EF KK+GLP+I KAAYGGGGRGMRVV+++E + E+F RA SEA AAFGNG MFIEKFIERPRHIEVQ+LGDK GN VHL+ERDCSVQRRHQK+VEIAPAP L + IRDKM   AV+LA+ VGYENAGTVEFL D+ +   YFIEVNARLQVEHTVTE++TG+DLV+SQI +AEG +LPELG TQ++I   GYAIQCR+TTEDPA DFQP++GRLEVFRSGEGMGIRLDSASA+AGAIISPYYDSLL+KVI+HA++ + + +KM R+LREFR+RGVKTNIPFL NVLEN++FL+G +DTYFIDEHP LF+FK S NRAQKLL Y+G ++VNGP T LAT LKP+L++P +PE P+  E P G R++LV  GP+AFA+ VR     L+MDTTFRDAHQSLLATRVR++D+ +ISP+V   F NL+SLENWGGATFDV++RFL ECPWERLE +RK IPNIPFQMLLRGANAVGYT+YPDN+VYKFC+LAVQ+GMDIFRVFD LNYLPN+I+GM+A  KAGGVVEA+  Y+GD++DP +TKY+L YY  LAD+LVK G H+L IKDMAG+LKP +AR+LI  +R K+PDIPIH+H+HDT+GAGVA+MLA A +G D+VD A+DSMSG+TSQPSMGAVVA LQ TPLDT L+L  +  YS+YWEQ R LY PFECTTTMRSGNADVY N+IPGGQYTNLQFQ+FSLGL D FE+VK+ Y  AN LLGD+IKVTPSSK+VGDLAQFMVQN + A  ++E+A+ELS PKSV+E+ QG +G P+GGFPE LRS+V+K+   I GRPG +LK  DF+  K EL +  +H    ++D+MS ALYP V  +F  FRE++GPV KL TRIFL GP++ EE  V LE+GKTL +K LA+S D++P+G+REVFFELNGQLR+V I+DKEA K I V PKA KS +  VG+PMPG V++++VK GD V+KGQ L ++SAMKMEM V SP+ G VK + +A   K+EGEDL++ IE
Sbjct:   15 KTQPRVRLNAIFKNG---YSSK--VEYKPIRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCDE-SGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDEHPQLFKFKPSLNRAQKLLNYMGEVLVNGPQTPLATTLKPALVSPHVPEVPLVTEPPKGLREVLVCEGPEAFAKEVRNRKELLLMDTTFRDAHQSLLATRVRSHDLLKISPYVTHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKRIPNIPFQMLLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPKRTKYDLKYYTNLADELVKAGTHVLCIKDMAGLLKPESARLLITAIRDKHPDIPIHIHTHDTSGAGVASMLACANAGADVVDVAVDSMSGMTSQPSMGAVVASLQGTPLDTNLDLRTVSEYSAYWEQTRTLYAPFECTTTMRSGNADVYLNEIPGGQYTNLQFQAFSLGLGDFFEDVKKAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNDLTADQVLERAEELSFPKSVVEYLQGSIGIPHGGFPEPLRSRVLKDMPRIEGRPGAELKDLDFDKLKKELQE--SHTCVTNRDVMSAALYPQVTNDFLNFREKYGPVDKLDTRIFLTGPKVGEEFDVPLERGKTLSVKALAVSADLKPNGIREVFFELNGQLRAVHILDKEAVKEIHVHPKANKSNKSEVGAPMPGTVIDIRVKVGDKVEKGQPLVVLSAMKMEMVVQSPLAGVVKKLEIANGTKLEGEDLIMIIE 1181          
BLAST of Pyruvate carboxylase vs. Ensembl Fly
Match: PCB (gene:FBgn0027580 transcript:FBtr0088456)

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 793/1175 (67.49%), Postives = 965/1175 (82.13%), Query Frame = 3
Query:   63 KCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHD-FDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALS-DIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K +P      +F N    Y S   +  K IR VLVANRGEIAIRVFRAC E+GI+SVA+YSEQD M MHR KADESY++GKGL PV AYLNI E+I++ K +DVDA+HPGYGFLSERSDFA A  +AG++FIGP  +VV+KMGDKV AR AA++A V +VPG+ GP+ T EEA+EF KK+GLP+I KAAYGGGGRGMRVV+++E + E+F RA SEA AAFGNG MFIEKFIERPRHIEVQ+LGDK GN VHL+ERDCSVQRRHQK+VEIAPAP L + IRDKM   AV+LA+ VGYENAGTVEFL D+ +   YFIEVNARLQVEHTVTE++TG+DLV+SQI +AEG +LPELG TQ++I   GYAIQCR+TTEDPA DFQP++GRLEVFRSGEGMGIRLDSASA+AGAIISPYYDSLL+KVI+HA++ + + +KM R+LREFR+RGVKTNIPFL NVLEN++FL+G +DTYFIDEHP LF+FK S NRAQKLL Y+G ++VNGP T LAT LKP+L++P +PE P+  E P G R++LV  GP+AFA+ VR     L+MDTTFRDAHQSLLATRVR++D+ +ISP+V   F NL+SLENWGGATFDV++RFL ECPWERLE +RK IPNIPFQMLLRGANAVGYT+YPDN+VYKFC+LAVQ+GMDIFRVFD LNYLPN+I+GM+A  KAGGVVEA+  Y+GD++DP +TKY+L YY  LAD+LVK G H+L IKDMAG+LKP +AR+LI  +R K+PDIPIH+H+HDT+GAGVA+MLA A +G D+VD A+DSMSG+TSQPSMGAVVA LQ TPLDT L+L  +  YS+YWEQ R LY PFECTTTMRSGNADVY N+IPGGQYTNLQFQ+FSLGL D FE+VK+ Y  AN LLGD+IKVTPSSK+VGDLAQFMVQN + A  ++E+A+ELS PKSV+E+ QG +G P+GGFPE LRS+V+K+   I GRPG +LK  DF+  K EL +  +H    ++D+MS ALYP V  +F  FRE++GPV KL TRIFL GP++ EE  V LE+GKTL +K LA+S D++P+G+REVFFELNGQLR+V I+DKEA K I V PKA KS +  VG+PMPG V++++VK GD V+KGQ L ++SAMKMEM V SP+ G VK + +A   K+EGEDL++ IE
Sbjct:   15 KTQPRVRLNAIFKNG---YSSK--VEYKPIRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCDE-SGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDEHPQLFKFKPSLNRAQKLLNYMGEVLVNGPQTPLATTLKPALVSPHVPEVPLVTEPPKGLREVLVCEGPEAFAKEVRNRKELLLMDTTFRDAHQSLLATRVRSHDLLKISPYVTHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKRIPNIPFQMLLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPKRTKYDLKYYTNLADELVKAGTHVLCIKDMAGLLKPESARLLITAIRDKHPDIPIHIHTHDTSGAGVASMLACANAGADVVDVAVDSMSGMTSQPSMGAVVASLQGTPLDTNLDLRTVSEYSAYWEQTRTLYAPFECTTTMRSGNADVYLNEIPGGQYTNLQFQAFSLGLGDFFEDVKKAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNDLTADQVLERAEELSFPKSVVEYLQGSIGIPHGGFPEPLRSRVLKDMPRIEGRPGAELKDLDFDKLKKELQE--SHTCVTNRDVMSAALYPQVTNDFLNFREKYGPVDKLDTRIFLTGPKVGEEFDVPLERGKTLSVKALAVSADLKPNGIREVFFELNGQLRAVHILDKEAVKEIHVHPKANKSNKSEVGAPMPGTVIDIRVKVGDKVEKGQPLVVLSAMKMEMVVQSPLAGVVKKLEIANGTKLEGEDLIMIIE 1181          
BLAST of Pyruvate carboxylase vs. Ensembl Fly
Match: PCB (gene:FBgn0027580 transcript:FBtr0088459)

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 793/1175 (67.49%), Postives = 965/1175 (82.13%), Query Frame = 3
Query:   63 KCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHD-FDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALS-DIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K +P      +F N    Y S   +  K IR VLVANRGEIAIRVFRAC E+GI+SVA+YSEQD M MHR KADESY++GKGL PV AYLNI E+I++ K +DVDA+HPGYGFLSERSDFA A  +AG++FIGP  +VV+KMGDKV AR AA++A V +VPG+ GP+ T EEA+EF KK+GLP+I KAAYGGGGRGMRVV+++E + E+F RA SEA AAFGNG MFIEKFIERPRHIEVQ+LGDK GN VHL+ERDCSVQRRHQK+VEIAPAP L + IRDKM   AV+LA+ VGYENAGTVEFL D+ +   YFIEVNARLQVEHTVTE++TG+DLV+SQI +AEG +LPELG TQ++I   GYAIQCR+TTEDPA DFQP++GRLEVFRSGEGMGIRLDSASA+AGAIISPYYDSLL+KVI+HA++ + + +KM R+LREFR+RGVKTNIPFL NVLEN++FL+G +DTYFIDEHP LF+FK S NRAQKLL Y+G ++VNGP T LAT LKP+L++P +PE P+  E P G R++LV  GP+AFA+ VR     L+MDTTFRDAHQSLLATRVR++D+ +ISP+V   F NL+SLENWGGATFDV++RFL ECPWERLE +RK IPNIPFQMLLRGANAVGYT+YPDN+VYKFC+LAVQ+GMDIFRVFD LNYLPN+I+GM+A  KAGGVVEA+  Y+GD++DP +TKY+L YY  LAD+LVK G H+L IKDMAG+LKP +AR+LI  +R K+PDIPIH+H+HDT+GAGVA+MLA A +G D+VD A+DSMSG+TSQPSMGAVVA LQ TPLDT L+L  +  YS+YWEQ R LY PFECTTTMRSGNADVY N+IPGGQYTNLQFQ+FSLGL D FE+VK+ Y  AN LLGD+IKVTPSSK+VGDLAQFMVQN + A  ++E+A+ELS PKSV+E+ QG +G P+GGFPE LRS+V+K+   I GRPG +LK  DF+  K EL +  +H    ++D+MS ALYP V  +F  FRE++GPV KL TRIFL GP++ EE  V LE+GKTL +K LA+S D++P+G+REVFFELNGQLR+V I+DKEA K I V PKA KS +  VG+PMPG V++++VK GD V+KGQ L ++SAMKMEM V SP+ G VK + +A   K+EGEDL++ IE
Sbjct:   15 KTQPRVRLNAIFKNG---YSSK--VEYKPIRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCDE-SGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDEHPQLFKFKPSLNRAQKLLNYMGEVLVNGPQTPLATTLKPALVSPHVPEVPLVTEPPKGLREVLVCEGPEAFAKEVRNRKELLLMDTTFRDAHQSLLATRVRSHDLLKISPYVTHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKRIPNIPFQMLLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPKRTKYDLKYYTNLADELVKAGTHVLCIKDMAGLLKPESARLLITAIRDKHPDIPIHIHTHDTSGAGVASMLACANAGADVVDVAVDSMSGMTSQPSMGAVVASLQGTPLDTNLDLRTVSEYSAYWEQTRTLYAPFECTTTMRSGNADVYLNEIPGGQYTNLQFQAFSLGLGDFFEDVKKAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNDLTADQVLERAEELSFPKSVVEYLQGSIGIPHGGFPEPLRSRVLKDMPRIEGRPGAELKDLDFDKLKKELQE--SHTCVTNRDVMSAALYPQVTNDFLNFREKYGPVDKLDTRIFLTGPKVGEEFDVPLERGKTLSVKALAVSADLKPNGIREVFFELNGQLRAVHILDKEAVKEIHVHPKANKSNKSEVGAPMPGTVIDIRVKVGDKVEKGQPLVVLSAMKMEMVVQSPLAGVVKKLEIANGTKLEGEDLIMIIE 1181          
BLAST of Pyruvate carboxylase vs. Ensembl Fly
Match: PCB (gene:FBgn0027580 transcript:FBtr0088462)

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 793/1175 (67.49%), Postives = 965/1175 (82.13%), Query Frame = 3
Query:   63 KCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHD-FDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALS-DIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K +P      +F N    Y S   +  K IR VLVANRGEIAIRVFRAC E+GI+SVA+YSEQD M MHR KADESY++GKGL PV AYLNI E+I++ K +DVDA+HPGYGFLSERSDFA A  +AG++FIGP  +VV+KMGDKV AR AA++A V +VPG+ GP+ T EEA+EF KK+GLP+I KAAYGGGGRGMRVV+++E + E+F RA SEA AAFGNG MFIEKFIERPRHIEVQ+LGDK GN VHL+ERDCSVQRRHQK+VEIAPAP L + IRDKM   AV+LA+ VGYENAGTVEFL D+ +   YFIEVNARLQVEHTVTE++TG+DLV+SQI +AEG +LPELG TQ++I   GYAIQCR+TTEDPA DFQP++GRLEVFRSGEGMGIRLDSASA+AGAIISPYYDSLL+KVI+HA++ + + +KM R+LREFR+RGVKTNIPFL NVLEN++FL+G +DTYFIDEHP LF+FK S NRAQKLL Y+G ++VNGP T LAT LKP+L++P +PE P+  E P G R++LV  GP+AFA+ VR     L+MDTTFRDAHQSLLATRVR++D+ +ISP+V   F NL+SLENWGGATFDV++RFL ECPWERLE +RK IPNIPFQMLLRGANAVGYT+YPDN+VYKFC+LAVQ+GMDIFRVFD LNYLPN+I+GM+A  KAGGVVEA+  Y+GD++DP +TKY+L YY  LAD+LVK G H+L IKDMAG+LKP +AR+LI  +R K+PDIPIH+H+HDT+GAGVA+MLA A +G D+VD A+DSMSG+TSQPSMGAVVA LQ TPLDT L+L  +  YS+YWEQ R LY PFECTTTMRSGNADVY N+IPGGQYTNLQFQ+FSLGL D FE+VK+ Y  AN LLGD+IKVTPSSK+VGDLAQFMVQN + A  ++E+A+ELS PKSV+E+ QG +G P+GGFPE LRS+V+K+   I GRPG +LK  DF+  K EL +  +H    ++D+MS ALYP V  +F  FRE++GPV KL TRIFL GP++ EE  V LE+GKTL +K LA+S D++P+G+REVFFELNGQLR+V I+DKEA K I V PKA KS +  VG+PMPG V++++VK GD V+KGQ L ++SAMKMEM V SP+ G VK + +A   K+EGEDL++ IE
Sbjct:   15 KTQPRVRLNAIFKNG---YSSK--VEYKPIRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCDE-SGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQPNTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDEHPQLFKFKPSLNRAQKLLNYMGEVLVNGPQTPLATTLKPALVSPHVPEVPLVTEPPKGLREVLVCEGPEAFAKEVRNRKELLLMDTTFRDAHQSLLATRVRSHDLLKISPYVTHKFNNLYSLENWGGATFDVALRFLHECPWERLEEMRKRIPNIPFQMLLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNLILGMEAAGKAGGVVEAAISYTGDVSDPKRTKYDLKYYTNLADELVKAGTHVLCIKDMAGLLKPESARLLITAIRDKHPDIPIHIHTHDTSGAGVASMLACANAGADVVDVAVDSMSGMTSQPSMGAVVASLQGTPLDTNLDLRTVSEYSAYWEQTRTLYAPFECTTTMRSGNADVYLNEIPGGQYTNLQFQAFSLGLGDFFEDVKKAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNDLTADQVLERAEELSFPKSVVEYLQGSIGIPHGGFPEPLRSRVLKDMPRIEGRPGAELKDLDFDKLKKELQE--SHTCVTNRDVMSAALYPQVTNDFLNFREKYGPVDKLDTRIFLTGPKVGEEFDVPLERGKTLSVKALAVSADLKPNGIREVFFELNGQLRAVHILDKEAVKEIHVHPKANKSNKSEVGAPMPGTVIDIRVKVGDKVEKGQPLVVLSAMKMEMVVQSPLAGVVKKLEIANGTKLEGEDLIMIIE 1181          
BLAST of Pyruvate carboxylase vs. Ensembl Zebrafish
Match: pcxa (pyruvate carboxylase a [Source:ZFIN;Acc:ZDB-GENE-090908-3])

HSP 1 Score: 1562.74 bits (4045), Expect = 0.000e+0
Identity = 769/1154 (66.64%), Postives = 935/1154 (81.02%), Query Frame = 3
Query:  117 YKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEI 3578
            + + Q L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIGKGL PVAAYL+I +IIK++K +DVDAIHPGYGFLSER+DFA AC +AG++FIGP  DVVRKMGDKV+AR  A+ A V VVPG+  PI   +EA EF   YG PII KAAYGGGGRGMRVV+E E L EN+ RA SEALAAFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++ +D+V LA+ VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +Q+ + EG+SLPELGL Q++IR  GYAIQCR+TTEDPAR FQPD+GRLEVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIA   +   A AKM R+L EFRVRGVKTNIPFL NVL N +FLNG+VDT FIDE+ +LF  K  QNRAQKLL YLG +MVNGP T +    KPS I+P IP  P+  E P G+RD+L++ GP  FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFVA +F NLFS+ENWGGATFDV+MRFL ECPW+RL+ LR L+PN+PFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD++DPT+ KY+L YYLKLAD+LVK G HIL IKDMAG+LKP++ R+L+G LR ++P +PIH+H+HDTAGAGVA MLA AE+G DIVD A+DSM+G+TSQPSMGAVVAC + T L+TG++LEK++ YS YWE  R LY PF+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ Y  AN LLGD+IKVTPSSKIVGDLAQFMVQN +    + E+ADELS P SV+EF QGH+G P+GGFPE  R+KV+K+   + GRPG  L A DF+A + +L D    +   +D+MS A+YP VF+EF+ F   FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D  A K +   PKA K VRG +G+PMPG+V+EVKVK+G  V+KGQ LC++SAMKME  VNSP+ G V  ++V     +EG+DL++EI
Sbjct:   28 HTAPQTLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGKGLPPVAAYLHIPDIIKVAKANDVDAIHPGYGFLSERADFAQACVDAGVRFIGPTPDVVRKMGDKVQARAIAISAGVPVVPGTDAPISCLQEAQEFSNSYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPATQLDPHLRDRLTADSVNLARQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGYAIQCRVTTEDPARGFQPDTGRLEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIASGKDLPAASAKMSRALAEFRVRGVKTNIPFLQNVLSNNQFLNGTVDTQFIDENSDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSPIDPVIPPVPLG-EPPVGFRDVLLREGPDGFAKAVRAHQGLLLMDTTFRDAHQSLLATRVRTHDLKRIAPFVAHSFNNLFSVENWGGATFDVAMRFLCECPWKRLQELRALMPNVPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMLLGMEAAGTAGGVVEAAISYTGDVSDPTRQKYSLDYYLKLADELVKAGTHILCIKDMAGLLKPDSGRLLVGALRDRFPHVPIHVHTHDTAGAGVAAMLACAEAGADIVDVAVDSMAGMTSQPSMGAVVACTKGTKLNTGISLEKVFDYSEYWEVTRGLYAPFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKSYTEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLTRAEVEERADELSFPLSVVEFLQGHIGIPHGGFPEPFRTKVLKSLPRVEGRPGASLPAMDFQALEKQLKDAHGDEITPEDVMSAAMYPKVFQEFKDFTRTFGPVDCLDTRLFLDGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTVAMKEMHFHPKALKDVRGQIGAPMPGKVVEVKVKQGQQVEKGQPLCVLSAMKMETVVNSPISGTVAKIYVTADSTLEGDDLILEI 1179          
BLAST of Pyruvate carboxylase vs. Ensembl Zebrafish
Match: pcxa (pyruvate carboxylase a [Source:ZFIN;Acc:ZDB-GENE-090908-3])

HSP 1 Score: 1562.74 bits (4045), Expect = 0.000e+0
Identity = 769/1154 (66.64%), Postives = 935/1154 (81.02%), Query Frame = 3
Query:  117 YKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEI 3578
            + + Q L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIGKGL PVAAYL+I +IIK++K +DVDAIHPGYGFLSER+DFA AC +AG++FIGP  DVVRKMGDKV+AR  A+ A V VVPG+  PI   +EA EF   YG PII KAAYGGGGRGMRVV+E E L EN+ RA SEALAAFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++ +D+V LA+ VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +Q+ + EG+SLPELGL Q++IR  GYAIQCR+TTEDPAR FQPD+GRLEVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIA   +   A AKM R+L EFRVRGVKTNIPFL NVL N +FLNG+VDT FIDE+ +LF  K  QNRAQKLL YLG +MVNGP T +    KPS I+P IP  P+  E P G+RD+L++ GP  FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFVA +F NLFS+ENWGGATFDV+MRFL ECPW+RL+ LR L+PN+PFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD++DPT+ KY+L YYLKLAD+LVK G HIL IKDMAG+LKP++ R+L+G LR ++P +PIH+H+HDTAGAGVA MLA AE+G DIVD A+DSM+G+TSQPSMGAVVAC + T L+TG++LEK++ YS YWE  R LY PF+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ Y  AN LLGD+IKVTPSSKIVGDLAQFMVQN +    + E+ADELS P SV+EF QGH+G P+GGFPE  R+KV+K+   + GRPG  L A DF+A + +L D    +   +D+MS A+YP VF+EF+ F   FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D  A K +   PKA K VRG +G+PMPG+V+EVKVK+G  V+KGQ LC++SAMKME  VNSP+ G V  ++V     +EG+DL++EI
Sbjct:   28 HTAPQTLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGKGLPPVAAYLHIPDIIKVAKANDVDAIHPGYGFLSERADFAQACVDAGVRFIGPTPDVVRKMGDKVQARAIAISAGVPVVPGTDAPISCLQEAQEFSNSYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPATQLDPHLRDRLTADSVNLARQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGYAIQCRVTTEDPARGFQPDTGRLEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIASGKDLPAASAKMSRALAEFRVRGVKTNIPFLQNVLSNNQFLNGTVDTQFIDENSDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSPIDPVIPPVPLG-EPPVGFRDVLLREGPDGFAKAVRAHQGLLLMDTTFRDAHQSLLATRVRTHDLKRIAPFVAHSFNNLFSVENWGGATFDVAMRFLCECPWKRLQELRALMPNVPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMLLGMEAAGTAGGVVEAAISYTGDVSDPTRQKYSLDYYLKLADELVKAGTHILCIKDMAGLLKPDSGRLLVGALRDRFPHVPIHVHTHDTAGAGVAAMLACAEAGADIVDVAVDSMAGMTSQPSMGAVVACTKGTKLNTGISLEKVFDYSEYWEVTRGLYAPFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKSYTEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLTRAEVEERADELSFPLSVVEFLQGHIGIPHGGFPEPFRTKVLKSLPRVEGRPGASLPAMDFQALEKQLKDAHGDEITPEDVMSAAMYPKVFQEFKDFTRTFGPVDCLDTRLFLDGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTVAMKEMHFHPKALKDVRGQIGAPMPGKVVEVKVKQGQQVEKGQPLCVLSAMKMETVVNSPISGTVAKIYVTADSTLEGDDLILEI 1179          
BLAST of Pyruvate carboxylase vs. Ensembl Zebrafish
Match: pcxb (pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-000831-1])

HSP 1 Score: 1539.24 bits (3984), Expect = 0.000e+0
Identity = 763/1152 (66.23%), Postives = 927/1152 (80.47%), Query Frame = 3
Query:  123 SDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEI 3578
            S Q L    I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PVAAYL+I +IIK++K ++VDAIHPGYGFLSER+DFA AC EAG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI   +EA EF K Y  PII KAAYGGGGRGMRVV+  E L EN+ RA SEALAAFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAPA +L   +RD++  D+V LAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +Q+ + EG+SLPELGL Q++I+  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GAIISP+YDSLL+KVIA   +   A  KM R+L EFRVRGVKTNIPFL NVL N +FL  +VDT FIDE+ NLF  K +QNRAQKLL YLG +MVNGP+T +    KPS ++P IP   +  E P G+R++L++ GP+ FA+A+R+H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+V+ NF NLFSLENWGGATFDV+MRFL ECPW+RL+ LR LIPN+PFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNY+PN+++GM+A   AGGVVEA+  Y+GD++DP + KY+L YYLKLAD+LVK G HIL IKDMAG+LKP A+R+LI  LR ++PDIPIH+H+HDTAGAGVA MLA A++G DIVD A+DSM+G+TSQPSMGA+VAC + T LDTG++L+K++ YS YWE AR LY PF+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ Y  AN LLGD+IKVTPSSKIVGDLAQFMVQN +    + ++ADELS P SV+EF QGH+G P+GGFPE  RSKV+K+   I GRPG  L   DFEA +  L      +   +D+MS A+YP VF+EF+ F   FGPV  L TR+FL GP+IAEE  V+LE+GK LHIK LAL D+  SG REVFFELNGQLRSV + D  A K +   PKA K VRG VG+PMPG+V+EVKVK G  V+KGQ LC++SAMKME  VNSP+ G +  VHV     +EGEDL++EI
Sbjct:   30 SSQTLEYHPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLSPVAAYLHIPDIIKVAKENNVDAIHPGYGFLSERADFAQACAEAGVRFIGPSPEVVRKMGDKVEARALAIKAGVPVVPGTDAPISCLQEAQEFAKTYDFPIIFKAAYGGGGRGMRVVRNYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAAHLDSHLRDRLTLDSVNLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLEQDKIQINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAIISPHYDSLLVKVIASGKDLPTAATKMHRALTEFRVRGVKTNIPFLQNVLSNSQFLYATVDTQFIDENQNLFNLKPTQNRAQKLLHYLGHVMVNGPMTPIPVKAKPSPVDPVIPSVSLG-EPPLGFREVLLREGPEGFARAIRQHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVSHNFSNLFSLENWGGATFDVAMRFLSECPWKRLQELRALIPNVPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYIPNMLLGMEAAGAAGGVVEAAISYTGDVSDPMRQKYSLDYYLKLADELVKAGTHILSIKDMAGLLKPQASRLLIEALRDRFPDIPIHVHTHDTAGAGVAAMLACAQAGADIVDVAVDSMAGMTSQPSMGAIVACTKGTKLDTGISLDKVFDYSEYWEVARGLYAPFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYTEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLSLAEVEKRADELSFPLSVVEFLQGHIGIPHGGFPEPFRSKVLKSLPRIEGRPGASLPPMDFEALESGLRAAHGDEITPEDVMSAAMYPKVFQEFKEFTSTFGPVDCLNTRLFLDGPKIAEEFQVELERGKILHIKALALGDLNKSGQREVFFELNGQLRSVLVKDTAAMKEMHFHPKALKDVRGQVGAPMPGKVVEVKVKAGQKVEKGQPLCVLSAMKMETVVNSPISGIISKVHVNADSSLEGEDLILEI 1179          
BLAST of Pyruvate carboxylase vs. Ensembl Zebrafish
Match: pcxb (pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-000831-1])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 304/432 (70.37%), Postives = 359/432 (83.10%), Query Frame = 3
Query:  123 SDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTN 1418
            S Q L    I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PVAAYL+I +IIK++K ++VDAIHPGYGFLSER+DFA AC EAG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI   +EA EF K Y  PII KAAYGGGGRGMRVV+  E L EN+ RA SEALAAFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAPA +L   +RD++  D+V LAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +Q+ + EG+SLPELGL Q++I+  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GAIISP+YDSLL+KVIA   +   A  KM R+L EFRVRGVK +
Sbjct:   30 SSQTLEYHPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLSPVAAYLHIPDIIKVAKENNVDAIHPGYGFLSERADFAQACAEAGVRFIGPSPEVVRKMGDKVEARALAIKAGVPVVPGTDAPISCLQEAQEFAKTYDFPIIFKAAYGGGGRGMRVVRNYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAAHLDSHLRDRLTLDSVNLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLEQDKIQINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAIISPHYDSLLVKVIASGKDLPTAATKMHRALTEFRVRGVKVS 460          
BLAST of Pyruvate carboxylase vs. Ensembl Zebrafish
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-050208-450])

HSP 1 Score: 363.999 bits (933), Expect = 1.154e-110
Identity = 192/454 (42.29%), Postives = 276/454 (60.79%), Query Frame = 3
Query:  147 KIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAA---YLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEG-MGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH 1496
            +I KV++ANRGEIA RV R   +MG+RSVA+YS+ D   MH   ADE+Y IG    P A+   YL + +I+ ++K     A+HPGYGFLSE ++FA  C + GI FIGPP+  +R MG K  ++     A V ++ G  G  Q+         + G P+++KA  GGGG+GMR+ +      E    A+ EA  +F +  M IEKF+E PRH+EVQ+ GD++G+AV+LFERDCSVQRRHQKI+E AP P ++  +R K+   AV+ AK V Y  AGTVEF+ D      YF+E+N RLQVEH V+E +TG DLV  Q+ +A G+ LP   L+QE+I   G++ + RI  EDP  +F P +G L    +  G    R+++     G  +S +YD ++ K++    +   A  K+   LR++ + G+ TNI FL ++  +  F  G+V T FI +H
Sbjct:   35 RIEKVVIANRGEIACRVMRTARKMGVRSVAVYSDADRHSMHVAMADEAYHIG----PAASQQSYLCMDKILDVAKKSSAQAVHPGYGFLSENTEFAEQCKQEGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIEGYHGDDQSDARLQSEAARIGYPVMIKAVRGGGGKGMRIAQSEAEFHEQLESARREARKSFNDDVMLIEKFVENPRHVEVQVFGDQYGDAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRRKLGEAAVRAAKAVNYVGAGTVEFIMD-AQHNFYFMEMNTRLQVEHPVSEMITGTDLVEWQLRVAAGEKLP---LSQEQIELRGHSFEARIYAEDPNNNFLPGAGPLLHLSTPPGDHNTRIETG-VREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVHTSFIPQH 479          
BLAST of Pyruvate carboxylase vs. Ensembl Xenopus
Match: hoxd3 (homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462])

HSP 1 Score: 1557.73 bits (4032), Expect = 0.000e+0
Identity = 771/1155 (66.75%), Postives = 936/1155 (81.04%), Query Frame = 3
Query:  117 YKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            ++S Q +  K I+KVLVANRGEIA RVFRAC E+GIR+VA+YSEQDT QMHR KADE+Y+IGKGL PV AYLNI +IIK++K ++VDA+HPGYGFLSERSDFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI    EA EF  KYG PII KAAYGGGGRGMRVV+  E L EN+TRA SEAL+AFGNG +F+EKFIE+PRHIEVQILGDKFGN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++  D+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI IAEGKSLPELGL QE IR  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIAH  + ++A  KM R+L EFR+RGVKTNIPFL NVL N +FL+G+VDT FIDE+P+LF  K  QNRAQKLL YLG +MVNGP T +    KPS ++P +P  P+      G+RDIL++ GP+ FA+A+R+H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFV+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+I+GM+A  +AGGVVEA+  Y+GD+ DPT+TKY L YY+ LA++LVK G HIL IKDMAG+LKP ++ +LI  LR ++P+IPIH+H+HDTAGAGVA+MLA A +G DIVD A+DSMSG+TSQPSMGA+VAC + T  DTG+ LEK++ YS YWE AR LY  F+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN +LGDVIKVTPSSKIVGDLAQFMV N ++ + +   ADELS P SV+E+ QG+VG PYGGFPE  RSKV+K+   I GRPG  L + DF   + +L   ++ D   +DIMS A+YP VF+E++ F  +FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D +A K +   PKA K V+G +G+PMPG+V+++KVKEG  V+KGQ LC++SAMKME  VNSPV G VK V+V   M +EGEDL++EIE
Sbjct:   63 FQSTQRVDYKPIKKVLVANRGEIATRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYIIGKGLPPVQAYLNIPDIIKVAKENEVDAVHPGYGFLSERSDFAQACTDAGVRFIGPSPEVVRKMGDKVEARAIAISAGVPVVPGTDSPISCLTEAKEFSNKYGFPIIFKAAYGGGGRGMRVVRSYEELEENYTRAYSEALSAFGNGALFVEKFIEKPRHIEVQILGDKFGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPQLRDRLTHDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHIAEGKSLPELGLKQENIRINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIAHGKDQQVAATKMSRALAEFRIRGVKTNIPFLQNVLNNNQFLHGTVDTQFIDENPDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSVDPVVPPIPMNDPP-PGFRDILLREGPEGFAKAIRQHKGLLLMDTTFRDAHQSLLATRVRTHDLKNIAPFVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMILGMEAAGRAGGVVEAAISYTGDVADPTRTKYTLDYYVNLAEELVKAGTHILCIKDMAGLLKPKSSDMLIRALRDRFPNIPIHVHTHDTAGAGVASMLACAHAGADIVDVAVDSMSGMTSQPSMGALVACAKGTDQDTGIQLEKVFDYSEYWEVARGLYSAFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKILGDVIKVTPSSKIVGDLAQFMVHNGLNREQVETMADELSFPLSVVEYMQGYVGIPYGGFPEPFRSKVLKDLPRIEGRPGASLPSMDFTKLEEKLKSKYD-DITPEDIMSAAMYPKVFEEYKDFGSQFGPVECLNTRLFLEGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVKEGTKVEKGQPLCVLSAMKMETLVNSPVTGTVKKVYVKTDMHLEGEDLLLEIE 1214          
BLAST of Pyruvate carboxylase vs. Ensembl Xenopus
Match: hoxd3 (homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462])

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 761/1137 (66.93%), Postives = 922/1137 (81.09%), Query Frame = 3
Query:  171 NRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            N GEIA RVFRAC E+GIR+VA+YSEQDT QMHR KADE+Y+IGKGL PV AYLNI +IIK++K ++VDA+HPGYGFLSERSDFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI    EA EF  KYG PII KAAYGGGGRGMRVV+  E L EN+TRA SEAL+AFGNG +F+EKFIE+PRHIEVQILGDKFGN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++  D+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI IAEGKSLPELGL QE IR  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIAH  + ++A  KM R+L EFR+RGVKTNIPFL NVL N +FL+G+VDT FIDE+P+LF  K  QNRAQKLL YLG +MVNGP T +    KPS ++P +P  P+      G+RDIL++ GP+ FA+A+R+H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFV+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+I+GM+A  +AGGVVEA+  Y+GD+ DPT+TKY L YY+ LA++LVK G HIL IKDMAG+LKP ++ +LI  LR ++P+IPIH+H+HDTAGAGVA+MLA A +G DIVD A+DSMSG+TSQPSMGA+VAC + T  DTG+ LEK++ YS YWE AR LY  F+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN +LGDVIKVTPSSKIVGDLAQFMV N ++ + +   ADELS P SV+E+ QG+VG PYGGFPE  RSKV+K+   I GRPG  L + DF   + +L   ++ D   +DIMS A+YP VF+E++ F  +FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D +A K +   PKA K V+G +G+PMPG+V+++KVKEG  V+KGQ LC++SAMKME  VNSPV G VK V+V   M +EGEDL++EIE
Sbjct:   35 NTGEIATRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYIIGKGLPPVQAYLNIPDIIKVAKENEVDAVHPGYGFLSERSDFAQACTDAGVRFIGPSPEVVRKMGDKVEARAIAISAGVPVVPGTDSPISCLTEAKEFSNKYGFPIIFKAAYGGGGRGMRVVRSYEELEENYTRAYSEALSAFGNGALFVEKFIEKPRHIEVQILGDKFGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPQLRDRLTHDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHIAEGKSLPELGLKQENIRINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIAHGKDQQVAATKMSRALAEFRIRGVKTNIPFLQNVLNNNQFLHGTVDTQFIDENPDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSVDPVVPPIPMNDPP-PGFRDILLREGPEGFAKAIRQHKGLLLMDTTFRDAHQSLLATRVRTHDLKNIAPFVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMILGMEAAGRAGGVVEAAISYTGDVADPTRTKYTLDYYVNLAEELVKAGTHILCIKDMAGLLKPKSSDMLIRALRDRFPNIPIHVHTHDTAGAGVASMLACAHAGADIVDVAVDSMSGMTSQPSMGALVACAKGTDQDTGIQLEKVFDYSEYWEVARGLYSAFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKILGDVIKVTPSSKIVGDLAQFMVHNGLNREQVETMADELSFPLSVVEYMQGYVGIPYGGFPEPFRSKVLKDLPRIEGRPGASLPSMDFTKLEEKLKSKYD-DITPEDIMSAAMYPKVFEEYKDFGSQFGPVECLNTRLFLEGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVKEGTKVEKGQPLCVLSAMKMETLVNSPVTGTVKKVYVKTDMHLEGEDLLLEIE 1168          
BLAST of Pyruvate carboxylase vs. Ensembl Xenopus
Match: hoxd3 (homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462])

HSP 1 Score: 1540.78 bits (3988), Expect = 0.000e+0
Identity = 761/1137 (66.93%), Postives = 922/1137 (81.09%), Query Frame = 3
Query:  171 NRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            N GEIA RVFRAC E+GIR+VA+YSEQDT QMHR KADE+Y+IGKGL PV AYLNI +IIK++K ++VDA+HPGYGFLSERSDFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI    EA EF  KYG PII KAAYGGGGRGMRVV+  E L EN+TRA SEAL+AFGNG +F+EKFIE+PRHIEVQILGDKFGN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++  D+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI IAEGKSLPELGL QE IR  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIAH  + ++A  KM R+L EFR+RGVKTNIPFL NVL N +FL+G+VDT FIDE+P+LF  K  QNRAQKLL YLG +MVNGP T +    KPS ++P +P  P+      G+RDIL++ GP+ FA+A+R+H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFV+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+I+GM+A  +AGGVVEA+  Y+GD+ DPT+TKY L YY+ LA++LVK G HIL IKDMAG+LKP ++ +LI  LR ++P+IPIH+H+HDTAGAGVA+MLA A +G DIVD A+DSMSG+TSQPSMGA+VAC + T  DTG+ LEK++ YS YWE AR LY  F+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN +LGDVIKVTPSSKIVGDLAQFMV N ++ + +   ADELS P SV+E+ QG+VG PYGGFPE  RSKV+K+   I GRPG  L + DF   + +L   ++ D   +DIMS A+YP VF+E++ F  +FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D +A K +   PKA K V+G +G+PMPG+V+++KVKEG  V+KGQ LC++SAMKME  VNSPV G VK V+V   M +EGEDL++EIE
Sbjct:   38 NTGEIATRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYIIGKGLPPVQAYLNIPDIIKVAKENEVDAVHPGYGFLSERSDFAQACTDAGVRFIGPSPEVVRKMGDKVEARAIAISAGVPVVPGTDSPISCLTEAKEFSNKYGFPIIFKAAYGGGGRGMRVVRSYEELEENYTRAYSEALSAFGNGALFVEKFIEKPRHIEVQILGDKFGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPQLRDRLTHDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHIAEGKSLPELGLKQENIRINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIAHGKDQQVAATKMSRALAEFRIRGVKTNIPFLQNVLNNNQFLHGTVDTQFIDENPDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSVDPVVPPIPMNDPP-PGFRDILLREGPEGFAKAIRQHKGLLLMDTTFRDAHQSLLATRVRTHDLKNIAPFVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMILGMEAAGRAGGVVEAAISYTGDVADPTRTKYTLDYYVNLAEELVKAGTHILCIKDMAGLLKPKSSDMLIRALRDRFPNIPIHVHTHDTAGAGVASMLACAHAGADIVDVAVDSMSGMTSQPSMGALVACAKGTDQDTGIQLEKVFDYSEYWEVARGLYSAFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKILGDVIKVTPSSKIVGDLAQFMVHNGLNREQVETMADELSFPLSVVEYMQGYVGIPYGGFPEPFRSKVLKDLPRIEGRPGASLPSMDFTKLEEKLKSKYD-DITPEDIMSAAMYPKVFEEYKDFGSQFGPVECLNTRLFLEGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVKEGTKVEKGQPLCVLSAMKMETLVNSPVTGTVKKVYVKTDMHLEGEDLLLEIE 1171          
BLAST of Pyruvate carboxylase vs. Ensembl Xenopus
Match: hoxd3 (homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462])

HSP 1 Score: 1540.4 bits (3987), Expect = 0.000e+0
Identity = 761/1137 (66.93%), Postives = 922/1137 (81.09%), Query Frame = 3
Query:  171 NRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            N GEIA RVFRAC E+GIR+VA+YSEQDT QMHR KADE+Y+IGKGL PV AYLNI +IIK++K ++VDA+HPGYGFLSERSDFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI    EA EF  KYG PII KAAYGGGGRGMRVV+  E L EN+TRA SEAL+AFGNG +F+EKFIE+PRHIEVQILGDKFGN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++  D+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI IAEGKSLPELGL QE IR  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIAH  + ++A  KM R+L EFR+RGVKTNIPFL NVL N +FL+G+VDT FIDE+P+LF  K  QNRAQKLL YLG +MVNGP T +    KPS ++P +P  P+      G+RDIL++ GP+ FA+A+R+H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFV+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+I+GM+A  +AGGVVEA+  Y+GD+ DPT+TKY L YY+ LA++LVK G HIL IKDMAG+LKP ++ +LI  LR ++P+IPIH+H+HDTAGAGVA+MLA A +G DIVD A+DSMSG+TSQPSMGA+VAC + T  DTG+ LEK++ YS YWE AR LY  F+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN +LGDVIKVTPSSKIVGDLAQFMV N ++ + +   ADELS P SV+E+ QG+VG PYGGFPE  RSKV+K+   I GRPG  L + DF   + +L   ++ D   +DIMS A+YP VF+E++ F  +FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D +A K +   PKA K V+G +G+PMPG+V+++KVKEG  V+KGQ LC++SAMKME  VNSPV G VK V+V   M +EGEDL++EIE
Sbjct:   31 NTGEIATRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYIIGKGLPPVQAYLNIPDIIKVAKENEVDAVHPGYGFLSERSDFAQACTDAGVRFIGPSPEVVRKMGDKVEARAIAISAGVPVVPGTDSPISCLTEAKEFSNKYGFPIIFKAAYGGGGRGMRVVRSYEELEENYTRAYSEALSAFGNGALFVEKFIEKPRHIEVQILGDKFGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPQLRDRLTHDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHIAEGKSLPELGLKQENIRINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIAHGKDQQVAATKMSRALAEFRIRGVKTNIPFLQNVLNNNQFLHGTVDTQFIDENPDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSVDPVVPPIPMNDPP-PGFRDILLREGPEGFAKAIRQHKGLLLMDTTFRDAHQSLLATRVRTHDLKNIAPFVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMILGMEAAGRAGGVVEAAISYTGDVADPTRTKYTLDYYVNLAEELVKAGTHILCIKDMAGLLKPKSSDMLIRALRDRFPNIPIHVHTHDTAGAGVASMLACAHAGADIVDVAVDSMSGMTSQPSMGALVACAKGTDQDTGIQLEKVFDYSEYWEVARGLYSAFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKILGDVIKVTPSSKIVGDLAQFMVHNGLNREQVETMADELSFPLSVVEYMQGYVGIPYGGFPEPFRSKVLKDLPRIEGRPGASLPSMDFTKLEEKLKSKYD-DITPEDIMSAAMYPKVFEEYKDFGSQFGPVECLNTRLFLEGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVKEGTKVEKGQPLCVLSAMKMETLVNSPVTGTVKKVYVKTDMHLEGEDLLLEIE 1164          
BLAST of Pyruvate carboxylase vs. Ensembl Xenopus
Match: hoxd3 (homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462])

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 654/944 (69.28%), Postives = 783/944 (82.94%), Query Frame = 3
Query:  117 YKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKV 2948
            ++S Q +  K I+KVLVANRGEIA RVFRAC E+GIR+VA+YSEQDT QMHR KADE+Y+IGKGL PV AYLNI +IIK++K ++VDA+HPGYGFLSERSDFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI    EA EF  KYG PII KAAYGGGGRGMRVV+  E L EN+TRA SEAL+AFGNG +F+EKFIE+PRHIEVQILGDKFGN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++  D+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI IAEGKSLPELGL QE IR  G AIQCR+TTEDP+R FQPD+GR+EVFRSGEGMGIRLDSASAF GA+ISP+YDSLL+KVIAH  + ++A  KM R+L EFR+RGVKTNIPFL NVL N +FL+G+VDT FIDE+P+LF  K  QNRAQKLL YLG +MVNGP T +    KPS ++P +P  P+      G+RDIL++ GP+ FA+A+R+H G L+MDTTFRDAHQSLLATRVRT+D+  I+PFV+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+I+GM+A  +AGGVVEA+  Y+GD+ DPT+TKY L YY+ LA++LVK G HIL IKDMAG+LKP ++ +LI  LR ++P+IPIH+H+HDTAGAGVA+MLA A +G DIVD A+DSMSG+TSQPSMGA+VAC + T  DTG+ LEK++ YS YWE AR LY  F+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN +LGDVIKVTPSSKIVGDLAQFMV N ++ + +   ADELS P SV+E+ QG+VG PYGGFPE  RSKV
Sbjct:   26 FQSTQRVDYKPIKKVLVANRGEIATRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYIIGKGLPPVQAYLNIPDIIKVAKENEVDAVHPGYGFLSERSDFAQACTDAGVRFIGPSPEVVRKMGDKVEARAIAISAGVPVVPGTDSPISCLTEAKEFSNKYGFPIIFKAAYGGGGRGMRVVRSYEELEENYTRAYSEALSAFGNGALFVEKFIEKPRHIEVQILGDKFGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPQLRDRLTHDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHIAEGKSLPELGLKQENIRINGCAIQCRVTTEDPSRGFQPDTGRIEVFRSGEGMGIRLDSASAFQGAVISPHYDSLLVKVIAHGKDQQVAATKMSRALAEFRIRGVKTNIPFLQNVLNNNQFLHGTVDTQFIDENPDLFNLKPVQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSVDPVVPPIPMNDPP-PGFRDILLREGPEGFAKAIRQHKGLLLMDTTFRDAHQSLLATRVRTHDLKNIAPFVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMILGMEAAGRAGGVVEAAISYTGDVADPTRTKYTLDYYVNLAEELVKAGTHILCIKDMAGLLKPKSSDMLIRALRDRFPNIPIHVHTHDTAGAGVASMLACAHAGADIVDVAVDSMSGMTSQPSMGALVACAKGTDQDTGIQLEKVFDYSEYWEVARGLYSAFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKILGDVIKVTPSSKIVGDLAQFMVHNGLNREQVETMADELSFPLSVVEYMQGYVGIPYGGFPEPFRSKV 967          

HSP 2 Score: 166.392 bits (420), Expect = 4.846e-41
Identity = 80/129 (62.02%), Postives = 101/129 (78.29%), Query Frame = 3
Query: 3195 VDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D +A K +   PKA K V+G +G+PMPG+V+++KVKEG  V+KGQ LC++SAMKME  VNSPV G VK V+V   M +EGEDL++EIE
Sbjct:  967 VELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVKEGTKVEKGQPLCVLSAMKMETLVNSPVTGTVKKVYVKTDMHLEGEDLLLEIE 1095          
BLAST of Pyruvate carboxylase vs. Ensembl Mouse
Match: Pcx (pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97520])

HSP 1 Score: 1517.29 bits (3927), Expect = 0.000e+0
Identity = 739/1149 (64.32%), Postives = 925/1149 (80.50%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K + VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI ++EG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNIPFL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +  ++ PS ++P +P  PI      G+RDIL++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A+DSMSG+TSQPSMGA+VAC + TPLDT + LE+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   I GRPG  L   + +  + +L D    +   +D++S A+YP VF +F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  GD V KGQ LC++SAMKME  V SP++G ++ VHV   M +EG+DL++EIE
Sbjct:   33 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVNVSPSPVDPAVPVVPIGPPP-AGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFNKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1179          
BLAST of Pyruvate carboxylase vs. Ensembl Mouse
Match: Pcx (pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97520])

HSP 1 Score: 1516.52 bits (3925), Expect = 0.000e+0
Identity = 739/1149 (64.32%), Postives = 925/1149 (80.50%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K + VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI ++EG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNIPFL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +  ++ PS ++P +P  PI      G+RDIL++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A+DSMSG+TSQPSMGA+VAC + TPLDT + LE+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   I GRPG  L   + +  + +L D    +   +D++S A+YP VF +F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  GD V KGQ LC++SAMKME  V SP++G ++ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVNVSPSPVDPAVPVVPIGPPP-AGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFNKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Mouse
Match: Pcx (pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97520])

HSP 1 Score: 1516.52 bits (3925), Expect = 0.000e+0
Identity = 739/1149 (64.32%), Postives = 925/1149 (80.50%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K + VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI ++EG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNIPFL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +  ++ PS ++P +P  PI      G+RDIL++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A+DSMSG+TSQPSMGA+VAC + TPLDT + LE+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   I GRPG  L   + +  + +L D    +   +D++S A+YP VF +F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  GD V KGQ LC++SAMKME  V SP++G ++ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVNVSPSPVDPAVPVVPIGPPP-AGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFNKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. Ensembl Mouse
Match: Mccc1 (methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) [Source:MGI Symbol;Acc:MGI:1919289])

HSP 1 Score: 361.303 bits (926), Expect = 1.816e-109
Identity = 200/450 (44.44%), Postives = 277/450 (61.56%), Query Frame = 3
Query:  150 IRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRL-EVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH 1496
            I KVL+ANRGEIA RV R   +MG++SVA+YSE D   MH   ADE+Y IG       +YL + +II+++K     AIHPGYGFLSE  +FA  C + GI FIGPP+  +R MG K  ++     A V VV G  G  Q+ +   E   K G P+++KA  GGGG+GMR+V+      E    A+ EA  +F +  M IEKF++ PRH+EVQ+ GD  GNAV+LFERDCSVQRRHQKI+E APAP +   +R K+   AV+ AK V Y  AGTVEF+ D      YF+E+N RLQVEH VTE +TG DLV  Q+ IA G+ +P   L+QEEI   G+A + RI  EDP  +F P +G L  +      M  R+++     G  +S +YD ++ K++  A++ + A +K+   L ++ + G+++N+ FL  +  +  F  G+V T FI +H
Sbjct:   45 ITKVLIANRGEIACRVIRTAKKMGVQSVAVYSEADRNSMHVDMADEAYSIGPAPSQ-QSYLAMEKIIQVAKSSAAQAIHPGYGFLSENMEFAELCKQEGIIFIGPPSSAIRDMGIKSTSKSIMAAAGVPVVEGYHGKDQSDQCLREHAGKIGYPVMIKAVRGGGGKGMRIVRSEREFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQRRHQKIIEEAPAPGINPEVRRKLGEAAVRAAKAVKYVGAGTVEFIMDS-RHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRIAAGEKIP---LSQEEIPLQGHAFEARIYAEDPDNNFMPGAGPLVHLSTPSADMSTRIETG-VRQGDEVSVHYDPMIAKLVVWASDRQSALSKLRYCLHQYNIVGLRSNVDFLLRLSGHPEFEAGNVHTDFIPQH 488          
BLAST of Pyruvate carboxylase vs. Ensembl Mouse
Match: Pcca (propionyl-Coenzyme A carboxylase, alpha polypeptide [Source:MGI Symbol;Acc:MGI:97499])

HSP 1 Score: 351.288 bits (900), Expect = 1.011e-105
Identity = 197/461 (42.73%), Postives = 290/461 (62.91%), Query Frame = 3
Query:  141 QKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVA-AYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQ-PDSGRLEVFRSGEGM-GIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFI-DEHPNLFQ 1511
            +K   K+L+ANRGEIA RV + C +MGI++VAI+S+ D   +H   ADE+  +G    P + +YLN+  I++  K     A+HPGYGFLSE  +FA       + FIGP    ++ MGDK+E++  A  A V  +PG  G ++  +EA+   ++ G P+++KA+ GGGG+GMR+  + E   + F  +  EA ++FG+  + IEKFI+ PRHIE+Q+LGDK GNA+ L ER+CS+QRR+QK+VE AP+  L    R  M   AV LAK V Y +AGTVEFL D   +  YF+E+N RLQVEH VTE +TG+DLV+  IL+A+G  L      QE+I   G+A++CR+  EDP + F  P  GRL  ++    + G+R+DS     G+ IS YYD ++ K++ + ++   A  +M  +L  + +RGV  NIP L  V+ N RF+ G + T F+ D +P+ F+
Sbjct:   56 EKTFDKILIANRGEIACRVIKTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPA--PTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIESKLLAKRAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDPETRQAMGEQAVALAKAVKYSSAGTVEFLVDSQKN-FYFLEMNTRLQVEHPVTECITGLDLVQEMILVAKGYPLRH---KQEDIPISGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPIHLPGVRVDSGIQ-PGSDISIYYDPMISKLVTYGSDRAEALKRMEDALDNYVIRGVTHNIPLLREVIINTRFVKGDISTKFLSDVYPDGFK 509          

HSP 2 Score: 65.0846 bits (157), Expect = 5.357e-10
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 3
Query: 3291 GQLRSVEIVDKEASKTIR-VRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            G +  V I+ K A++  + +  K  K    ++ SPMPG V+ V VK GD V +GQ +C+I AMKM+ S+ +   GKVK+VH      +   DL++E+E
Sbjct:  627 GTVYKVHILTKLAAELNKFMLEKVPKDTSSTLCSPMPGVVVAVSVKPGDMVAEGQEICVIEAMKMQNSMTAGKMGKVKLVHCKAGDTVGEGDLLVELE 724          
BLAST of Pyruvate carboxylase vs. UniProt/SwissProt
Match: sp|O17732|PYC1_CAEEL (Pyruvate carboxylase 1 OS=Caenorhabditis elegans OX=6239 GN=pyc-1 PE=1 SV=1)

HSP 1 Score: 1600.49 bits (4143), Expect = 0.000e+0
Identity = 774/1156 (66.96%), Postives = 945/1156 (81.75%), Query Frame = 3
Query:  114 NYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            NY ++ ++  ++  KV+VANRGEIAIRVFRA  E+   SVAIY+EQD   MHRLKADE+YL+GKGL PVAAYL I +II+ +  H++DAIHPGYGFLSERSDFAAAC  AGI FIGP  DV+ +MGDKV ARQAA++A V VVPG+PGPI T +EA+EF K+YG PIILKAAYGGGGRG+R V +LE + E F R+ SEA AAFG+G +F+EKF+ERPRHIEVQ+LGD  GN VHL+ERDCSVQRRHQK+VEIAPAP L   +R+K+L+DA++LA+ VGY+NAGTVEFL DQ    +YFIEVNARLQVEHTVTE++TGVDLV++QI IAEGKSL +L L+QE I++ G AIQCR+TTEDPA+ FQPDSGR+EVFRSGEGMGIRLDSASAFAG++ISP+YDSL++KVIA A N   A AKM+R+L++FR+RGVKTNIPFL NVL    FL+ SVDTYFIDEHP LFQFK SQNRAQKLL YLG + VNGP T LATDLKP++++P IP  P   + PTG RD+LV+ GP  FA+ VR  PGC+I DTTFRDAHQSLLATRVRTYDMA ISPFVAQ+F  LFSLENWGGATFDVSMRFL ECPWERL+TLRKLIPNIPFQ LLRGANA+GY+NYPDN++YKFC+LAV++GMD+FRVFD LNYLPN++VGM+AV KAGGVVEA+  Y+GD+TD ++ KY+L YYL LAD LVK  AHIL IKDMAGVLKP AA++LIG LR K+PDIPIH+H+HDT+GAGVA ML  A++G D+VD A+DSMSG+TSQPSMGA+VA LQ T  DTGL+L+ I  YS+YWE  R+LY PFEC TTM+SGNADVY ++IPGGQYTNLQFQ+FSLGL  QF+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +  +TLV++AD+LS PKSV++F QG+VG+P  GFPE LR+KV++    + GRPG++ K  D +A K EL +       ++D+MSY+++P VF EF+ FR+++GPV KL TR+FL G  IAEE+ V++E GKTL I+ LA   +   G REVFF+LNGQ+RS+ +VDKEASK I  RP+A   VRG +G+PMPG+VLE+K+KEGD V K Q L ++SAMKMEM ++SP+ G VK +H     K    DL++E+E
Sbjct:   21 NY-ANGVIKPREFNKVMVANRGEIAIRVFRALTELNKTSVAIYAEQDKNSMHRLKADEAYLVGKGLPPVAAYLTIDQIIETALKHNIDAIHPGYGFLSERSDFAAACQNAGIVFIGPSPDVMARMGDKVAARQAAIEAGVQVVPGTPGPITTADEAVEFAKQYGTPIILKAAYGGGGRGIRRVDKLEEVEEAFRRSYSEAQAAFGDGSLFVEKFVERPRHIEVQLLGDHHGNIVHLYERDCSVQRRHQKVVEIAPAPALPEGVREKILADALRLARHVGYQNAGTVEFLVDQ-KGNYYFIEVNARLQVEHTVTEEITGVDLVQAQIRIAEGKSLDDLKLSQETIQTTGSAIQCRVTTEDPAKGFQPDSGRIEVFRSGEGMGIRLDSASAFAGSVISPHYDSLMVKVIASARNHPNAAAKMIRALKKFRIRGVKTNIPFLLNVLRQPSFLDASVDTYFIDEHPELFQFKPSQNRAQKLLNYLGEVKVNGPTTPLATDLKPAVVSPPIPYIPAGAKPPTGLRDVLVQRGPTEFAKEVRSRPGCMITDTTFRDAHQSLLATRVRTYDMAAISPFVAQSFNGLFSLENWGGATFDVSMRFLHECPWERLQTLRKLIPNIPFQCLLRGANAMGYSNYPDNVIYKFCELAVKNGMDVFRVFDSLNYLPNLLVGMEAVGKAGGVVEAAIAYTGDVTDKSRDKYDLKYYLNLADQLVKAQAHILSIKDMAGVLKPEAAKLLIGALRDKFPDIPIHVHTHDTSGAGVAAMLECAKAGADVVDAAVDSMSGMTSQPSMGAIVASLQGTKHDTGLSLDDISKYSAYWESTRQLYAPFECATTMKSGNADVYKHEIPGGQYTNLQFQAFSLGLGPQFDEVKRMYREANLVLGDIIKVTPSSKIVGDLAQFMVQNNLTRETLVDRADDLSFPKSVVDFMQGNVGQPPYGFPEPLRTKVLRGKPKVDGRPGENAKPVDLDAVKVELEEKHGRTLSEEDVMSYSMFPTVFDEFETFRQQYGPVDKLPTRLFLTGLEIAEEVDVEIESGKTLAIQLLAEGKLNKRGEREVFFDLNGQMRSIFVVDKEASKEIVTRPRALPGVRGHIGAPMPGDVLELKIKEGDKVTKKQPLFVLSAMKMEMVIDSPIAGTVKAIHAPQGTKCSAGDLVVEVE 1174          
BLAST of Pyruvate carboxylase vs. UniProt/SwissProt
Match: sp|P11498|PYC_HUMAN (Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2)

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 743/1149 (64.66%), Postives = 922/1149 (80.24%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VAIYSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNI FL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI    P G+RDIL++ GP+ FA+AVR HPG L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A DSMSG+TSQPSMGA+VAC + TPLDT + +E+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   + GRPG  L   D +A + EL D    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SP++G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPP-PAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. UniProt/SwissProt
Match: sp|Q29RK2|PYC_BOVIN (Pyruvate carboxylase, mitochondrial OS=Bos taurus OX=9913 GN=PC PE=2 SV=2)

HSP 1 Score: 1534.62 bits (3972), Expect = 0.000e+0
Identity = 745/1149 (64.84%), Postives = 924/1149 (80.42%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K ++VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI +AEG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNIPFL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +     PS  +P +P  PI     TG+RDIL++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +ISP+VA +F  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+L+PNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMDIFRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD++DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A +G D+VD A DSMSG+TSQPSMGA+VAC + TPLDTG+ LE+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE LRSKV+K+   + GRPG  L   D +A + EL +    +   +D++S A+YP VF  F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  G  V KGQ LC++SAMKME  V SPV+G V+ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDR-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPIVPVVPIGPPP-TGFRDILLREGPEGFARAVRNHEGLLLMDTTFRDAHQSLLATRVRTHDLKKISPYVAHSFNKLFSIENWGGATFDVAMRFLYECPWRRLQELRELVPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDIFRVFDSLNYLPNLLLGMEAAGSAGGVVEAAISYTGDVSDPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAHAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTGVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLTRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPLRSKVLKDLPRVEGRPGASLPPLDLQALEKELTERHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAISDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGAKVTKGQPLCVLSAMKMETVVTSPVEGTVRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. UniProt/SwissProt
Match: sp|P52873|PYC_RAT (Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pc PE=1 SV=2)

HSP 1 Score: 1519.21 bits (3932), Expect = 0.000e+0
Identity = 738/1149 (64.23%), Postives = 923/1149 (80.33%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K + VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   YG PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI ++EG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNIPFL NVL N++FL G VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +   + PS ++P +P  PI      G+RDIL++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF NLFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FR+FD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+G+GVA MLA A++G D+VD A+DSMSG+TSQPSMGA+VAC + TPLDT + LE+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   I GRPG  L   + +  + +L D    +   +D++S A+YP VF +F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V++VKV  G  V KGQ LC++SAMKME  V SP++G ++ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTNSPINSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGIVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKVSPSPVDPIVPVVPIGPPP-AGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFNNLFSIENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRIFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGSGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDVKVAAGAKVVKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. UniProt/SwissProt
Match: sp|Q05920|PYC_MOUSE (Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1)

HSP 1 Score: 1515.36 bits (3922), Expect = 0.000e+0
Identity = 738/1149 (64.23%), Postives = 925/1149 (80.50%), Query Frame = 3
Query:  135 LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            L  K I+KV+VANRGEIAIRVFRAC E+GIR+VA+YSEQDT QMHR KADE+YLIG+GL PV AYL+I +IIK++K + VDA+HPGYGFLSER+DFA AC +AG++FIGP  +VVRKMGDKVEAR  A+ A V VVPG+  PI +  EA EF   +G PII KAAYGGGGRGMRVV   E L EN+TRA SEALAAFGNG +F+EKFIE+PRHIEVQILGD++GN +HL+ERDCS+QRRHQK+VEIAPA +L   +R ++ SD+VKLAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +QI ++EG+SLP+LGL QE IR  G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLD+ASAF GA+ISP+YDSLL+KVIAH  +   A  KM R+L EFRVRGVKTNIPFL NVL N++FL G+VDT FIDE+P LFQ + +QNRAQKLL YLG +MVNGP T +  ++ PS ++P +P  PI      G+RDIL++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+VA NF  LFS+ENWGGATFDV+MRFL ECPW RL+ LR+LIPNIPFQMLLRGANAVGYTNYPDN+V+KFC++A ++GMD+FRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD+ DP++TKY+L YY+ LA++LV+ G HIL IKDMAG+LKP A  +L+  LR ++PD+P+H+H+HDT+GAGVA MLA A++G D+VD A+DSMSG+TSQPSMGA+VAC + TPLDT + LE+++ YS YWE AR LY  F+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ Y  AN +LGD+IKVTPSSKIVGDLAQFMVQN +       +A+ELS P+SV+EF QG++G P+GGFPE  RSKV+K+   I GRPG  L   + +  + +L D    +   +D++S A+YP VF +F+ F   FGP+  L TR+FL GP+IAEE  V+LE+GKTLHIK LA+SD+  +G R+VFFELNGQLRS+ + D +A K +   PKA K V+G +G+PMPG+V+++KV  GD V KGQ LC++SAMKME  V SP++G ++ VHV   M +EG+DL++EIE
Sbjct:   32 LEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTFGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVNVSPSPVDPAVPVVPIGPPP-AGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFNKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Pyruvate carboxylase vs. TrEMBL
Match: A0A4Z2CX27 (Pyruvate carboxylase OS=Schistosoma japonicum OX=6182 GN=EWB00_006959 PE=4 SV=1)

HSP 1 Score: 1683.31 bits (4358), Expect = 0.000e+0
Identity = 814/1151 (70.72%), Postives = 969/1151 (84.19%), Query Frame = 3
Query:  129 QILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            Q  T K+I+K++VANRGEIAIR+FRAC EM IR+VAIYSEQD MQMHR KADESYLIGK L PVAAYLNI EII+++  HDV+AIHPGYGFLSERS+FA AC +AGI FIGP A VV++MGDKVEARQAA++ANV+VVPGSPGPI + EEAMEF K+YGLP+ILKAAYGGGGRGMRVV++LE L +NF  A SEALAAFGNG MFIEKFIERPRHIEVQILGDK+G  VHL+ERDCSVQRRHQK+VEIAPAPNL  +IR+ +L+DAV+LA  VGYENAGTVEFLYDQ + ++YFIEVNARLQVEHTVTE++TGVDLVRSQI IAEG+SL +L LTQ++I S GYAIQCRITTEDPA+ FQPDSGR+EVF+SGEGMGIRLDSASAFAGAIISPYYDSLL+K+IA A++FRLA  KMLRSL EFR+ G+KTNIPFL NVL++E+FL+G VDT FIDEHP+LF    ++ RAQKLL+Y+G  MVNGP T+LAT L PS I P +P+ P  +  P GWR+IL++ GP  FA+A+R HP  LI DTT RDAHQSLLATRVRT+D+  I+P++A   P LFSLENWGGATFDVSMRFL ECPWERL+ LR L+PNIPFQMLLRGANAVGY NYPDNIVYKFC++AV++G+DIFRVFD LNYLPN+I+GMDAV  AGGV+E S CYSGD+++PT  KYNL YY+ L D+LVK G HILGIKDMAG+LKPN+ R+LI  +R +YP++PIHLH+HDTAGAGVA +LAAAESGVDIVD A+DSMSG+TSQPSMGAVVACLQ+T +DTGL+ + I  YSSYWEQ R LY PFECTTTMRSGNADVY NQIPGGQYTNLQFQS+SLGL DQFE VK+KY+ AN LLGD+IKVTPSSKIVGDLAQFMVQN + A+ ++++A+ELS P SVIEFF G +G PYGGFPE LR+K+++  K  T R G  ++ FDF+    +L + F  DFD+ D++S ALYP VF EF+ FR+ +GPV +L TR+F VGP+IAEE  VDLE GK LHIKTLA+ D+  +G R VFFE+NGQLRS+ I DKEA+K+I   PKA K V+GSVGSPMPGE++ + VKEGD V+KGQ L  +SAMKMEMS+ +P+ G +K VH++  MK+ G+DL+ +IE
Sbjct:   37 QKTTGKQIKKLMVANRGEIAIRIFRACTEMNIRTVAIYSEQDKMQMHRQKADESYLIGKSLPPVAAYLNIPEIIQLALKHDVEAIHPGYGFLSERSEFAQACADAGIIFIGPSAKVVKRMGDKVEARQAAINANVSVVPGSPGPITSSEEAMEFCKQYGLPVILKAAYGGGGRGMRVVRKLEDLKQNFEMASSEALAAFGNGAMFIEKFIERPRHIEVQILGDKYGKVVHLYERDCSVQRRHQKLVEIAPAPNLDPTIRNALLNDAVRLASSVGYENAGTVEFLYDQTSGRYYFIEVNARLQVEHTVTEEITGVDLVRSQIRIAEGRSLDDLNLTQDKIESHGYAIQCRITTEDPAKQFQPDSGRIEVFQSGEGMGIRLDSASAFAGAIISPYYDSLLVKIIARASDFRLASKKMLRSLAEFRIHGIKTNIPFLMNVLKHEQFLSGVVDTNFIDEHPDLFNLPPAKQRAQKLLRYIGNTMVNGPSTLLATKLPPSDIEPTVPQVPYVNHIPRGWRNILLELGPVEFAKAIRAHPRLLITDTTMRDAHQSLLATRVRTFDLLRIAPYLAYQMPQLFSLENWGGATFDVSMRFLHECPWERLQQLRALVPNIPFQMLLRGANAVGYKNYPDNIVYKFCEVAVKNGLDIFRVFDSLNYLPNLIMGMDAVGTAGGVIEGSICYSGDLSNPTLDKYNLNYYMDLTDELVKAGTHILGIKDMAGLLKPNSIRMLISAIRDRYPNMPIHLHTHDTAGAGVACLLAAAESGVDIVDVAVDSMSGMTSQPSMGAVVACLQHTDIDTGLSSKDISVYSSYWEQTRSLYAPFECTTTMRSGNADVYENQIPGGQYTNLQFQSYSLGLGDQFENVKRKYSEANQLLGDIIKVTPSSKIVGDLAQFMVQNNLTAQQVLDRAEELSFPTSVIEFFSGAIGIPYGGFPEPLRTKIMRGQKIQTERAGTRMEPFDFDKLAEQLKEKFKRDFDEHDLLSAALYPKVFDEFEEFRKIYGPVDRLPTRMFFVGPKIAEEFPVDLETGKMLHIKTLAVGDLTKTGERAVFFEMNGQLRSILIRDKEATKSISFHPKALKGVKGSVGSPMPGELVTINVKEGDIVEKGQKLATLSAMKMEMSITAPIPGCIKKVHISSGMKVSGDDLLFDIE 1187          
BLAST of Pyruvate carboxylase vs. TrEMBL
Match: A0A3Q0KND4 (Pyruvate carboxylase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1677.53 bits (4343), Expect = 0.000e+0
Identity = 810/1158 (69.95%), Postives = 970/1158 (83.77%), Query Frame = 3
Query:  120 KSDQILTQ----KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K+D   TQ    +KI+K++VANRGEIAIR+FRAC EM IR+VAIYSEQD MQMHR KADESYLIGK L PVAAYLNI EII+++  HDV+AIHPGYGFLSERS+FA AC +AGI FIGPPA+VV++MGDKVEARQAA++ANV+VVPGSPGPI + EEAMEF K+YGLP+ILKAAYGGGGRGMRVV++LE + +NF  A SEALAAFGNG MFIEKFIERPRHIEVQILGDK+GN VHL+ERDCSVQRRHQK+VEIAPAP+L  +IR  +LSDAV+LA  V YENAGTVEFLYDQ T ++YFIEVNARLQVEHTVTE++TGVDLVRSQI +AEG+SL +L L+Q++I   G+AIQCRITTEDPA+ FQPDSGR+EVF+SGEGMGIR+DSASAFAGAIISPYYDSLL+K+IA A++FRLA  KMLRSL EFR+ GVKTNIPFL NV+++E+FL+G VDT FIDEHP+LF    ++ RAQKLL+Y+G +M+NGP T+LAT L PS I PK+P     +  P GWR++L++ GP  F++A+R HP  LI DTT RDAHQSLLATRVRT+D+  I P++A   P LFS+ENWGGATFDVSMRFL ECPWERLE LR +IPNIPFQMLLRGANAVGY NYPDNI+YKFC++AV++G+DIFR+FD LNYLPN+I+GMDAV  AGGVVE S CYSGD+ +P   KYNL YY+ L D LVK G HILGIKDMAG+LKPNAARIL+  +R +YPDIPIHLH+HDTAGAGVA +LAAAESGVDIVD A+DSMSGLTSQPSMGA+VACL++T  DTGL+ E + +YS+YWEQ R LY PFECTTTMRSGNADVY NQIPGGQYTNLQFQS+SLGL DQFE VK+KY  AN LLGD+IKVTPSSKIVGDLAQFMVQN + A+ ++++A+ELS P SVIEFF G +G PYGGFPE LR+K+++  K  T R G  ++ FDF+    +L + F  DFD++D++S ALYP VF EF+ FR+ +GPV +L TR+F VGP+IAEE  VDLE GK LHIKTLA+ ++  +G REVFFE+NGQLRS+ I DKEA+K+I   PKA K V+GS+GSPMPGE++ + VKEGD V+KGQ L  +SAMKMEMS+ SP+ G VK +HV+  MK+ G+DL+ +IE
Sbjct:   30 KTDTGATQNTSGRKIKKLMVANRGEIAIRIFRACTEMNIRTVAIYSEQDKMQMHRQKADESYLIGKSLPPVAAYLNIPEIIQLALRHDVEAIHPGYGFLSERSEFAQACADAGIIFIGPPANVVKRMGDKVEARQAAINANVSVVPGSPGPITSSEEAMEFCKQYGLPVILKAAYGGGGRGMRVVRKLEDIKQNFELASSEALAAFGNGAMFIEKFIERPRHIEVQILGDKYGNVVHLYERDCSVQRRHQKLVEIAPAPSLDPTIRKSLLSDAVRLASSVDYENAGTVEFLYDQTTGRYYFIEVNARLQVEHTVTEEITGVDLVRSQIRLAEGRSLSDLNLSQDKIEPHGFAIQCRITTEDPAKQFQPDSGRIEVFQSGEGMGIRVDSASAFAGAIISPYYDSLLVKIIARASDFRLAAKKMLRSLAEFRIHGVKTNIPFLMNVIKHEQFLSGIVDTNFIDEHPDLFDLPPAKQRAQKLLRYIGNIMINGPSTMLATQLPPSDIEPKVPTISYANHIPRGWRNMLLEKGPVEFSKAIRSHPHLLITDTTMRDAHQSLLATRVRTFDLLRIGPYLAYQMPQLFSIENWGGATFDVSMRFLHECPWERLEQLRNIIPNIPFQMLLRGANAVGYKNYPDNIIYKFCEVAVKNGIDIFRIFDSLNYLPNLIMGMDAVGTAGGVVEGSICYSGDLANPKLDKYNLQYYMDLTDQLVKAGTHILGIKDMAGLLKPNAARILLSAIRDRYPDIPIHLHTHDTAGAGVACLLAAAESGVDIVDVAVDSMSGLTSQPSMGALVACLKHTDNDTGLSSEDVSTYSAYWEQTRSLYAPFECTTTMRSGNADVYENQIPGGQYTNLQFQSYSLGLGDQFENVKRKYTEANQLLGDIIKVTPSSKIVGDLAQFMVQNGLTAQQVLDRAEELSFPSSVIEFFSGEIGFPYGGFPEPLRTKIMRGQKAKTERVGSHMEPFDFDKLAKQLKEKFKRDFDERDLLSAALYPKVFNEFEEFRKIYGPVDRLPTRMFFVGPKIAEEFPVDLETGKMLHIKTLAVGELTKAGEREVFFEMNGQLRSILISDKEATKSISFHPKALKGVKGSIGSPMPGELVTINVKEGDVVEKGQKLATLSAMKMEMSITSPIAGCVKKIHVSSGMKVSGDDLLFDIE 1187          
BLAST of Pyruvate carboxylase vs. TrEMBL
Match: A0A094ZHZ7 (Pyruvate carboxylase OS=Schistosoma haematobium OX=6185 GN=MS3_02353 PE=4 SV=1)

HSP 1 Score: 1666.74 bits (4315), Expect = 0.000e+0
Identity = 805/1158 (69.52%), Postives = 968/1158 (83.59%), Query Frame = 3
Query:  120 KSDQILTQ----KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K+D   TQ    +KI+K++VANRGEIAIR+FRAC EM IR+VAIYSEQD MQMHR KADESYLIGK L PVAAYLNI EII+++  H+V+AIHPGYGFLSERS+FA AC +AGI FIGPPA VV++MGDKVEARQAA++ANV+VVPGSPGPI + EEAMEF K+YGLP+ILKAAYGGGGRGMRVV+ LE + +NF  A SEALAAFGNG MFIEKFIERPRHIEVQILGDK+GN VHL+ERDCSVQRRHQK+VEIAPAP+L  ++R  +L+DAV+LA  V YENAGTVEFLYDQ T  +YFIEVNARLQVEHTVTE++TGVDLVRSQI +AEG+SL +L L Q++I   G+AIQCRITTEDPA+ FQPDSGR+EVF+SGEGMGIR+DSASAFAGAIISPYYDSLL+K+IA A+NFRLA  KMLRSL EFR+ GVKTNIPFL NV+++E+FL+G VDT FIDEHP+LF    ++ RAQKLL+Y+G  MVNGP T+LAT L PS I PK+P+    +  P GWR+IL++ GP  F++A+R HP  LI DTT RDAHQSLLATRVRT+D+  I P++A   P LFS+ENWGGATFDVSMRFL ECPW RLE LR +IPNIPFQMLLRGANAVGY NYPDNI+YKFC++AV++G+DIFR+FD LNYLPN+++GMDAV  AGGVVE S CYSGD+++P   KYNL YY+ L D LVK G HILGIKDMAG+LKPNAARIL+  +R +YPDIPIHLH+HDTAGAGVA +LAAAESGVDIVD A+DSMSGLTSQPSMGA+VACL++T +DTGL+ E + +YS+YWEQ R LY PFECTTTMRSGNADVY NQIPGGQYTNLQFQS+SLGL DQFE VK+KY  AN LLGD+IKVTPSSKIVGDLAQFMVQN + A+ ++++A+ELS P SVIEFF G +G PYGGFPE LR+K+++  K  T R G  ++ FDF+    +L + F  DFD++D++S ALYP VF EF+ FR+ +GPV +L TR+F VGP+IAEE  VDLE GK LHIKTLA+ ++  +G REVFFE+NGQLRS+ I DKEA+K+I   PKA K V+GSVGSPMPGE++ + VK+GD V+KGQ L  +SAMKMEMS+ +P+ G +K ++V+  MK+ G+DL+++IE
Sbjct:   30 KTDTGATQNTSGRKIKKLMVANRGEIAIRIFRACTEMNIRTVAIYSEQDKMQMHRQKADESYLIGKSLPPVAAYLNIPEIIQLALRHNVEAIHPGYGFLSERSEFAQACTDAGIIFIGPPAKVVKRMGDKVEARQAAINANVSVVPGSPGPITSSEEAMEFCKQYGLPVILKAAYGGGGRGMRVVRRLEDIKQNFELASSEALAAFGNGAMFIEKFIERPRHIEVQILGDKYGNVVHLYERDCSVQRRHQKLVEIAPAPSLDPTVRKSLLNDAVRLASSVDYENAGTVEFLYDQTTGHYYFIEVNARLQVEHTVTEEITGVDLVRSQIRLAEGRSLSDLNLCQDKIEPHGFAIQCRITTEDPAKQFQPDSGRIEVFQSGEGMGIRVDSASAFAGAIISPYYDSLLVKIIARASNFRLAAKKMLRSLAEFRIHGVKTNIPFLMNVIKHEQFLSGIVDTNFIDEHPDLFDLPPAKQRAQKLLRYIGNTMVNGPSTLLATKLPPSDIEPKVPKISYANSIPRGWRNILLEKGPVEFSKAIRSHPHLLITDTTMRDAHQSLLATRVRTFDLLRIGPYLAYQMPQLFSIENWGGATFDVSMRFLHECPWGRLEQLRNVIPNIPFQMLLRGANAVGYKNYPDNIIYKFCEVAVKNGIDIFRIFDSLNYLPNLLMGMDAVGTAGGVVEGSICYSGDLSNPKLDKYNLKYYMDLTDQLVKAGTHILGIKDMAGLLKPNAARILLSAIRDRYPDIPIHLHTHDTAGAGVACLLAAAESGVDIVDVAVDSMSGLTSQPSMGALVACLKHTDIDTGLSSEDVSTYSAYWEQTRSLYAPFECTTTMRSGNADVYENQIPGGQYTNLQFQSYSLGLGDQFENVKRKYTEANQLLGDIIKVTPSSKIVGDLAQFMVQNGLSAQQVLDRAEELSFPSSVIEFFSGEIGFPYGGFPEPLRTKIMRGQKAKTERVGSHMEPFDFDKLAKQLKEKFKRDFDERDLLSAALYPKVFDEFEEFRKIYGPVDRLPTRMFFVGPKIAEEFPVDLETGKMLHIKTLAVGELTKAGEREVFFEMNGQLRSILISDKEATKSISFHPKALKGVKGSVGSPMPGELVTINVKDGDVVEKGQKLATLSAMKMEMSITAPISGCIKKIYVSSGMKVSGDDLLLDIE 1187          
BLAST of Pyruvate carboxylase vs. TrEMBL
Match: K1QHI5 (Pyruvate carboxylase, mitochondrial OS=Crassostrea gigas OX=29159 GN=CGI_10017251 PE=4 SV=1)

HSP 1 Score: 1655.57 bits (4286), Expect = 0.000e+0
Identity = 805/1200 (67.08%), Postives = 976/1200 (81.33%), Query Frame = 3
Query:   30 KMSAMFQAIKLKCKPNFHSKFLFHN----SGINYKSDQILTQ----KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIK--------DMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            ++S + Q+ +++  PN       H      G+   S Q  +Q    +KI+K++VANRGEIAIRVFRAC EM I++VAIYSEQD M MHR KADESYLIGKGL PVAAYLNI EII+++K + VDAIHPGYGFLSER DFA    +AGI+FIGP  +VVRKMGDKVEARQAA+ A V VVPGS GP+ + EEA  F ++YGLP+I KAAYGGGGRGMR+V+ +E + ENF RA SEA AAFGNG +F+EKFIERPRHIEVQILGD+ GN VHL+ERDCSVQRRHQK+VEIAPAP L + IRDKM +DAVKLA+FVGYENAGTVEFL D  + ++YFIEVNARLQVEHTVTE+VTG+DLV+SQI IAEGK LPE+GL+Q+EI   G AIQCR+TTEDPAR FQPD+GR+EVFRSGEGMGIRLDSA  FAGAIISPYYDSLL+KVIA A +   A AKMLR+L+EFR+RGVKTNIPFL NVL++++FL+G VDTYFIDE+P LF+F  +QNRAQKLL YL  +MVNGP T LATDL+PS + P +P+ P     PTGWRD+LVK GP+AFA+ VR+H G L+MDTTFRDAHQSLLATRVRTYD+  ISPFV Q F NL+SLENWGGATFDV+MRFL ECPWERLE +RKL+PN+PFQMLLRGANAVGYTNYPDN+VYKFCD+AV+SGMDIFR+FD LNYLPNI+VGMDAV KAGGV+EA+  Y+GD++DP+KTKYNL YY+ LA +LVK G HIL IK        DMAGVLKP AA +L+G LR K+PDIPIH+H+HDTA AGVA+MLAAA++G D+VD A+DSMSGLTSQPSMGAVVA L+ T LDTG++L  +  YS+YWEQ R LY PFEC  T++SGN+DVY NQIPGGQYTNLQFQ+FSLGLADQFEEVK+ YA AN LLGD+ KVTPSSK+VGD+AQFMVQNK+  + + ++A+ELS P SV+E+FQG++G P GG+PE LR+K++K  + +  RPG+ L   DF+  K +L +   HD  ++ ++S ALYP V  +F  F +++GPV  L T+IF VGP++A+E+ V +EKGKTL IKTLA  D+  +G REVFFELNGQLRSV+I D+EASK +   PKA K VRGSVG+PMPGEV++VKVKEGD V+KGQ + ++SAMKMEM V +P  G V+ + V  KMK+EG+DL+++IE
Sbjct:  175 RLSTLCQSARVQL-PNVARGHNHHGYKLPPGVACCSTQAKSQSKPEEKIKKLMVANRGEIAIRVFRACTEMNIQTVAIYSEQDMMHMHRQKADESYLIGKGLPPVAAYLNIPEIIQVAKENGVDAIHPGYGFLSERDDFAQQVLDAGIRFIGPSPEVVRKMGDKVEARQAAIAAGVQVVPGSDGPVASIEEARHFCEQYGLPVIFKAAYGGGGRGMRIVRSMEEVDENFRRATSEAEAAFGNGALFLEKFIERPRHIEVQILGDRGGNVVHLYERDCSVQRRHQKVVEIAPAPKLPLDIRDKMTADAVKLARFVGYENAGTVEFLLDP-SGQYYFIEVNARLQVEHTVTEEVTGIDLVQSQIQIAEGKLLPEMGLSQDEIELHGCAIQCRMTTEDPARGFQPDTGRIEVFRSGEGMGIRLDSALGFAGAIISPYYDSLLVKVIAKARDHPAAAAKMLRTLKEFRIRGVKTNIPFLLNVLQHDQFLSGVVDTYFIDENPQLFKFYPTQNRAQKLLYYLAQVMVNGPQTPLATDLQPSDVVPSVPQLPFAPTPPTGWRDVLVKEGPEAFAKKVREHKGLLLMDTTFRDAHQSLLATRVRTYDLKRISPFVTQRFNNLYSLENWGGATFDVAMRFLHECPWERLEEMRKLVPNVPFQMLLRGANAVGYTNYPDNVVYKFCDMAVKSGMDIFRIFDSLNYLPNIVVGMDAVGKAGGVIEAAISYTGDVSDPSKTKYNLEYYVNLATELVKAGTHILSIKVSSYMNAQDMAGVLKPRAATMLVGALREKFPDIPIHVHTHDTACAGVASMLAAAQAGADVVDVAVDSMSGLTSQPSMGAVVAALEGTDLDTGISLSDVTDYSAYWEQTRNLYAPFECCKTLKSGNSDVYINQIPGGQYTNLQFQAFSLGLADQFEEVKKMYAEANQLLGDIPKVTPSSKVVGDMAQFMVQNKLTKEMVEDRAEELSFPVSVMEYFQGYLGVPPGGYPEPLRTKILKGQQGLDSRPGESLPPVDFDKLKADLVEKHGHDVKEQHVISAALYPKVTDDFLEFHDKYGPVDALDTKIFFVGPKVAQEMEVKIEKGKTLSIKTLACGDLNKNGEREVFFELNGQLRSVKIKDEEASKELHFHPKALKGVRGSVGAPMPGEVIDVKVKEGDKVEKGQPVLVLSAMKMEMVVTAPASGTVRSIAVEKKMKLEGDDLLMDIE 1372          
BLAST of Pyruvate carboxylase vs. TrEMBL
Match: A0A0P5LPJ2 (Pyruvate carboxylase, mitochondrial OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 1635.54 bits (4234), Expect = 0.000e+0
Identity = 795/1162 (68.42%), Postives = 969/1162 (83.39%), Query Frame = 3
Query:  105 SGINYKSDQI--LTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALS-DIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            S  NY  ++   +  K IR VLVANRGEIAIRVFRAC+E+GIRSVAIYSEQD MQ+HR KADESYL+GKGL PVAAYL+I EII+++K + VDAIHPGYGFLSER+DFA AC ++GI+FIGP   VV +MGDKV ARQAA++ANV +VPG+PGP+ T EEA+ F ++YGLP+I KAAYGGGGRGMRVV+++E + E F RA SEALAAFGNG MFIEKF+ERPRHIEVQILGD+ GN VHL+ERDCSVQRRHQK+VEIAPAPNL   +RD+M +DAV+L   VGYENAGTVEFL D+   +HYFIEVNARLQVEHTVTE+VTG+DLV+ Q+ IAEG +LPELGL Q +I+  G AIQCR+TTEDPA++FQPD+GR+EVFRSGEGMGIRLDSASAFAGAIISPYYDSLL+KVIAHA N   + AKM+R+LREFRVRGVKTNIPFL NVLEN++FL G++DTYFIDEHP LFQF  SQNRAQKLL Y+G ++VNGP+T L TDLKP+ + P +P+   +    TG+RDIL + GP+AFA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +ISPFVAQNF +L+SLENWGGATFDV+MRFL ECPWERLE +R+++PNIPFQMLLRGANAVGYT+YPDN+VYKFC+LAVQ+GMDIFRVFD LNYLPN+I+G+DAV KAGGVVEA+  YSGD++DP++TKY LPYYL LAD+LVK G H+L IKDMAG+LKP AA +LI  +R ++PDIPIH+H+HDT+GAGVA+MLAAA +G D+VD A+DSMSG+TSQPSMGAVVA LQ + LDTGL+LE +  YS+YWEQ R LY PFEC  TM+SGNADVY N+IPGGQYTNLQFQ++SLGL +QFE++K+ Y  AN LLGD+IKVTPSSK VGDLAQFMVQNK+  + ++++A+ELS PKSV+EF QG++G PYGGFPE LR++V+K  K + GRPG  +   D +  K +L +   +   D D+MS A+YP+V KE+  FR ++GPV K  TRIFL GP++ EE  V +EKGKTLHIKTLA++ D+  +G REVFFELNGQLRSV I DK A+K + + PKA+K V+GSVG+PMPG V++++VK GD V+KGQ L ++SAMKMEM V SP  G VK V +   MK+EG+DL++ IE
Sbjct:   81 SQANYSPNKCKDVEYKPIRSVLVANRGEIAIRVFRACSELGIRSVAIYSEQDKMQVHRQKADESYLVGKGLPPVAAYLSIPEIIRVAKENRVDAIHPGYGFLSERADFAQACVDSGIRFIGPSPRVVHQMGDKVAARQAAIEANVPIVPGTPGPVTTTEEAVNFCREYGLPVIFKAAYGGGGRGMRVVRKMEEVEELFRRATSEALAAFGNGAMFIEKFVERPRHIEVQILGDRAGNVVHLYERDCSVQRRHQKVVEIAPAPNLNQEVRDRMTTDAVRLCNHVGYENAGTVEFLVDE-AGRHYFIEVNARLQVEHTVTEEVTGIDLVQHQVKIAEGLTLPELGLDQSQIKIQGSAIQCRMTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLVKVIAHAGNLPASAAKMVRALREFRVRGVKTNIPFLLNVLENQKFLTGTLDTYFIDEHPELFQFVPSQNRAQKLLNYVGDVLVNGPLTPLGTDLKPADVVPLVPQVDSSQRL-TGFRDILTEQGPEAFAKAVRNHKGLLLMDTTFRDAHQSLLATRVRTHDLLKISPFVAQNFSSLYSLENWGGATFDVAMRFLHECPWERLEEMRRIMPNIPFQMLLRGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNMILGIDAVGKAGGVVEAAISYSGDVSDPSRTKYTLPYYLDLADELVKAGTHVLCIKDMAGLLKPRAATMLIDGIRQRHPDIPIHVHTHDTSGAGVASMLAAAHAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSELDTGLSLESVSDYSAYWEQTRTLYAPFECCVTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGNQFEDIKKAYREANLLLGDIIKVTPSSKTVGDLAQFMVQNKLSGQDVLDRAEELSFPKSVVEFMQGYLGIPYGGFPEPLRTRVLKGMKKVEGRPGATMAPLDLDKLKSDLIEAHGNQIRDVDVMSAAMYPSVCKEYLEFRSKYGPVDKFATRIFLTGPKVGEEFEVTIEKGKTLHIKTLAMAEDLTRTGDREVFFELNGQLRSVFIRDKTAAKELHIHPKAEKGVKGSVGAPMPGTVIDLRVKAGDKVEKGQPLVVLSAMKMEMVVQSPCTGTVKSVAITKDMKLEGDDLLLNIE 1240          
BLAST of Pyruvate carboxylase vs. Ensembl Cavefish
Match: pcxb (pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-000831-1])

HSP 1 Score: 1508.43 bits (3904), Expect = 0.000e+0
Identity = 735/1105 (66.52%), Postives = 897/1105 (81.18%), Query Frame = 3
Query:  264 MHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEI 3578
            MHR KADE+YLIGKGL PVAAYL+I +IIK++K ++VDAIHPGYGFLSERSDFA AC +AG++F+GP  DVVRKMGDKVEAR  A+ A V VVPG+  PI + +EA EF K YG PII KAAYGGGGRGMRVV+E E L EN+ RA SEALAAFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++ SD+V LAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +Q+ + EG+SLPELGL Q++IR  G AIQCR+TTEDPAR FQPD+GRLEVFRS EGMGIRLDSASAF GA+ISP+YDSLL+KVI+   +   A +KMLR+L EFR+RGVKTNIPFL NVL N +FL+ +VDT FIDE+ +LF  K++QNRAQKLL YLG +MVNGP T +    KPS  +P IP  P+  E P G+R++L++ GP+ FA+AVR+H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+V+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR L+PN+PFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD++DP + KY+L YY++LAD+LVK G HIL IKDMAG+LKP ++RILI  LR ++PD+PIH+H+HDTAGAGVA MLA AE+G DIVD A+DSM+G+TSQPSMGA+VAC + T LDTG++LEK++ YS YWE AR LY PF+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN LLGD+IKVTPSSKIVGDLAQFMVQN +    + E+ADELS P SV+EF QGHVG P+GGFPE  RSKV+K+   + GRPG  L A DF+  + +L      +   +D+MS A+YP VFKEF+ FR  FGPV +L TR+FL GP IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D  A K +   PKA K VRG VG+PMPG+V+EVKVK+G  V+KGQ LC++SAMKME  VNSP+ G V  V+V     +EG+DL++EI
Sbjct:    1 MHRQKADEAYLIGKGLPPVAAYLHIPDIIKVAKENNVDAIHPGYGFLSERSDFAQACEDAGVRFVGPSPDVVRKMGDKVEARALAIQAGVPVVPGTDAPITSQQEAHEFAKTYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPHLRDRLTSDSVTLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGCAIQCRVTTEDPARGFQPDTGRLEVFRSAEGMGIRLDSASAFQGAVISPHYDSLLVKVISSGKDLPTAASKMLRALAEFRIRGVKTNIPFLQNVLSNNQFLHSTVDTQFIDENQDLFNLKRTQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSTDPVIPPVPLG-EPPAGFREVLLREGPEGFAKAVRQHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRALLPNVPFQMLLRGANAVGYTNYPDNSVFKFCEVAKENGMDIFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVSDPMRQKYSLDYYVQLADELVKAGTHILSIKDMAGLLKPESSRILITALRDRFPDMPIHVHTHDTAGAGVAAMLACAEAGADIVDVAVDSMAGMTSQPSMGAIVACTKGTKLDTGISLEKVFDYSEYWEVARGLYAPFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLSRAEVEERADELSFPLSVVEFLQGHVGIPHGGFPEPFRSKVLKSLPRVEGRPGATLPAIDFKKLEADLKAEHGSEITPEDVMSAAMYPKVFKEFKEFRRSFGPVDRLSTRLFLDGPNIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTVAMKEMHFHPKALKDVRGQVGAPMPGKVVEVKVKQGQKVEKGQPLCVLSAMKMETVVNSPLSGTVAKVYVKTDTSLEGDDLILEI 1103          
BLAST of Pyruvate carboxylase vs. Ensembl Cavefish
Match: pcxb (pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-000831-1])

HSP 1 Score: 1325.84 bits (3430), Expect = 0.000e+0
Identity = 645/944 (68.33%), Postives = 782/944 (82.84%), Query Frame = 3
Query:  117 YKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKV 2948
            + S Q L  + I+KV+VANR        RAC E+GIR+VA+YSEQDT QMHR KADE+YLIGKGL PVAAYL+I +IIK++K ++VDAIHPGYGFLSERSDFA AC +AG++F+GP  DVVRKMGDKVEAR  A+ A V VVPG+  PI + +EA EF K YG PII KAAYGGGGRGMRVV+E E L EN+ RA SEALAAFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAPA  L   +RD++ SD+V LAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T VDLV +Q+ + EG+SLPELGL Q++IR  G AIQCR+TTEDPAR FQPD+GRLEVFRS EGMGIRLDSASAF GA+ISP+YDSLL+KVI+   +   A +KMLR+L EFR+RGVKTNIPFL NVL N +FL+ +VDT FIDE+ +LF  K++QNRAQKLL YLG +MVNGP T +    KPS  +P IP  P+  E P G+R++L++ GP+ FA+AVR+H G L+MDTTFRDAHQSLLATRVRT+D+ +I+P+V+ NF NLFSLENWGGATFDV+MRFL ECPW RL+ LR L+PN+PFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD++DP + KY+L YY++LAD+LVK G HIL IKDMAG+LKP ++RILI  LR ++PD+PIH+H+HDTAGAGVA MLA AE+G DIVD A+DSM+G+TSQPSMGA+VAC + T LDTG++LEK++ YS YWE AR LY PF+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN LLGD+IKVTPSSKIVGDLAQFMVQN +    + E+ADELS P SV+EF QGHVG P+GGFPE  RSKV
Sbjct:   28 HTSPQTLEYRPIKKVMVANRD--CNPCVRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGKGLPPVAAYLHIPDIIKVAKENNVDAIHPGYGFLSERSDFAQACEDAGVRFVGPSPDVVRKMGDKVEARALAIQAGVPVVPGTDAPITSQQEAHEFAKTYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPHLRDRLTSDSVTLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGCAIQCRVTTEDPARGFQPDTGRLEVFRSAEGMGIRLDSASAFQGAVISPHYDSLLVKVISSGKDLPTAASKMLRALAEFRIRGVKTNIPFLQNVLSNNQFLHSTVDTQFIDENQDLFNLKRTQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSTDPVIPPVPLG-EPPAGFREVLLREGPEGFAKAVRQHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVSHNFNNLFSLENWGGATFDVAMRFLYECPWRRLQELRALLPNVPFQMLLRGANAVGYTNYPDNSVFKFCEVAKENGMDIFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVSDPMRQKYSLDYYVQLADELVKAGTHILSIKDMAGLLKPESSRILITALRDRFPDMPIHVHTHDTAGAGVAAMLACAEAGADIVDVAVDSMAGMTSQPSMGAIVACTKGTKLDTGISLEKVFDYSEYWEVARGLYAPFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLSRAEVEERADELSFPLSVVEFLQGHVGIPHGGFPEPFRSKV 967          

HSP 2 Score: 158.688 bits (400), Expect = 8.467e-39
Identity = 78/128 (60.94%), Postives = 97/128 (75.78%), Query Frame = 3
Query: 3195 VDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEI 3578
            V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D  A K +   PKA K VRG VG+PMPG+V+EVKVK+G  V+KGQ LC++SAMKME  VNSP+ G V  V+V     +EG+DL++EI
Sbjct:  967 VELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTVAMKEMHFHPKALKDVRGQVGAPMPGKVVEVKVKQGQKVEKGQPLCVLSAMKMETVVNSPLSGTVAKVYVKTDTSLEGDDLILEI 1094          
BLAST of Pyruvate carboxylase vs. Ensembl Cavefish
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:103043051])

HSP 1 Score: 370.163 bits (949), Expect = 6.683e-113
Identity = 190/450 (42.22%), Postives = 273/450 (60.67%), Query Frame = 3
Query:  147 KIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH 1496
            +I KVL+ANRGEIA RV R   +MG+RSVA+YS+ D   MH   ADE+Y IG   Q   +YL + ++++++K     A+HPGYGFLSE ++FA  C + GI FIGPP+  +R MG K  ++     A V ++ G  G  Q+ ++      + G P+++KA  GGGG+GMR+        E    A+ EA  +F +  M +EKF+E PRH+EVQ+ GD+ GNAV+LFERDCSVQRRHQKI+E AP P ++  +R K+   AV+ AK V Y  AGTVEF+ D      YF+E+N RLQVEH V+E +TG DLV  Q+ +A G+ +P   L+QE+I   G++ + RI  EDP  DF P +G L+   + +             G  +S +YD ++ K++    +   A  K+   LR++ + G+ TNI FL N+  +  F  G+V T FI +H
Sbjct:   34 RIEKVLIANRGEIACRVMRTAKKMGVRSVAVYSDADRHSMHVAMADEAYHIGAA-QSQQSYLCMEKVLEVAKKSSAQAVHPGYGFLSENTEFAELCKQEGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIEGYHGEDQSDKKLQAEAARIGYPVMIKAVRGGGGKGMRIAHSEAEFHEQLESARREARKSFNDDVMLVEKFVENPRHVEVQVFGDQHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRRKLGEAAVRAAKAVNYVGAGTVEFIMDS-QHNFYFMEMNTRLQVEHPVSEMITGTDLVEWQLRVAAGEKIP---LSQEDIVLRGHSFEARIYAEDPNNDFMPGAGHLQHLSNPQADEHTRIETGVRDGDEVSAHYDPMIAKLVVWGEDRPAALKKLRYCLRQYNIVGLNTNIDFLLNLSGHPEFEAGNVHTSFIPQH 478          
BLAST of Pyruvate carboxylase vs. Ensembl Cavefish
Match: ENSAMXT00000052136.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:18923125:18932967:-1 gene:ENSAMXG00000038620.1 transcript:ENSAMXT00000052136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 351.673 bits (901), Expect = 1.620e-111
Identity = 177/297 (59.60%), Postives = 218/297 (73.40%), Query Frame = 3
Query: 2688 LGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEI 3578
            +GL ++F+EVK+ Y  AN LLGD+IKVTPSSKIVGDLAQFMVQN +    + E+ADELS P SV+EF QGHVG P+GGFPE  RSKV+K+   I GRPG  L   DF+A + +L D    D   +D+MS A+YP VF+EF+ F   FGPV  L TR+FL GP+IAEE  V+LE+GKTLHIK LAL D+  +G REVFFELNGQLRSV + D  A K +   PKA K VRG VG+PMPG+V+EVKVKEG  V+KGQ LC++SAMKME  VNSP+ G V  V+V     +EG+DL++EI
Sbjct:    1 MGLGNKFKEVKKAYVEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLTRAEVEERADELSFPLSVVEFLQGHVGIPHGGFPEPFRSKVLKSLPRIEGRPGASLPPMDFQALEKQLRDTHGDDITPEDVMSAAMYPKVFQEFKEFTTAFGPVDCLNTRLFLDGPKIAEEFEVELERGKTLHIKALALGDLNKAGQREVFFELNGQLRSVLVKDTVAMKEMHFHPKALKDVRGQVGAPMPGKVVEVKVKEGQKVEKGQPLCVLSAMKMETVVNSPLSGTVAKVYVNADSSLEGDDLILEI 297          
BLAST of Pyruvate carboxylase vs. Ensembl Cavefish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 343.584 bits (880), Expect = 2.670e-103
Identity = 193/461 (41.87%), Postives = 286/461 (62.04%), Query Frame = 3
Query:  141 QKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVA-AYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQ-PDSGRLEVFRSGEGM-GIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDE-HPNLFQ 1511
            +K   K+L+ANRGEIA RV + C +MGI++VA++S+ D+  +H   ADE++ +G    P + +YLN+  I++  +     A+HPGYGFLSE  +FA      G+ FIGP    ++ MGDK+E++  A  A V  +PG  G ++  EEA++   + G P+++KA+ GGGG+GMR+    E   E F  +  EA ++FG+  + IEK+I+ PRHIE+Q+L DK GNA+ L ER+CS+QRR+QK+VE AP+  L    R  M   AV LAK V Y +AGTVEFL D      YF+E+N RLQVEH +TE +TG+DLV+  I +A+G  L      QE+I   G+AI+ R+  EDP + F  P  GRL  +     + G+R+DS     G+ IS YYD ++ K++ + +    A  KM  +L  + +RGV  NIP L  ++ + RF++G + T F+ E +P  F+
Sbjct:   43 EKTFDKILIANRGEIACRVIKTCKKMGIKTVAVHSDVDSSAVHVKMADEAFCVGPA--PTSKSYLNMDAIMEAIRQTGAQAVHPGYGFLSENKEFARRLAADGVSFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPGFDGVVKNAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPVTRRAMGEQAVSLAKAVKYSSAGTVEFLVDS-KKNFYFLEMNTRLQVEHPITECITGLDLVQQMIRVAKGYKLQH---KQEDIPINGWAIESRVYAEDPYKSFGLPSIGRLSQYEEPLNLPGVRVDSGIQ-EGSDISIYYDPMISKLVTYGSTRAEALKKMEDALDNYVIRGVTHNIPLLREIIVHPRFISGDISTNFLPEVYPEGFK 496          

HSP 2 Score: 68.9366 bits (167), Expect = 2.602e-11
Identity = 47/158 (29.75%), Postives = 80/158 (50.63%), Query Frame = 3
Query: 3117 REEFGPVSKLGTRIFLVG-PRIAEEISVDLEKGKTLHIKTLAL-SDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRP-KAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            R  +    +L  R+ ++G  R     +V+++  K +      L S + P  + E+  +  G    V ++ K A+   ++ P K  +     + SPMPG V+ V VK GD+V +GQ +C+I AMKM+ S+ +    KVK VH      +   DL++E+E
Sbjct:  539 RRNWELCVELDKRVHMLGVSRSGNSYTVEIDGEKVVVSGEWNLASALLPLTINEITLQYLGTSFKVRVLSKLAASLNKLMPEKIPEDTSSILRSPMPGTVVAVSVKPGDTVAEGQEICVIEAMKMQNSMTAAKTAKVKSVHCTAGETVGEGDLLVELE 696          
BLAST of Pyruvate carboxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006397.1 (pep scaffold:Pmarinus_7.0:GL476470:932002:942971:-1 gene:ENSPMAG00000005777.1 transcript:ENSPMAT00000006397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 330/584 (56.51%), Postives = 424/584 (72.60%), Query Frame = 3
Query: 1872 GATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKF-CDLAVQSGMDIFRV-FDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKAD------------ELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            GATFDV+MRFL ECPW+RL+ +RKLIPN+PFQMLLRGANAVGYTNYPDN V+     + + S  +I  V    L Y    I+ +        V + +  +SG ++ P +     P  L+L      G AH+   KDMAG+LKP AAR+L+G LR +YPD+PIH+H+HDTAGAGVA+MLAAAE+G D+VD A+DSMSG+TSQPSMGA+VA LQ T LDTG++L+K++ YS YWE AR+LY PF+CT TM+SGN+DVY N+IPGGQYTNL FQ+ S+GL  +F+EVK+ YA AN LLGD+IKVTPSSKIVGDLAQFMVQN++  + + E+A+            ELSLPKSV+EF QG +G P GG+PE LRSK++K+ +   GRPG  L   DF   + +L      D   +D++S ++YP VF E++ F  +FGPV  L TR+FL GP+IAEE  V+LE+GKTL IK LAL D+   G REVFFELNGQLRSV + D +A K + V PKA KSV+G VG+PMPG V+E+KVKEG  V+KGQ LC++SAMKME  VN+P+ GK+  +HV P M +EG+DL++EIE
Sbjct:    1 GATFDVAMRFLYECPWKRLQKMRKLIPNVPFQMLLRGANAVGYTNYPDNSVFNPPSPVRINSNENIRTVRVHYLYYTAQHILYIKEHGNFTYVYDLAQRFSGALSPPARR----PCLLRLNG----GNAHLCNSKDMAGLLKPKAARMLVGALRERYPDMPIHVHTHDTAGAGVASMLAAAEAGADVVDVAVDSMSGMTSQPSMGALVASLQGTELDTGIDLQKVFDYSEYWEVARQLYAPFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGHKFKEVKKAYAEANKLLGDLIKVTPSSKIVGDLAQFMVQNRLTRQEVEERAEQTDPPEVRRGVHELSLPKSVVEFMQGAIGVPPGGYPEPLRSKILKDMERTEGRPGASLPPLDFVQLEKDLKGRHGRDITPEDVVSASMYPQVFDEYKEFTAQFGPVECLNTRLFLEGPQIAEEFQVELERGKTLIIKALALGDLN-KGHREVFFELNGQLRSVLVKDTKAMKNMHVHPKALKSVKGQVGAPMPGSVIEIKVKEGQQVEKGQPLCVLSAMKMETVVNAPMTGKIIKLHVQPSMHLEGDDLILEIE 575          
BLAST of Pyruvate carboxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006339.1 (pep scaffold:Pmarinus_7.0:GL476470:734267:771330:-1 gene:ENSPMAG00000005705.1 transcript:ENSPMAT00000006339.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 349/727 (48.01%), Postives = 460/727 (63.27%), Query Frame = 3
Query: 1410 KTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQK--LLKYLGTLMVNGPVTVLATDLKPSL--------------INPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXES---GVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHV 3533
            +TNIPFL NVL N +F+ G+VDT FIDE+P LF  K  QNRAQK  LL   G +MVNG +T L    K +               I+        T   P+G+RD+LV  GP+AF  AV KH G L+ DT FRD HQSLLATRVRT+    ISPFVA +F NL+S+ENWGGA FDV+MRFL E PW+RL  +RKLIPN+PFQMLLRG N+ G  NYPD +  +  + A+   + +  V  C+ Y         ++ K   +V  S  Y G + +   ++      +     +++  A  +   D      P         LR  YPD+PIH+ + DTAGAGVA +LAAA +      +VD A+DSMSG+ S+P MG +VA LQ T LDTG++L+K++ YS YWE AR+LY PF+CT TM  GN+DVY N+IPGGQYTNL FQ  S+GL  +F+EVK+ YA  N LLGD+IKVTPSS IVGDLA  M+Q+ +  +       E+SLP+SV+EF QG   + +   P   +++++K+ +   GRPG  L   DF   + E +    H  D   ++S ++ P VF E++ F+ +F PV  L TR+FL GP+IAEE  V+L+ GKTL IK LAL D+   G REVFFELNGQLRSV + D +A K + V PKA KSV+G VG+PMPG V+E+KVKEG  V+KGQ LC++SAMKME  VN+P+ GK+  +HV
Sbjct:    1 QTNIPFLQNVLNNSQFVYGTVDTQFIDENPELFNLKPGQNRAQKAALLPGPGHVMVNGAMTPLPVKAKVTDVDPVVPDVPLVLDLIHSSSESMARTALLPSGFRDVLVTQGPEAFTMAVWKHRGLLLTDTPFRDVHQSLLATRVRTHARTAISPFVAHSFGNLYSIENWGGAKFDVAMRFLYERPWKRLLKMRKLIPNVPFQMLLRGTNSAGCANYPDPLRLRLGEGALTGEVPLACV--CVRYEDG------SLSKTSPIVVVS--YRGIVVNERVSENRTECQVSFVGRMLRWDAWTICFGDCMFTTTP--------RLRGHYPDMPIHVRTRDTAGAGVAPVLAAASARPPRQHVVDVAVDSMSGMNSRPGMG-LVASLQGTELDTGIDLQKVFDYSEYWEVARQLYAPFDCTATMTPGNSDVYENEIPGGQYTNLHFQVHSMGLGHKFKEVKKAYAEVNKLLGDLIKVTPSSMIVGDLALCMLQDGLTRQ-------EVSLPESVVEFMQGPTAQ-HXSPPTPHKARILKDMERTEGRPGASLPPPDF--VQLEKDPKGRHGRDTARVVSASVRPQVFDEYKEFKAQFWPVECLNTRLFL-GPQIAEEFQVELQWGKTLIIKALALGDLN-KGHREVFFELNGQLRSVLVKDTKAMKNMHVHPKALKSVKGQVGAPMPGSVIEIKVKEGQQVEKGQPLCVLSAMKMETMVNAPMTGKITKLHV 696          
BLAST of Pyruvate carboxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006346.1 (pep scaffold:Pmarinus_7.0:GL476470:805110:813016:1 gene:ENSPMAG00000005733.1 transcript:ENSPMAT00000006346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 488.034 bits (1255), Expect = 1.715e-162
Identity = 250/358 (69.83%), Postives = 296/358 (82.68%), Query Frame = 3
Query:  159 VLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEV 1232
            V +   GEIA RVFRAC E+GIR+VA+YSEQD  Q+HR KADE+YLIGKGL PVAAYL+I +II++++ + VDAIHPGYGFLSERSDFA AC +A I+FIGP  +VVR+MGDKVEAR  A+ A V VVPG+  P+ +  EA  F + YG PII KAA+GGGGRGMRVV+  E L E+F RA SEALAAFGNG +FIEK+IE+PRHIEVQILGDK+GN VHL+ERDCS+QRRHQK+VEIAP  NL  S+R+ + +DAVKLAK VGYENAGTVEFL D+ + +HYFIEVN+RLQVEHTVTE +TGVDLV SQI IAEG+SLP LGL Q+ IR  G AIQCR+TTEDPAR FQPD+GR+EV
Sbjct:   40 VCIVALGEIATRVFRACTELGIRTVAVYSEQDNGQVHRQKADEAYLIGKGLAPVAAYLHIPDIIRVAQENAVDAIHPGYGFLSERSDFAQACLDADIRFIGPSPEVVRQMGDKVEARAIAISAGVPVVPGTEEPVVSLVEARHFCETYGFPIIFKAAFGGGGRGMRVVRSYEELEESFQRAYSEALAAFGNGSLFIEKYIEKPRHIEVQILGDKYGNVVHLYERDCSIQRRHQKVVEIAPGANLDPSMREHLTNDAVKLAKQVGYENAGTVEFLLDK-SGRHYFIEVNSRLQVEHTVTEQITGVDLVHSQIHIAEGRSLPSLGLHQDTIRINGCAIQCRVTTEDPARGFQPDTGRIEV 396          
BLAST of Pyruvate carboxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006351.1 (pep scaffold:Pmarinus_7.0:GL476470:805693:813506:1 gene:ENSPMAG00000005733.1 transcript:ENSPMAT00000006351.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 484.952 bits (1247), Expect = 6.386e-162
Identity = 249/357 (69.75%), Postives = 295/357 (82.63%), Query Frame = 3
Query:  159 VLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLE 1229
            V +   GEIA RVFRAC E+GIR+VA+YSEQD  Q+HR KADE+YLIGKGL PVAAYL+I +II++++ + VDAIHPGYGFLSERSDFA AC +A I+FIGP  +VVR+MGDKVEAR  A+ A V VVPG+  P+ +  EA  F + YG PII KAA+GGGGRGMRVV+  E L E+F RA SEALAAFGNG +FIEK+IE+PRHIEVQILGDK+GN VHL+ERDCS+QRRHQK+VEIAP  NL  S+R+ + +DAVKLAK VGYENAGTVEFL D+ + +HYFIEVN+RLQVEHTVTE +TGVDLV SQI IAEG+SLP LGL Q+ IR  G AIQCR+TTEDPAR FQPD+GR+E
Sbjct:    1 VCIVALGEIATRVFRACTELGIRTVAVYSEQDNGQVHRQKADEAYLIGKGLAPVAAYLHIPDIIRVAQENAVDAIHPGYGFLSERSDFAQACLDADIRFIGPSPEVVRQMGDKVEARAIAISAGVPVVPGTEEPVVSLVEARHFCETYGFPIIFKAAFGGGGRGMRVVRSYEELEESFQRAYSEALAAFGNGSLFIEKYIEKPRHIEVQILGDKYGNVVHLYERDCSIQRRHQKVVEIAPGANLDPSMREHLTNDAVKLAKQVGYENAGTVEFLLDK-SGRHYFIEVNSRLQVEHTVTEQITGVDLVHSQIHIAEGRSLPSLGLHQDTIRINGCAIQCRVTTEDPARGFQPDTGRIE 356          
BLAST of Pyruvate carboxylase vs. Ensembl Sea Lamprey
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 289.656 bits (740), Expect = 1.346e-88
Identity = 158/361 (43.77%), Postives = 230/361 (63.71%), Query Frame = 3
Query:  117 YKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVA-AYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVV---KELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTE 1187
            Y +    ++K   K+L+ANRGEIA RV + C +MGI +VA++S+ D   +H   ADE++ +G    P A +YLN++ I+   K     A+HPGYGFLSE  +FA      G++FIGP    ++ MGDK+E++  A  A V  +PG  G ++  ++A++  ++ G P+++KA+ GGGG+GMR+    +E     E F  +  EA ++FG+  + IEKFI+ PRHIE+Q+L D+ GNA+ L ER+CSVQRR+QK+VE AP+  L    R  M   AV LA+ V Y +AGTVEFL D   +  YF+E+N RLQVEH +TE +TG+DLV   I +A G     L L+Q E+   G+AI+CR+  E
Sbjct:    3 YTATHDPSEKTFDKILIANRGEIACRVIKTCKKMGITTVAVHSDVDANAVHVKMADEAFCVGPA--PTAQSYLNMAAILDAVKTSGAQAVHPGYGFLSENKEFAKQLAAEGVKFIGPDTHALQAMGDKIESKLIAKTAGVNTIPGFDGVVKNTKDAVKIAREIGYPVMIKASAGGGGKGMRIAWNDEETNVRREGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLADEHGNALWLNERECSVQRRNQKVVEEAPSMFLDTQTRRAMGEQAVALARAVRYSSAGTVEFLVDSQRN-FYFLEMNTRLQVEHPITECITGLDLVMEMIRVAAGH---RLRLSQSEVPIRGWAIECRVYAE 357          
BLAST of Pyruvate carboxylase vs. Ensembl Yeast
Match: PYC2 (Pyruvate carboxylase isoform; cytoplasmic enzyme that converts pyruvate to oxaloacetate; differentially regulated than isoform Pyc1p; mutations in the human homolog are associated with lactic acidosis; PYC2 has a paralog, PYC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000422])

HSP 1 Score: 1241.48 bits (3211), Expect = 0.000e+0
Identity = 627/1161 (54.01%), Postives = 840/1161 (72.35%), Query Frame = 3
Query:  156 KVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQ--PVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKI---PETPITHEY------------PTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKN-HKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDI-RPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K+LVANRGEI IR+FR+ +E+ +R++AIYS +D + MHRLKADE+Y+IG+  Q  PV AYL + EII+I+K H VD IHPGYGFLSE S+FA    +AGI +IGPPA+V+  +GDKV AR  A  ANV  VPG+PGPI+T +EA++F  +YG P+I+KAA+GGGGRGMRVV+E + +++ F RA SEA  AFGNG  F+E+F+++P+HIEVQ+L D  GN VHLFERDCSVQRRHQK+VE+APA  L   +RD +L+DAVKLAK  GY NAGT EFL D   ++HYFIE+N R+QVEHT+TE++TG+D+V +QI IA G +L +LGL Q++I + G++IQCRITTEDP+++FQPD+GRLEV+RS  G G+RLD  +A+AGA ISP+YDS+L+K     + + +   KM+R+L EFR+RGVKTNIPFL  +L N  F+ G+  T FID+ P LFQ   SQNRAQKLL YL  L VNG      + +K  +  PK+   P  P  H+             P+GWR +L++ GP  FA+ VR+  G L+MDTT+RDAHQSLLATRVRT+D+A I+P  A      F+LE WGGATFDV+MRFL E PWERL  LR L+PNIPFQMLLRGAN V Y++ PDN +  F   A  +G+DIFRVFD LN L  + VG++AV KAGGVVEA+ CYSGD+  P K KYNL YYL++ + +V+ G HILGIKDMAG +KP AA++LIG LR++YPD+PIH+HSHD+AG  VA+M A A +G D+VD AI+SMSGLTSQPS+ A++A L+   +DTG+N+E +    +YW + R LY  FE    ++  + +VY ++IPGGQ TNL FQ+  LGL +Q+ E K+ Y  AN LLGD++KVTP+SK+VGDLAQFMV NK+ +  +   A+ L  P SV++FF+G +G+PYGGFPE LRS V++N  + +T RPG +L+ FD E  + +L + F  D D+ D+ SY +YP V+++FQ  RE +G +S L T+ FL      EEI V +E+GKTL IK  A+ D+ + +G REV+FELNG+LR + + DK  +     +PKA       +G+PM G ++EVKV +G  VKKG+++ ++SAMKMEM V+SP DG+VK V +     ++  DL++ +E
Sbjct:   22 KILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLADLAVNG------SSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGK-KYNLDYYLEVVEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGADVVDVAINSMSGLTSQPSINALLASLEGN-IDTGINVEHVRELDAYWAEMRLLYSCFEA--DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRKLTCRPGLELEPFDLEKIREDLQNRFG-DIDECDVASYNMYPRVYEDFQKIRETYGDLSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPADGQVKDVFIKDGESVDASDLLVVLE 1170          
BLAST of Pyruvate carboxylase vs. Ensembl Yeast
Match: PYC1 (Pyruvate carboxylase isoform; cytoplasmic enzyme that converts pyruvate to oxaloacetate; differentially regulated than isoform Pyc2p; mutations in the human homolog are associated with lactic acidosis; PYC1 has a paralog, PYC2, that arose from the whole genome duplication [Source:SGD;Acc:S000003030])

HSP 1 Score: 1215.29 bits (3143), Expect = 0.000e+0
Identity = 624/1161 (53.75%), Postives = 835/1161 (71.92%), Query Frame = 3
Query:  156 KVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQ--PVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKI---PETPITHEY------------PTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKN-HKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDI-RPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            K+LVANRGEI IR+FR  +E+ +++VAIYS +D +  H+ KADE+Y+IG+  Q  PV AYL I EII I++ H VD IHPGYGFLSE S+FA    +AGI +IGPPA+V+  +GDKV AR  A  ANV  VPG+PGPI+T EEA++F  +YG P+I+KAA+GGGGRGMRVV+E + +++ F RA SEA  AFGNG  F+E+F+++P+HIEVQ+L D  GN VHLFERDCSVQRRHQK+VE+APA  L   +RD +L+DAVKLAK  GY NAGT EFL D   ++HYFIE+N R+QVEHT+TE++TG+D+V +QI IA G SLP+LGL Q++I + G+AIQCRITTEDPA++FQPD+GR+EV+RS  G G+RLD  +A+AG IISP+YDS+L+K     + + +   KM+R+L EFR+RGVKTNIPFL  +L N  F+ G+  T FID+ P LFQ   SQNRAQKLL YL  + VNG      + +K  +  PK+   P  P  H+             P+GWR +L++ GP  FA+ VR+  G L+MDTT+RDAHQSLLATRVRT+D+A I+P  A      F+LE WGGATFDV+MRFL E PWERL  LR L+PNIPFQMLLRGAN V Y++ PDN +  F   A  +G+DIFRVFD LN L  + VG+DAV KAGGVVEA+ C+SGD+  P K KYNL YYL++A+ +V+ G HILGIKDMAG +KP AA++LIG LR+KYPD+PIH+H+HD+AG  VA+M A A +G D+VD AI+SMSGLTSQPS+ A++A L+   +DTG+N+E +    +YW + R LY  FE    ++  + +VY ++IPGGQ TNL FQ+  LGL +Q+ E K+ Y  AN LLGD++KVTP+SK+VGDLAQFMV NK+ +  +   A+ L  P SV++FF+G +G+PYGGFPE  RS V++N  + +T RPG +L+ FD E  + +L + F  D D+ D+ SY +YP V+++FQ  RE +G +S L TR FL      EEI V +E+GKTL IK  A+ D+ + +G REV+F+LNG++R + + D+        + KA       +G+PM G ++EVKV +G  +KKGQ + ++SAMKMEM ++SP DG+VK V V+    ++  DL++ +E
Sbjct:   21 KILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLADVAVNG------SSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGK-KYNLDYYLEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGADVVDVAINSMSGLTSQPSINALLASLEGN-IDTGINVEHVRELDAYWAEMRLLYSCFEA--DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRKLTCRPGLELEPFDLEKIREDLQNRFG-DVDECDVASYNMYPRVYEDFQKMRETYGDLSVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGENVDSSDLLVLLE 1169          
BLAST of Pyruvate carboxylase vs. Ensembl Yeast
Match: DUR1,2 (Urea amidolyase; contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000412])

HSP 1 Score: 331.257 bits (848), Expect = 4.133e-94
Identity = 182/446 (40.81%), Postives = 269/446 (60.31%), Query Frame = 3
Query:  159 VLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH 1496
            VL+ANRGEIA+R+ +   ++GIRSVA+YS+ D    H   AD S  +  G      YL++++II  +K  +  AI PGYGFLSE +DF+ AC  AGI F+GP  D++R +G K  ARQ A  A V +VPGS   I + EEA +   +   P+++K+  GGGG G++ V   E +   F   + +    FG+  +F+E+FIE  RH+EVQ++GD FG A+ L ERDCS+QRR+QK++E  PAPNL    R  +   A  L   + Y+ AGTVEF+YD+  D+ YF+EVN RLQVEH +TE VTG+DLV   I IA   + P+   T+ E+   G +++ R+  E+P ++F+P  G L   +  +    R+D+     G  ISP YD  L K+I H  +   A +K+ ++L E +V G  TNI +L +++ ++ F    V T  ++ +
Sbjct:  636 VLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPL-HGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDA-PDFDSTKVEVN--GVSMEARLYAENPLKNFRPSPGLLVDVKFPDWA--RVDTWVK-KGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSY 1073          
BLAST of Pyruvate carboxylase vs. Ensembl Yeast
Match: ACC1 (Acetyl-CoA carboxylase, biotin containing enzyme; catalyzes carboxylation of cytosolic acetyl-CoA to form malonyl-CoA and regulates histone acetylation by regulating the availablity of acetyl-CoA; required for de novo biosynthesis of long-chain fatty acids; ACC1 has a paralog, HFA1, that arose from the whole genome duplication [Source:SGD;Acc:S000005299])

HSP 1 Score: 234.572 bits (597), Expect = 5.417e-63
Identity = 161/513 (31.38%), Postives = 249/513 (48.54%), Query Frame = 3
Query:  150 IRKVLVANRGEIAIRVFRAC---------NEMGIRSVAIYSEQD-TMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAG--IQFIGPPADVVRKMGDKVEARQAALDANVTVVPGS------------------------PGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEG-----------------KSLPELGL-------TQEEIRSI--GYAIQCRITTEDPARDFQPDSGRLEV--FRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRG-VKTNIPFLFNVLENERFLNGSVDTYFIDE 1493
            I K+L+AN G  A++  R+          ++  ++ VA+ + +D       ++  + Y+   G      Y N+  I+ I++  DVDA+  G+G  SE         ++   + FIGPP + +R +GDK+ +   A  A V  +P S                         G   +PE+ ++  K+ G P+++KA+ GGGG+G+R V+      E+F     +A        +FI K   R RH+EVQ+L D++G  + LF RDCSVQRRHQKI+E AP          +M   AV+L K VGY +AGTVE+LY     K YF+E+N RLQVEH  TE V+GV+L  +Q+ IA G                  S  E+         T+++ R I  G+   CRIT+EDP   F+P  G L    FRS   +       S      I  + DS    + A   N + +   M+ +L+E  +RG  +T + +L  +LE E F + ++ T ++D+
Sbjct:   59 ISKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVER----EEDFIALYHQAANEIPGSPIFIMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHELNFRSSSNV---WGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564          
BLAST of Pyruvate carboxylase vs. Ensembl Yeast
Match: HFA1 (Mitochondrial acetyl-coenzyme A carboxylase; catalyzes production of malonyl-CoA in mitochondrial fatty acid biosynthesis; relocalizes from mitochondrion to cytoplasm upon DNA replication stress; genetic and comparative analysis suggests that translation begins at a non-canonical (Ile) start codon at -372 relative to the annotated start codon [Source:SGD;Acc:S000004820])

HSP 1 Score: 231.491 bits (589), Expect = 5.441e-62
Identity = 147/436 (33.72%), Postives = 224/436 (51.38%), Query Frame = 3
Query:  327 YLNISEIIKISKMHDVDAIHPGYGFLSERSDFAA--ACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQT------------------------PEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEG------------KSLPELGLTQEEIRSI------GYAIQCRITTEDPARDFQPDSGRLEV--FRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRG-VKTNIPFLFNVLENERFLNGSVDTYFIDE 1493
            Y NI  I+ +++  DVDA+  G+G  SE        A  +  I FIGPP   +R +GDK+ +   A  A +  +P S   I T                        PE+A+E  K  G P+++KA+ GGGG+G+R V       ++F     +A+       MF+ K +   RH+EVQ+L D++G  + LF RDCS+QRRHQKI+E AP          +M   A++L + VGY +AGTVE+LY    DK YF+E+N RLQVEH  TE ++GV+L  +Q+ IA G              L   G +  + +++      G+ I CRIT+EDP   F+P +G++    FRS   +       +   GAI S + DS    + A   + + A   M+ +L++F +RG  KT I +L  +LE   F + ++ T ++D+
Sbjct:   54 YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDN----EDDFIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGN--NGAIHS-FSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLDD 482          
BLAST of Pyruvate carboxylase vs. Ensembl Nematostella
Match: EDO48484 (Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc:A7RIZ1])

HSP 1 Score: 1543.48 bits (3995), Expect = 0.000e+0
Identity = 742/1152 (64.41%), Postives = 929/1152 (80.64%), Query Frame = 3
Query:  141 QKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPI----THEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLF-NHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            + +I+K+LVANRGEIAIRVFRA  E GIR+VAIYSEQD   MHR KADE+YL+GKG+ PVAAYLNI EII+I+K  + DAIHPGYGFLSER+DFA AC ++G+ FIGP   VV  MGDK+EAR+ A+++ V VVPG+  PI+T EEA +F +++GLP+I KAAYGGGGRGMRV+ ++E L E F  A +EA AAFG+G MFIEKFIE+PRHIEVQ++GD +G+ VHLFERDCSVQRRHQK++EIAPAP+L  +IR  +  DAV+L K VGY NAGTVEFL DQ    HYFIEVNARLQVEHTVTE++TGVDLVR+QI +AEGK+L ELGL Q+ I+  G AIQ R+TTEDPA +F PD+GR+EVFRSGEGMGIRLD +SAFAGA+ISP+YDSLL KVIAHA + R A  K+ RSLREFRVRGVKTN  F+ NVL+++ FL+G V T FI E+P++ +  K QNRAQKLLK++G +MVNGPVT+ AT LKPS I+PK+PE P+    ++  P+G+RD+ +  GP+ FA AVRK    LI DTTFRDAHQSLLATRVRT+DM +I+PFV+  F N FSLE WGGATFDV++RFL ECPW+RL  LR+ IPNIPFQMLLRGANAVGYT+YPDN+VY+FC  A   GMDIFRVFD LNYLPN+ +G+DA  +AG +VEA+  Y+GD+TDP++TKYN+ YY+ LA  L K G HIL IKDMAG+LKP AA +LIG LR+++P +PIH+H+HDTAGAGVA+MLAAAE+G D+VD A+DSMSG+TSQPSMGAVVA L+ T L+TG+ ++ ++ YS+YWEQAR LY PFE T TM+SGN+DVY N+IPGGQYTNL FQ++SLGL+DQF ++K+KYA+AN LLGDV+KVTP+SK+VGDLAQFMVQN +D + ++EKADEL  P SV+EF QG++GEP+GGFPE LRSK++K+  TI GRPG+ L  FDFEA + +L + F +H   D D++S ALYP VF ++  F++EFGPV  L TR+FL GP I EE  V LE GK LH+K LA+ D+ P+G REVF E+NGQLRSV I DK A+KT+ + PKA K V+GSVG+PMPG+V+ V+VKE + VKKG  L ++SAMKME +V++P+DG VK + V+    +E  DL+I+IE
Sbjct:   47 KHEIKKILVANRGEIAIRVFRAATEAGIRTVAIYSEQDANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKERECDAIHPGYGFLSERADFAHACTKSGVIFIGPSPQVVHMMGDKLEARKMAINSGVPVVPGTENPIRTAEEAKQFCEEHGLPVITKAAYGGGGRGMRVIWKMEDLEEFFNLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPHLDDAIRQTLTEDAVRLCKAVGYSNAGTVEFLLDQ-EGNHYFIEVNARLQVEHTVTEEITGVDLVRAQIGVAEGKTLGELGLVQDNIKITGAAIQARVTTEDPANNFTPDTGRIEVFRSGEGMGIRLDGSSAFAGAVISPHYDSLLTKVIAHANSHREAATKLHRSLREFRVRGVKTNTEFIRNVLQHKDFLDGHVTTDFILENPDMLKVGKGQNRAQKLLKHIGNIMVNGPVTLGATGLKPSRIDPKVPEVPVHNSPSYIRPSGFRDLYLHKGPQGFASAVRKLDRLLITDTTFRDAHQSLLATRVRTHDMVKIAPFVSHYFANAFSLECWGGATFDVALRFLYECPWDRLTELREQIPNIPFQMLLRGANAVGYTSYPDNVVYQFCQKATDRGMDIFRVFDSLNYLPNLQLGIDAAGQAGAIVEAAISYTGDVTDPSRTKYNIDYYMDLASKLAKSGTHILCIKDMAGLLKPKAATLLIGSLRAQFPKLPIHVHTHDTAGAGVASMLAAAEAGADVVDVAVDSMSGMTSQPSMGAVVAALEGTELETGIAMQSVHDYSAYWEQARLLYAPFESTVTMKSGNSDVYENEIPGGQYTNLHFQAYSLGLSDQFSDIKKKYAIANKLLGDVVKVTPTSKVVGDLAQFMVQNNLDKRDVLEKADELDFPSSVVEFMQGYLGEPHGGFPEPLRSKIIKDKPTIKGRPGETLPPFDFEALETKLKEEFGDHSIRDVDVLSAALYPKVFHDYMVFKKEFGPVEGLPTRLFLNGPEIGEEFQVQLEAGKVLHLKVLAVGDLLPNGNREVFCEMNGQLRSVMIHDKGATKTLTLHPKADKGVKGSVGAPMPGKVVGVRVKENEVVKKGMPLVVLSAMKMETNVSAPIDGIVKKISVSLNSNVEAGDLLIDIE 1197          
BLAST of Pyruvate carboxylase vs. Ensembl Nematostella
Match: EDO48483 (Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc:A7RIZ0])

HSP 1 Score: 1504.96 bits (3895), Expect = 0.000e+0
Identity = 717/1141 (62.84%), Postives = 915/1141 (80.19%), Query Frame = 3
Query:  162 LVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHD-FDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            +VANRGEIAIRVFRA  E GIR+VAIYSEQD   MHR KADE+YL+GKG+ PVAAYLNI EII+I+K  + DAIHPGYGFLSER+DFA AC ++GI FIGP   VV  MGDK+EAR+ A++A V VVPG+  PI+  E+A  F +++GLP+I KAAYGGGGRGMRV+  L+ + + FT A +EA AAFG+G MFIEKFIE+PRHIEVQ++GD +G+ VHLFERDCSVQRRHQK++EIAPAP L  +IR  +  DAV+L K VGY NAGTVEFL DQ    HYFIEVNARLQVEHTVTE++TG+DLVR+QI +AEGK+L ELGL Q+ I+  G AIQ R+TTEDPA +F PD+GR+EVFRSGEGMGIRLD +SAFAGA+ISP+YDSLL KVIAHA++ R A  K+ R+L E+R+RGVKTN  FL NVL+++ FLNG+V+T FI E+P+L + + S+NRAQKLL YLG ++VNGPVT LAT LKP+   P +P+T +    P G R+I ++ GP  FA+ VRK     + DTTFRDAHQSLLATRVRT+DM +I+PFV+  F N +SLE WGGATFDV++RFL ECPW+RL  LR+ IPNIPFQMLLRGANAVGYT+YPDN+V++FC  A   GMDIFRVFD LNY+PN+ +G+DA  +AG +VEA+  Y+GD+TDP++TKYN+ YY+ LA  L + GAH+L IKDMAG+LKP AA +L+G +R+++P +PIH+H+HDTAGAGVA+MLAAAE+G D+VD A+DSMSG+TSQPSMGAVVA L+ T LDTG+ L+ ++ YS+YWEQAR LY PFE T TM+SGN+DVY N+IPGGQYTNL FQ++SLGL+DQF E+K+KYA+AN LLGDV+KVTP+SK+VGDLAQFMVQN +D + ++EKADEL  P SV+EF QG++GEP+GGFPE LRSK++K+  TI GRPG+ L  FDF+A + +L + F  D   D D++S ALYP VF ++  F++EFGPV  L TR++  GP I EE  V L+ G+ L++K LA+ D+ P+G REVF E+NG LRSV + DK A+KT+ + PKA K+V+GSVG+PMPG+V+ V+VKE + VKKG +L ++SAMKME +V++P+DG+VK + V+  M +   DL++E+E
Sbjct:    1 MVANRGEIAIRVFRAATEAGIRTVAIYSEQDANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKDKECDAIHPGYGFLSERADFARACTKSGIIFIGPSPQVVHMMGDKLEARKVAVEAGVPVVPGTAEPIRNAEDARAFCQEHGLPVITKAAYGGGGRGMRVIWNLDDVEKYFTLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPLLDENIRQTLTEDAVRLCKAVGYSNAGTVEFLLDQ-EGNHYFIEVNARLQVEHTVTEEITGIDLVRAQIGVAEGKTLGELGLVQDNIKITGAAIQARVTTEDPANNFTPDTGRIEVFRSGEGMGIRLDGSSAFAGAVISPHYDSLLTKVIAHASSHREAATKLHRALTEYRIRGVKTNTSFLMNVLKHDSFLNGTVNTDFILENPDLLKVRVSKNRAQKLLHYLGYILVNGPVTPLATGLKPAKKEPNVPQTYLQ---PQGLRNIFLREGPDGFARYVRKMDRLQLTDTTFRDAHQSLLATRVRTHDMVKIAPFVSHYFANAYSLECWGGATFDVALRFLNECPWDRLAELREQIPNIPFQMLLRGANAVGYTSYPDNVVHQFCKKAKDHGMDIFRVFDSLNYVPNLQLGIDAAGQAGAIVEAAISYTGDVTDPSRTKYNIDYYMDLATKLARSGAHVLCIKDMAGLLKPKAAHLLVGSIRAQFPKLPIHVHTHDTAGAGVASMLAAAEAGADVVDVAVDSMSGMTSQPSMGAVVAALEGTELDTGIALQSVHDYSAYWEQARLLYAPFESTVTMKSGNSDVYENEIPGGQYTNLHFQAYSLGLSDQFPEIKKKYAIANKLLGDVVKVTPTSKVVGDLAQFMVQNNLDERDVLEKADELDFPSSVVEFMQGYLGEPHGGFPEPLRSKIIKDKPTIKGRPGETLPPFDFDALEAKLKEDFGDDNIRDVDVLSAALYPKVFHDYMVFKKEFGPVEGLPTRLYFSGPEIGEEFQVQLQPGRMLNLKVLAIGDLLPNGTREVFCEMNGALRSVMVEDKSATKTLVLHPKADKAVKGSVGAPMPGKVVAVRVKENEVVKKGTSLVVLSAMKMETNVSAPIDGRVKKISVSQNMSLNAGDLLVELE 1137          
BLAST of Pyruvate carboxylase vs. Ensembl Nematostella
Match: EDO26946 (pep supercontig:ASM20922v1:NEMVEscaffold_5057:44:1594:-1 gene:NEMVEDRAFT_v1g152547 transcript:EDO26946 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.525 bits (911), Expect = 4.283e-114
Identity = 169/254 (66.54%), Postives = 207/254 (81.50%), Query Frame = 3
Query:  306 GLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTG 1067
            G+ PVAAYLNI EII+I+K  + DAIHPGYGFLSER+DFA AC ++G+ FIGP   VV  MGDK+EAR+ A+++ V VVPG+  PI+T EEA +F +++GLP+I KAAYGGGGRGMRV+ ++E L E F  A +EA AAFG+G MFIEKFIE+PRHIEVQ++GD +G+ VHLFERDCSVQRRHQK++EIAPAP+L  +IR  +  DAV+L K VGY NAGTVEFL DQ    HYFIEVNARLQVEHTVTE++TG
Sbjct:    2 GMPPVAAYLNIPEIIRIAKERECDAIHPGYGFLSERADFAHACTKSGVIFIGPSPQVVHMMGDKLEARKMAINSGVPVVPGTENPIRTAEEAKQFCEEHGLPVITKAAYGGGGRGMRVIWKMEDLEEFFNLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPHLDDAIRQTLTEDAVRLCKAVGYSNAGTVEFLLDQ-EGNHYFIEVNARLQVEHTVTEEITG 254          
BLAST of Pyruvate carboxylase vs. Ensembl Nematostella
Match: EDO44779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUP0])

HSP 1 Score: 370.933 bits (951), Expect = 1.178e-113
Identity = 197/460 (42.83%), Postives = 284/460 (61.74%), Query Frame = 3
Query:  150 IRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSG-RLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH-PNLFQFKKS 1523
            I K+LVANRGEIA RV      MG+++VA+YS  D   +H   ADE+Y IG       +YL + +I++++K     AIHPGYGFLSE  +FA  C E  I FIGPPA  +R MG K  ++    DA V ++ G  G  Q+ E   +  ++ G P++LKA  GGGG+GMR+V   +   E    A++E++ +F +  M +EKF+E PRH+EVQ+ GD+ GN V+L+ERDCSVQRRHQKI+E APAP ++  +R  +   AV+ AK VGY  AGTVEF+ D  +   YF+E+N RLQ +H +TE +TG+DLV  Q+ IA G+ LP   L Q+E++  G+A + R+  EDP+ DF P +G  L +    E   IR+D+     G  +S YYD ++ K++  +     A   +  SL+++ V G++TNI FL ++ ++  F  G V T FI +H  +LF  K S
Sbjct:   35 ISKILVANRGEIACRVMHTARRMGVQTVAVYSNADAKSLHVSLADEAYRIGPAPSS-ESYLKMHKIMEVAKKTGAQAIHPGYGFLSESPEFADLCQEENIIFIGPPASAIRDMGIKSTSKSIMSDAGVPIIQGYHGEDQSVERLQQEAERIGYPVMLKAVRGGGGKGMRIVNSPDEFHEMLESAKNESIKSFNDDSMLVEKFVETPRHVEVQVFGDRQGNVVYLYERDCSVQRRHQKIIEEAPAPGVSDEVRRSIGEAAVRAAKAVGYFGAGTVEFIMDS-SQNFYFMEMNTRLQAKHPITEMITGLDLVEWQLKIAAGEDLP---LKQDEVQLHGHAFEARVYAEDPSSDFLPGAGPLLHLTTPQETQHIRIDTG-VRQGDQVSTYYDPMIAKLVVWSETRPSALRLLKESLKKYNVVGLETNISFLTSLCDHNSFQAGDVHTDFIKQHMADLFPAKGS 488          
BLAST of Pyruvate carboxylase vs. Ensembl Nematostella
Match: EDO35168 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM69])

HSP 1 Score: 358.607 bits (919), Expect = 8.203e-111
Identity = 198/463 (42.76%), Postives = 284/463 (61.34%), Query Frame = 3
Query:  150 IRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEF---GKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSG-RLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH-PNLFQFKKS 1523
            I K+LVANRGEIA RV      MG+++VA+YS+ D   +H   ADE+Y IG       +YL + +I++++K     AIHPGYGFLSE  +FA  C E  I FIGPPA  +R MG K  ++    DA V ++ G+   I +   ++ F     KY  P++LKA  GGGG+GMR+V   +   E    A++E++ +F +  M +EKF+E PRH+EVQ+ GD+ GN V+L+ERDCSVQRRHQKI+E APAP ++  +R  +   AV+ AK VGY  AGTVEF+ D  +   YF+E+N RLQ +H +TE +TG+DLV  Q+ IA G+ LP   L QEE++  G+A + R+  EDP+ DF P +G  L +    E   IR+D+     G  +S YYD ++ K++  +     A   +  SL+++ V G++TNI FL ++  +  F  G V T FI +H  +LF  K S
Sbjct:    1 ISKILVANRGEIACRVMHTARRMGVQTVAVYSDADAKSLHVSLADEAYRIGPAPSS-ESYLKMHKIMEVAKKTGAQAIHPGYGFLSESPEFADLCQEENIIFIGPPASAIRDMGIKSTSKSIMSDAGVPIIQGN---ILSSLLSIHFYSSTSKY--PVMLKAVRGGGGKGMRIVNSPDEFHEMLESAKNESIKSFNDDSMLVEKFVETPRHVEVQVFGDRQGNVVYLYERDCSVQRRHQKIIEEAPAPGVSDEVRRSIGEAAVRAAKAVGYFGAGTVEFIMDS-SQNFYFMEMNTRLQAKHPITEMITGLDLVEWQLKIAAGEDLP---LKQEEVQLHGHAFEARVYAEDPSSDFLPGAGPLLHLSTPQETQHIRIDTG-VRQGDQVSTYYDPMIAKLVVWSETRPSALRLLKESLKKYNVVGLETNISFLTSLCGHNSFQAGDVHTDFIKQHMADLFPAKGS 452          
BLAST of Pyruvate carboxylase vs. Ensembl Medaka
Match: pcxb (pyruvate carboxylase [Source:NCBI gene;Acc:101170548])

HSP 1 Score: 1212.59 bits (3136), Expect = 0.000e+0
Identity = 611/935 (65.35%), Postives = 734/935 (78.50%), Query Frame = 3
Query:  144 KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKV 2948
            K I+KV+VANRGEIAIRVFRAC EMGIR+VA+YSEQDT QMHR KADE+YLIG+GL PVAAYL+I +IIK++K + VDAIHPGYGFLSER+DFA AC +AG++F+GP  D VRKMGDKVEAR  A  A V VVPG+  PI   ++A  F + YG PII KAAYGGGGRGMRVV+E E L EN+ RA SEAL AFGNG +F+EKFIE+PRHIEVQILGDK+GN +HL+ERDCS+QRRHQK+VEIAP   L   +RD++ SDAV LAK VGYENAGTVEFL D+   KHYFIEVN+RLQVEHTVTE++T    V                                                L+VFRSGEGMGIRLDSASAF GAIISP+YDSLL+KVIA   +   A +KM R+L EFRVRGVKTNIPFL NVL N +FL+ +VDT FIDE+P LF  K +QNRAQKLL YLG +MVNGP T +    KPS I+P +P   +  + P G+RD+L++ GP+ FA+AVR H G L+MDTTFRDAHQSLLATRVRT+D+ +ISPFV+ +F NLFSLENWGGATFDV+MRFL ECPW+RL+ LR LIPN+PFQMLLRGANAVGYTNYPDN V+KFC++A ++GMDIFRVFD LNYLPN+++GM+A   AGGVVEA+  Y+GD++DP + KY+L YY+ LAD+LVK G HIL IKDMAG+LKP ++++LIG LR ++PD+PIH+HSHDTAGAGVA MLA AE+G D+VD A+DSM+G+TSQPSMGA+VAC + T  DTG+ LEK++ YS YWE  R LY PF+CT TM+SGNADVY N+IPGGQYTNL FQ+ S+GL ++F+EVK+ YA AN LLGD+IKVTPSSKIVGDLAQFMVQN +  + + E+ADELS P+SV+EF QGHVG P+GGFPE  RSKV
Sbjct:   35 KPIKKVMVANRGEIAIRVFRACTEMGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLPPVAAYLHIPDIIKVAKENGVDAIHPGYGFLSERADFAQACADAGVRFVGPTPDTVRKMGDKVEARSLANSAGVPVVPGTDAPISCLQDAQAFAQTYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALTAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPGFQLDPHLRDRLHSDAVNLAKQVGYENAGTVEFLVDK-HGKHYFIEVNSRLQVEHTVTEEITDKPFV------------------------------------------------LQVFRSGEGMGIRLDSASAFQGAIISPHYDSLLVKVIASGKDLNTAASKMSRALAEFRVRGVKTNIPFLQNVLSNNQFLHSTVDTQFIDENPELFNLKPTQNRAQKLLHYLGHVMVNGPTTPIPVKAKPSSIDPVVPHVGMG-DPPVGFRDVLLRDGPEGFAKAVRAHQGLLLMDTTFRDAHQSLLATRVRTHDLKKISPFVSHSFSNLFSLENWGGATFDVAMRFLSECPWKRLQELRALIPNVPFQMLLRGANAVGYTNYPDNAVFKFCEVAKENGMDIFRVFDSLNYLPNMLLGMEAAGAAGGVVEAAISYTGDVSDPMRQKYSLDYYVNLADELVKAGTHILCIKDMAGLLKPTSSQLLIGALRDRFPDVPIHVHSHDTAGAGVAAMLACAEAGADVVDVAVDSMAGMTSQPSMGAIVACTKGTKYDTGIALEKVFDYSEYWEVTRGLYAPFDCTATMKSGNADVYENEIPGGQYTNLHFQAHSMGLGNKFKEVKKAYAEANKLLGDLIKVTPSSKIVGDLAQFMVQNSLTRQEVEERADELSFPQSVVEFLQGHVGIPHGGFPEPFRSKV 919          

HSP 2 Score: 169.859 bits (429), Expect = 2.461e-42
Identity = 79/129 (61.24%), Postives = 103/129 (79.84%), Query Frame = 3
Query: 3195 VDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            V+LE+GKTLHIK LAL D+  +G REVFFE+NGQLRSV + D  A K ++  PKA+KS++G VG+PMPG+VLEVKVK G  V+KGQ LC++SAMKME  VNSP+ G +K +HV+P   +EG+DL++EIE
Sbjct:  919 VELERGKTLHIKALALGDLNKNGQREVFFEMNGQLRSVLVKDTVAMKEMKFHPKAQKSIKGQVGAPMPGKVLEVKVKTGSKVEKGQPLCVLSAMKMETVVNSPMAGTIKAIHVSPDASLEGDDLILEIE 1047          
BLAST of Pyruvate carboxylase vs. Ensembl Medaka
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:101161876])

HSP 1 Score: 365.925 bits (938), Expect = 1.761e-111
Identity = 197/476 (41.39%), Postives = 282/476 (59.24%), Query Frame = 3
Query:  144 KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH-PNLFQFKKSQNRAQKLLKYLGTLM 1568
            ++I KVL+ANRGEIA RV R   +MG+RSVA+YSE D   MH   ADE+Y IG       +YL++ ++++++K     A+HPGYGFLSE ++FA AC   GI FIGPP+  +R MG K  ++     A V ++ G  G  Q+ E  +    K G P+++KA  GGGG+GMR+ +      E    A+ EA  +F +  M +EKF+E PRH+EVQ+ GD  GNAV+LFERDCSVQRRHQKI+E AP P ++  +R K+   AV+ AK V Y  AGTVEF+ D      YF+E+N RLQVEH VTE +TG DLV  Q+ +A G+ LP   L Q++I   G++ + RI  EDP  +F P +G L    +               G  +S +YD ++ K++    +   A  K+   LR++ + G+ TNI FL ++  +  F  G+V T FI +H  +LF   ++ + A      LG ++
Sbjct:   20 ERIEKVLIANRGEIACRVMRTAKKMGVRSVAVYSEADKSSMHVAMADEAYHIGPPPSQ-QSYLSVEKVLEVAKKSGSHAVHPGYGFLSENTEFAEACKREGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIGGYHGEDQSNERLLAEAAKIGFPVMIKAVRGGGGKGMRIARSETDFLEQLESARREARKSFNDDVMLVEKFVEDPRHVEVQVFGDTHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRKKLGEAAVRAAKAVNYVGAGTVEFIVD-AQHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRVAAGERLP---LLQDDIILRGHSFEARIYAEDPNNEFLPGAGPLLHLSTPPADRHTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVSTSFIPQHYSDLFPTPRAPSGATICQAALGLIL 490          
BLAST of Pyruvate carboxylase vs. Ensembl Medaka
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:101161876])

HSP 1 Score: 365.925 bits (938), Expect = 2.887e-111
Identity = 197/476 (41.39%), Postives = 282/476 (59.24%), Query Frame = 3
Query:  144 KKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEH-PNLFQFKKSQNRAQKLLKYLGTLM 1568
            ++I KVL+ANRGEIA RV R   +MG+RSVA+YSE D   MH   ADE+Y IG       +YL++ ++++++K     A+HPGYGFLSE ++FA AC   GI FIGPP+  +R MG K  ++     A V ++ G  G  Q+ E  +    K G P+++KA  GGGG+GMR+ +      E    A+ EA  +F +  M +EKF+E PRH+EVQ+ GD  GNAV+LFERDCSVQRRHQKI+E AP P ++  +R K+   AV+ AK V Y  AGTVEF+ D      YF+E+N RLQVEH VTE +TG DLV  Q+ +A G+ LP   L Q++I   G++ + RI  EDP  +F P +G L    +               G  +S +YD ++ K++    +   A  K+   LR++ + G+ TNI FL ++  +  F  G+V T FI +H  +LF   ++ + A      LG ++
Sbjct:   38 ERIEKVLIANRGEIACRVMRTAKKMGVRSVAVYSEADKSSMHVAMADEAYHIGPPPSQ-QSYLSVEKVLEVAKKSGSHAVHPGYGFLSENTEFAEACKREGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIGGYHGEDQSNERLLAEAAKIGFPVMIKAVRGGGGKGMRIARSETDFLEQLESARREARKSFNDDVMLVEKFVEDPRHVEVQVFGDTHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRKKLGEAAVRAAKAVNYVGAGTVEFIVD-AQHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRVAAGERLP---LLQDDIILRGHSFEARIYAEDPNNEFLPGAGPLLHLSTPPADRHTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVSTSFIPQHYSDLFPTPRAPSGATICQAALGLIL 508          
BLAST of Pyruvate carboxylase vs. Ensembl Medaka
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:101175100])

HSP 1 Score: 334.724 bits (857), Expect = 5.498e-100
Identity = 190/470 (40.43%), Postives = 287/470 (61.06%), Query Frame = 3
Query:  141 QKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQ-PDSGRLEVFRSGEGMG-IRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDE-HPNLF---QFKKSQNR 1532
            ++  +K+L+ANRGEIA RV + C  MGI+++A++S+ D+  +H   ADE+  +G     ++ YLN+  I+   +     A+HPGYGFLSE  +FA       + FIGP    ++ MGDK++++  A  A V  +PG  G +++ E+A++  ++ G P+++KA+ GGGG+GMR+    E   E F  +  EA ++FG+  + IEK+I+RPRHIE+Q+L DK GNA+ L ER+CS+QRR+QK+VE AP+  L  + R  M   AV+LAK V Y +AGTVEFL D      YF+E+N RLQVEH +TE +TG+DLV   I +A+G  L      QE+I   G+AI+ R+  EDP + F  P  GRL  ++    +  +R+DS     G+ IS YYD ++ K++        A A+M  SL  + +RGV  NIP L  ++ +  F++G + T F+ E +P  F   Q +  Q R
Sbjct:   46 EETFQKLLIANRGEIACRVIKTCKRMGIQTIAVHSDVDSNAVHVKMADEAVCVGPAPTSLS-YLNMDAILNAVRRTGAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIQSKLIAKAAKVNTIPGFDGVVKSAEDAVKIAQQIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDRPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPTTRRAMGEQAVQLAKAVQYSSAGTVEFLVD-AQKNFYFLEMNTRLQVEHPITECITGLDLVEQMIRVAKGYRLQH---KQEDIPINGWAIESRVYAEDPFKSFGLPSIGRLSQYQEPLDLSNVRVDSGIE-EGSDISIYYDPMISKLVTFGATRAEALARMEESLDRYVIRGVTHNIPLLREIITHPLFISGDISTNFLPEVYPEGFKGHQLEAEQRR 509          

HSP 2 Score: 68.1662 bits (165), Expect = 3.766e-11
Identity = 39/104 (37.50%), Postives = 57/104 (54.81%), Query Frame = 3
Query: 3273 VFFELNGQLRSVEIVDKEASKTIRVRP-KAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            +  +  G L  V ++ K ASK     P K  +     + SPMPG V+ V V  GD+V +GQ +C+I AMKM+ S+ +    KVK VH  P   +   DL++E+E
Sbjct:  611 IALQFMGTLFKVRVLSKLASKLNSYMPEKLPEDTSSILRSPMPGTVVAVSVHPGDTVAEGQEICVIEAMKMQNSLTAVKQAKVKSVHCKPGETVGEGDLLVELE 714          
BLAST of Pyruvate carboxylase vs. Ensembl Medaka
Match: acacb (acetyl-CoA carboxylase beta [Source:NCBI gene;Acc:101171338])

HSP 1 Score: 238.424 bits (607), Expect = 2.663e-63
Identity = 165/516 (31.98%), Postives = 256/516 (49.61%), Query Frame = 3
Query:  150 IRKVLVANRGEIAIRVFRAC---------NEMGIRSVAIYSEQDTMQMHRLKADESYL-IGKGLQPVAA------YLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGS---------------------------PGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSI-----------------------GYAIQCRITTEDPARDFQPDSGRLEV--FRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRG-VKTNIPFLFNVLENERFLNGSVDTYFID 1490
            I KVL+AN G  A++  R+          NE  IR V + + +D      LKA+  Y+ +     PV        Y N+  I+ I+K   V  +  G+G  SE        H+AGI F+GP +  +  +GDKV +   A  A++  +P S                            G ++  E+ +   ++ G P+++KA+ GGGG+G+R V+  E     F + Q+E   +     +F+ +  +  RH+EVQIL D++GNA+ LF RDCS+QRRHQKI+E APA   A S  ++M   AV++AK VGY +AGTVE+LY +    H F+E+N RLQVEH  TE +  V+L  +Q+ IA G  L  +    ++IR +                       G+ I  RIT+E+P   F+P SG ++   FRS + +     S  A  G  +  + DS      +   N   A + M+ +L+E  +RG  +T + +L  +LE E + N  +DT ++D
Sbjct:  197 IEKVLIANNGIAAVKCMRSIRRWSYEMFRNERTIRFVVMVTPED------LKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIAKRIPVQGVWAGWGHASENPKLPELLHKAGISFLGPSSKAMWALGDKVASSIVAQSADIPTLPWSGSGLKVDWTEEDQTQGKVISVPPEVYNEGCVRDVEDGLAGAERIGYPVVIKASEGGGGKGIRKVENSEDFPGFFRQVQTEVPGS----PIFVMQLAQHARHLEVQILADEYGNAISLFGRDCSIQRRHQKIIEEAPATIAASSTLEQMEQYAVRMAKMVGYVSAGTVEYLYSEDGSFH-FLELNPRLQVEHPCTEMIGDVNLPAAQLQIAMGIPLSRI----KDIRLLYGESPWGDTHINFEVPYRLPSPRGHVIAVRITSENPDEGFKPSSGTVQELNFRSSKNVWGYF-SVGATGG--LHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKILETESYRNNEIDTGWLD 694          
BLAST of Pyruvate carboxylase vs. Planmine SMEST
Match: SMESG000077941.1 (SMESG000077941.1)

HSP 1 Score: 2419.81 bits (6270), Expect = 0.000e+0
Identity = 1183/1183 (100.00%), Postives = 1183/1183 (100.00%), Query Frame = 3
Query:   33 MSAMFQAIKLKCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDXXXXXXXXXXXXXESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            MSAMFQAIKLKCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDTAGAGVATMLAAAESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE
Sbjct:    1 MSAMFQAIKLKCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEVFRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNRAQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDILVKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVAQNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRGANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHKAGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAGVLKPNAARILIGELRSKYPDIPIHLHSHDTAGAGVATMLAAAESGVDIVDCAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLYGPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYAVANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVIEFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELNDLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIAEEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEASKTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 1183          
BLAST of Pyruvate carboxylase vs. Planmine SMEST
Match: SMESG000034830.1 (SMESG000034830.1)

HSP 1 Score: 345.125 bits (884), Expect = 8.321e-104
Identity = 192/514 (37.35%), Postives = 311/514 (60.51%), Query Frame = 3
Query:   54 IKLKC---KPNFH---SKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQ-PDSGRLEVFRSGEGM-GIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDE-HPNLFQFKKSQNRAQKLLKYLGTLM 1568
            +++KC    P  H   +KF      I +       + K +K+L+ANRGEIA R+  +C   GI++VA++S+ D +      ADE+  IG   Q   +YLN+ +I+   K    +A+HPGYGFLSE + FA    +  + F+GP +  +  MGDK+E+++ A  A V  +PG  G I   +EA++   + G P+++KA+ GGGG+GMR+    +   E +  +++EA ++FG+  M IEK+I +PRHIE+QI+ DK GNA++L ER+CS+QRR+QK++E AP+  +    R  M   AV++AK VGY++AGTVEFL D   +  YF+E+N RLQVEH ++E +TGVD+V     + +G  L    L Q +I   G+A++CR+  EDP + F  P  GRL  ++    +  +R DS     G+ IS YYD ++ K++ +  +   A A M+++L  + +RGV  NIP L +++   RF++G++ T ++ E +P+ F+ K+   +   LL+ +  ++
Sbjct:    2 LRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPA-QTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRN-FYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVV 509          

HSP 2 Score: 57.3806 bits (137), Expect = 6.432e-8
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 3
Query: 3351 PKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            PK        + +PMPG V  V VK G  V  GQ LC++ AMKM+ S+ +   G +K VH  P   +   D++IE+E
Sbjct:  637 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 713          
BLAST of Pyruvate carboxylase vs. Planmine SMEST
Match: SMESG000034830.1 (SMESG000034830.1)

HSP 1 Score: 345.125 bits (884), Expect = 8.430e-104
Identity = 192/514 (37.35%), Postives = 311/514 (60.51%), Query Frame = 3
Query:   54 IKLKC---KPNFH---SKFLFHNSGINYKSDQILTQKKIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQ-PDSGRLEVFRSGEGM-GIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDE-HPNLFQFKKSQNRAQKLLKYLGTLM 1568
            +++KC    P  H   +KF      I +       + K +K+L+ANRGEIA R+  +C   GI++VA++S+ D +      ADE+  IG   Q   +YLN+ +I+   K    +A+HPGYGFLSE + FA    +  + F+GP +  +  MGDK+E+++ A  A V  +PG  G I   +EA++   + G P+++KA+ GGGG+GMR+    +   E +  +++EA ++FG+  M IEK+I +PRHIE+QI+ DK GNA++L ER+CS+QRR+QK++E AP+  +    R  M   AV++AK VGY++AGTVEFL D   +  YF+E+N RLQVEH ++E +TGVD+V     + +G  L    L Q +I   G+A++CR+  EDP + F  P  GRL  ++    +  +R DS     G+ IS YYD ++ K++ +  +   A A M+++L  + +RGV  NIP L +++   RF++G++ T ++ E +P+ F+ K+   +   LL+ +  ++
Sbjct:    2 LRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPA-QTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRN-FYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVV 509          

HSP 2 Score: 57.3806 bits (137), Expect = 6.752e-8
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 3
Query: 3351 PKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKMEMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE 3581
            PK        + +PMPG V  V VK G  V  GQ LC++ AMKM+ S+ +   G +K VH  P   +   D++IE+E
Sbjct:  646 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 722          
BLAST of Pyruvate carboxylase vs. Planmine SMEST
Match: SMESG000025190.1 (SMESG000025190.1)

HSP 1 Score: 310.842 bits (795), Expect = 4.287e-92
Identity = 189/511 (36.99%), Postives = 279/511 (54.60%), Query Frame = 3
Query:  147 KIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKH--YFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPAR--DFQPDSGRLEVFRSGE-GMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPN-LFQFKKSQNRAQKLLKYLGTLM-VNGPVTVLATDLKPSLINPKIPETPITHEY 1658
            +I K+L+ANRGEIA RV +    MGI ++A+YSE D   +H   A +SY IG     ++ YLN  +++ +++M    AIHPGYGFLSE  +FAA C+                                       G  Q  +  +E   K G PI++KA  GGGG+GMR+        E    A+ EA+ +F +  M +EKFIE PRH+EVQ+ GD +GN VHL ERDCSVQRRHQKI+E AP P +   IRD++   AVK A  V Y  AGTVEF+ D    KH  YF+E+N RLQVEH +TE +TG DLV  Q+ +A G+ LP   + Q  I+  G+A + RI  ED      F P +G ++  R  E    +R+D+     G  IS +YD ++ K++  + +   A  K+  +L  +++ G+ TNI FL ++  +  F++G V T FI +H + LF  +KS+ R   +   +  ++    P+ + +++ + S    ++P   I H +
Sbjct:    5 RISKILIANRGEIACRVIKTAKRMGIETIAVYSEADRNSLHAKMASQSYCIGPAASQLS-YLNAEKLLSVAQMTKSQAIHPGYGFLSENVEFAALCYH--------------------------------------GNNQNKDYLLEEATKIGFPIMIKAVRGGGGKGMRICLSKNEFFEQLESAKREAIKSFNDDAMLLEKFIETPRHVEVQVFGDSYGNYVHLCERDCSVQRRHQKIIEEAPGPGITAEIRDRLGKAAVKAAAAVSYVGAGTVEFIMDA---KHNFYFMEMNTRLQVEHPITEMITGTDLVEWQLRVASGERLPI--IDQALIQPKGHAFEARIYAEDCTNPTAFMPTAGLIKHMRLPEINENVRIDTG-VLEGDEISVHYDPMISKLVVWSHDRSSALQKLTMALNSYQIVGLPTNIEFLKSLSLHPSFIDGLVHTDFIKQHTDSLFAVEKSETRDVSIAAAVSVMIDSQHPIVIDSSEDRYSPFATQLPGFRINHNF 470          
BLAST of Pyruvate carboxylase vs. Planmine SMEST
Match: SMESG000025178.1 (SMESG000025178.1)

HSP 1 Score: 298.13 bits (762), Expect = 2.532e-87
Identity = 186/511 (36.40%), Postives = 278/511 (54.40%), Query Frame = 3
Query:  147 KIRKVLVANRGEIAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYLNISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVRKMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAYGGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEVQILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVKLAKFVGYENAGTVEFLYDQVTDKH--YFIEVNARLQVEHTVTEDVTGVDLVRSQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPAR--DFQPDSGRLEVFRSGE-GMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRSLREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPN-LFQFKKSQNRAQKLLKYLGTLM-VNGPVTVLATDLKPSLINPKIPETPITHEY 1658
            +I K+L+ANRGEIA RV +    MGI ++A+YSE D   +H   A +SY IG     ++ YLN  +++ +++M    AIHPGYGFLSE  +FAA C    + FIGPP   +R MG K  ++     A V VV G  G  Q  +  +E   K G PI++KA  GGGG+GMR+        E    A+ EA+ +F +  M +EKFIE PRH+EVQ+ G                     KI+E AP P +   IRD++   AVK A  V Y  AGTVEF+ D    KH  YF+E+N RLQVEH +TE +TG DLV  Q+ +A G+ LP   + Q  I+  G+A + RI  ED      F P +G ++  R  E    +R+D+     G  IS +YD ++ K++  + +   A  K+  +L  +++ G+ TNI FL ++  +  F++G V T FI +H + LF  +KS+ R   +   +  ++    P+ + +++ + S    ++P   I H +
Sbjct:    5 RISKILIANRGEIACRVIKTAKRMGIETIAVYSEADRNSLHAKMASQSYCIGPAASQLS-YLNAEKLLSVAQMTKSQAIHPGYGFLSENVEFAALCKANNVIFIGPPESAIRDMGIKNTSKSIMEAAGVPVVKGYHGNNQNKDYLLEEATKIGFPIMIKAVRGGGGKGMRICLSKNEFFEQLESAKREAIKSFNDDAMLLEKFIETPRHVEVQVFGIV------------------TKIIEEAPGPGITAEIRDRLGKAAVKAAAAVSYVGAGTVEFIMDA---KHNFYFMEMNTRLQVEHPITEMITGTDLVEWQLRVASGERLPI--IDQALIQPKGHAFEARIYAEDCTNPTAFMPTAGLIKHMRLPEINENVRIDTG-VLEGDEISVHYDPMISKLVVWSHDRSSALQKLTMALNSYQIVGLPTNIEFLKSLSLHPSFIDGLVHTDFIKQHTDSLFAVEKSETRDVSIAAAVSVMIDSQHPIVIDSSEDRYSPFATQLPGFRINHNF 490          
The following BLAST results are available for this feature:
BLAST of Pyruvate carboxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PC0.000e+064.66pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
PC0.000e+064.66pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
PC0.000e+064.66pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
PC0.000e+064.66pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
PC0.000e+064.66pyruvate carboxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pyc-10.000e+066.96Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Pr... [more]
pyc-10.000e+066.96Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Pr... [more]
pyc-10.000e+065.53Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Pr... [more]
mccc-11.537e-11045.81MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [S... [more]
mccc-11.537e-11045.81MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [S... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCB0.000e+067.49gene:FBgn0027580 transcript:FBtr0088455[more]
PCB0.000e+067.49gene:FBgn0027580 transcript:FBtr0088457[more]
PCB0.000e+067.49gene:FBgn0027580 transcript:FBtr0088456[more]
PCB0.000e+067.49gene:FBgn0027580 transcript:FBtr0088459[more]
PCB0.000e+067.49gene:FBgn0027580 transcript:FBtr0088462[more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcxa0.000e+066.64pyruvate carboxylase a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pcxa0.000e+066.64pyruvate carboxylase a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pcxb0.000e+066.23pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pcxb0.000e+070.37pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
mccc11.154e-11042.29methylcrotonoyl-CoA carboxylase 1 (alpha) [Source:... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd30.000e+066.75homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462][more]
hoxd30.000e+066.93homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462][more]
hoxd30.000e+066.93homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462][more]
hoxd30.000e+066.93homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462][more]
hoxd34.846e-4169.28homeobox D3 [Source:Xenbase;Acc:XB-GENE-478462][more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcx0.000e+064.32pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97... [more]
Pcx0.000e+064.32pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97... [more]
Pcx0.000e+064.32pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97... [more]
Mccc11.816e-10944.44methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) [... [more]
Pcca1.011e-10542.73propionyl-Coenzyme A carboxylase, alpha polypeptid... [more]
back to top
BLAST of Pyruvate carboxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O17732|PYC1_CAEEL0.000e+066.96Pyruvate carboxylase 1 OS=Caenorhabditis elegans O... [more]
sp|P11498|PYC_HUMAN0.000e+064.66Pyruvate carboxylase, mitochondrial OS=Homo sapien... [more]
sp|Q29RK2|PYC_BOVIN0.000e+064.84Pyruvate carboxylase, mitochondrial OS=Bos taurus ... [more]
sp|P52873|PYC_RAT0.000e+064.23Pyruvate carboxylase, mitochondrial OS=Rattus norv... [more]
sp|Q05920|PYC_MOUSE0.000e+064.23Pyruvate carboxylase, mitochondrial OS=Mus musculu... [more]
back to top
BLAST of Pyruvate carboxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CX270.000e+070.72Pyruvate carboxylase OS=Schistosoma japonicum OX=6... [more]
A0A3Q0KND40.000e+069.95Pyruvate carboxylase OS=Schistosoma mansoni OX=618... [more]
A0A094ZHZ70.000e+069.52Pyruvate carboxylase OS=Schistosoma haematobium OX... [more]
K1QHI50.000e+067.08Pyruvate carboxylase, mitochondrial OS=Crassostrea... [more]
A0A0P5LPJ20.000e+068.42Pyruvate carboxylase, mitochondrial OS=Daphnia mag... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcxb0.000e+066.52pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pcxb8.467e-3968.33pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
mccc16.683e-11342.22methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
ENSAMXT00000052136.11.620e-11159.60pep primary_assembly:Astyanax_mexicanus-2.0:14:189... [more]
pcca2.670e-10341.87propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006397.10.000e+056.51pep scaffold:Pmarinus_7.0:GL476470:932002:942971:-... [more]
ENSPMAT00000006339.10.000e+048.01pep scaffold:Pmarinus_7.0:GL476470:734267:771330:-... [more]
ENSPMAT00000006346.11.715e-16269.83pep scaffold:Pmarinus_7.0:GL476470:805110:813016:1... [more]
ENSPMAT00000006351.16.386e-16269.75pep scaffold:Pmarinus_7.0:GL476470:805693:813506:1... [more]
pcca1.346e-8843.77propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PYC20.000e+054.01Pyruvate carboxylase isoform; cytoplasmic enzyme t... [more]
PYC10.000e+053.75Pyruvate carboxylase isoform; cytoplasmic enzyme t... [more]
DUR1,24.133e-9440.81Urea amidolyase; contains both urea carboxylase an... [more]
ACC15.417e-6331.38Acetyl-CoA carboxylase, biotin containing enzyme; ... [more]
HFA15.441e-6233.72Mitochondrial acetyl-coenzyme A carboxylase; catal... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO484840.000e+064.41Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO484830.000e+062.84Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO269464.283e-11466.54pep supercontig:ASM20922v1:NEMVEscaffold_5057:44:1... [more]
EDO447791.178e-11342.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351688.203e-11142.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pyruvate carboxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcxb2.461e-4265.35pyruvate carboxylase [Source:NCBI gene;Acc:1011705... [more]
mccc11.761e-11141.39methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
mccc12.887e-11141.39methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
pcca5.498e-10040.43propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
acacb2.663e-6331.98acetyl-CoA carboxylase beta [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Pyruvate carboxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077941.10.000e+0100.00SMESG000077941.1[more]
SMESG000034830.18.321e-10437.35SMESG000034830.1[more]
SMESG000034830.18.430e-10437.35SMESG000034830.1[more]
SMESG000025190.14.287e-9236.99SMESG000025190.1[more]
SMESG000025178.12.532e-8736.40SMESG000025178.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024713 ID=SMED30024713|Name=Pyruvate carboxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=3655bp
CTATATAAATCTTATATGATTCTTATTTAAAAATGTCTGCTATGTTTCAA
GCGATAAAATTAAAATGCAAACCTAATTTTCATTCTAAGTTTTTGTTTCA
TAATTCAGGAATTAATTATAAATCAGATCAGATATTAACACAGAAAAAAA
TTCGAAAGGTTTTAGTTGCGAATCGAGGAGAAATTGCTATTCGCGTTTTT
CGAGCATGTAATGAAATGGGAATTCGGTCAGTGGCCATTTATAGTGAACA
GGACACGATGCAAATGCATCGTTTAAAAGCCGATGAATCGTATTTAATTG
GCAAAGGCTTACAACCAGTAGCGGCTTATTTGAACATTAGTGAAATAATT
AAAATTTCAAAAATGCATGATGTCGACGCTATTCATCCGGGATATGGGTT
TTTAAGTGAACGCTCGGATTTTGCAGCAGCTTGCCATGAAGCTGGAATAC
AATTTATTGGTCCACCGGCAGATGTCGTGCGTAAGATGGGTGACAAAGTC
GAGGCAAGACAAGCTGCATTAGATGCCAATGTCACTGTGGTTCCAGGAAG
CCCAGGGCCGATTCAGACACCAGAAGAAGCAATGGAGTTTGGTAAGAAAT
ACGGTTTGCCAATTATATTGAAAGCAGCATATGGTGGAGGTGGACGTGGG
ATGCGAGTAGTTAAAGAATTGGAGACTTTATCTGAAAATTTTACTCGAGC
CCAGTCGGAAGCTTTAGCCGCTTTTGGAAACGGTGAAATGTTCATTGAAA
AATTTATTGAAAGACCAAGACACATTGAAGTTCAAATATTAGGTGACAAG
TTCGGCAATGCTGTGCATCTATTCGAAAGAGATTGTAGTGTTCAAAGGAG
ACATCAGAAAATTGTTGAAATCGCCCCAGCTCCAAATTTAGCAGTTTCAA
TAAGAGATAAAATGTTGTCAGATGCCGTTAAATTAGCAAAATTTGTTGGA
TATGAAAATGCCGGGACTGTTGAGTTTCTGTACGACCAAGTAACAGATAA
ACATTATTTTATCGAAGTCAATGCTAGATTGCAAGTTGAACATACAGTGA
CAGAAGATGTTACCGGAGTGGATTTAGTACGATCTCAAATTTTGATAGCC
GAAGGTAAAAGTTTACCGGAGCTTGGTCTTACCCAAGAAGAAATAAGATC
AATTGGATATGCGATTCAATGTCGAATTACAACCGAAGATCCCGCTCGTG
ATTTCCAACCTGATTCTGGTAGATTGGAGGTTTTTCGAAGTGGAGAAGGA
ATGGGTATACGTCTCGATTCTGCAAGTGCTTTTGCTGGAGCAATTATTTC
TCCGTATTATGACTCATTATTAATTAAAGTCATAGCTCATGCGACTAATT
TTCGATTGGCTTGTGCCAAAATGTTGCGATCACTTAGAGAATTTAGAGTT
AGAGGTGTAAAGACAAATATTCCATTTCTTTTCAATGTCCTCGAAAACGA
ACGTTTTTTAAATGGAAGTGTCGATACGTACTTTATTGATGAACATCCAA
ATCTGTTTCAGTTTAAAAAATCTCAAAATCGAGCACAGAAATTGCTGAAA
TATTTAGGTACATTAATGGTAAATGGACCGGTGACTGTGCTTGCTACAGA
TTTGAAACCGTCTTTAATAAATCCCAAAATTCCTGAAACTCCAATTACGC
ATGAGTATCCTACTGGGTGGAGAGATATTCTAGTAAAATCAGGCCCGAAA
GCTTTTGCGCAGGCAGTTAGAAAACATCCAGGATGTTTAATAATGGATAC
GACATTTAGAGATGCCCATCAATCTTTATTGGCCACTCGAGTCAGGACGT
ATGATATGGCGGAAATTAGTCCCTTTGTGGCGCAAAACTTTCCTAATCTA
TTCAGCTTGGAAAACTGGGGAGGCGCAACATTTGATGTTTCTATGAGATT
TTTGAAAGAGTGCCCGTGGGAACGATTGGAAACATTGAGAAAATTGATTC
CAAATATTCCATTTCAAATGCTATTAAGAGGAGCAAACGCAGTTGGCTAT
ACTAACTATCCAGATAACATTGTATATAAGTTCTGTGACCTAGCCGTTCA
ATCAGGAATGGATATTTTCCGAGTTTTTGACTGTCTTAATTATTTACCTA
ATATTATTGTTGGTATGGATGCGGTTCATAAAGCTGGGGGTGTTGTTGAG
GCGTCATTTTGCTACAGTGGTGATATTACTGATCCAACGAAAACCAAATA
TAATCTTCCGTATTATTTGAAACTTGCCGATGATTTGGTTAAAGGAGGGG
CTCATATCCTTGGTATCAAAGACATGGCAGGTGTATTGAAACCGAATGCC
GCAAGAATCCTCATCGGTGAATTACGAAGCAAATATCCGGACATACCCAT
TCATTTACATTCTCACGATACAGCTGGAGCCGGAGTAGCTACAATGTTAG
CTGCTGCAGAGTCCGGAGTTGATATTGTAGATTGTGCCATAGATTCGATG
TCAGGTCTCACTAGTCAGCCTTCAATGGGAGCCGTCGTTGCCTGTTTACA
AAATACACCTTTAGATACAGGATTGAATTTGGAAAAAATTTACTCTTATT
CGTCATATTGGGAACAGGCACGAAGGCTTTATGGGCCTTTTGAGTGCACA
ACAACTATGCGTAGTGGTAATGCTGATGTTTATCATAATCAAATCCCTGG
GGGTCAATATACCAATCTTCAATTCCAATCTTTCTCTCTTGGATTAGCAG
ATCAATTCGAAGAAGTTAAGCAAAAATATGCTGTTGCAAATGATCTGTTG
GGAGATGTTATCAAAGTAACCCCTTCATCAAAAATAGTTGGTGATTTAGC
ACAATTCATGGTTCAAAATAAAATAGACGCTAAAACCTTAGTTGAGAAAG
CTGATGAATTGTCACTTCCTAAATCGGTTATTGAATTTTTTCAAGGTCAT
GTTGGTGAACCATATGGTGGCTTTCCGGAAAAATTACGATCTAAAGTCGT
TAAAAATCATAAAACTATAACTGGTCGACCAGGAGATGACCTAAAGGCAT
TTGATTTTGAAGCTGCCAAGTTTGAATTAAATGACCTATTCAATCATGAT
TTCGATGACAAAGACATCATGTCATACGCATTGTATCCAGCTGTTTTCAA
AGAATTCCAATATTTTCGAGAGGAATTTGGACCGGTTTCTAAATTAGGGA
CTAGAATATTTTTAGTTGGACCCAGAATTGCCGAAGAGATTTCAGTAGAC
CTCGAAAAAGGAAAAACACTGCATATTAAAACATTAGCTCTTAGTGATAT
AAGGCCCAGTGGAGTTCGAGAGGTATTTTTTGAATTGAACGGGCAACTGA
GATCCGTTGAAATAGTTGATAAAGAAGCATCAAAAACTATTCGAGTACGG
CCGAAAGCGAAAAAAAGCGTTCGGGGATCAGTGGGATCACCTATGCCAGG
CGAAGTATTAGAAGTAAAAGTAAAAGAGGGCGACAGTGTTAAAAAAGGCC
AAACACTCTGCATTATTAGTGCAATGAAAATGGAAATGTCAGTCAATTCT
CCGGTTGATGGTAAAGTGAAAGTTGTACACGTAGCACCTAAAATGAAAAT
TGAAGGTGAAGATCTAATGATAGAGATAGAATAGACTTGATTTTTTTCTT
ATTTTATTTATATTTGTTCAAGTTTTTGATTTTTAATACATAGATTTAGT
TAAAA
back to top

protein sequence of SMED30024713-orf-1

>SMED30024713-orf-1 ID=SMED30024713-orf-1|Name=SMED30024713-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1184bp
MSAMFQAIKLKCKPNFHSKFLFHNSGINYKSDQILTQKKIRKVLVANRGE
IAIRVFRACNEMGIRSVAIYSEQDTMQMHRLKADESYLIGKGLQPVAAYL
NISEIIKISKMHDVDAIHPGYGFLSERSDFAAACHEAGIQFIGPPADVVR
KMGDKVEARQAALDANVTVVPGSPGPIQTPEEAMEFGKKYGLPIILKAAY
GGGGRGMRVVKELETLSENFTRAQSEALAAFGNGEMFIEKFIERPRHIEV
QILGDKFGNAVHLFERDCSVQRRHQKIVEIAPAPNLAVSIRDKMLSDAVK
LAKFVGYENAGTVEFLYDQVTDKHYFIEVNARLQVEHTVTEDVTGVDLVR
SQILIAEGKSLPELGLTQEEIRSIGYAIQCRITTEDPARDFQPDSGRLEV
FRSGEGMGIRLDSASAFAGAIISPYYDSLLIKVIAHATNFRLACAKMLRS
LREFRVRGVKTNIPFLFNVLENERFLNGSVDTYFIDEHPNLFQFKKSQNR
AQKLLKYLGTLMVNGPVTVLATDLKPSLINPKIPETPITHEYPTGWRDIL
VKSGPKAFAQAVRKHPGCLIMDTTFRDAHQSLLATRVRTYDMAEISPFVA
QNFPNLFSLENWGGATFDVSMRFLKECPWERLETLRKLIPNIPFQMLLRG
ANAVGYTNYPDNIVYKFCDLAVQSGMDIFRVFDCLNYLPNIIVGMDAVHK
AGGVVEASFCYSGDITDPTKTKYNLPYYLKLADDLVKGGAHILGIKDMAG
VLKPNAARILIGELRSKYPDIPIHLHSHDTAGAGVATMLAAAESGVDIVD
CAIDSMSGLTSQPSMGAVVACLQNTPLDTGLNLEKIYSYSSYWEQARRLY
GPFECTTTMRSGNADVYHNQIPGGQYTNLQFQSFSLGLADQFEEVKQKYA
VANDLLGDVIKVTPSSKIVGDLAQFMVQNKIDAKTLVEKADELSLPKSVI
EFFQGHVGEPYGGFPEKLRSKVVKNHKTITGRPGDDLKAFDFEAAKFELN
DLFNHDFDDKDIMSYALYPAVFKEFQYFREEFGPVSKLGTRIFLVGPRIA
EEISVDLEKGKTLHIKTLALSDIRPSGVREVFFELNGQLRSVEIVDKEAS
KTIRVRPKAKKSVRGSVGSPMPGEVLEVKVKEGDSVKKGQTLCIISAMKM
EMSVNSPVDGKVKVVHVAPKMKIEGEDLMIEIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005482Biotin_COase_C
IPR009057Homeobox-like_sf
IPR005930Pyruv_COase
IPR000891PYR_CT
IPR005481BC-like_N
IPR016185PreATP-grasp_dom_sf
IPR013815ATP_grasp_subdomain_1
IPR003379Carboxylase_cons_dom
IPR013785Aldolase_TIM
IPR000089Biotin_lipoyl
IPR005479CbamoylP_synth_lsu-like_ATP-bd
IPR013816ATP_grasp_subdomain_2
IPR001882Biotin_BS
IPR011761ATP-grasp
IPR011764Biotin_carboxylation_dom
IPR011054Rudment_hybrid_motif
IPR011053Single_hybrid_motif
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
GO:0009374biotin binding
GO:0004736pyruvate carboxylase activity
GO:0003824catalytic activity
GO:0046872metal ion binding
GO:0004075biotin carboxylase activity
GO:0000166nucleotide binding
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0006094gluconeogenesis
GO:0006090pyruvate metabolic process
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005482Biotin carboxylase, C-terminalSMARTSM00878Biotin_carb_C_2coord: 384..491
e-value: 4.9E-48
score: 175.6
IPR005482Biotin carboxylase, C-terminalPFAMPF02785Biotin_carb_Ccoord: 384..492
e-value: 9.0E-31
score: 106.2
IPR005481Biotin carboxylase-like, N-terminal domainPFAMPF00289Biotin_carb_Ncoord: 45..153
e-value: 7.5E-41
score: 139.1
NoneNo IPR availableGENE3DG3DSA:2.40.50.100coord: 1111..1188
e-value: 5.7E-23
score: 82.5
NoneNo IPR availableGENE3DG3DSA:1.10.472.90coord: 859..991
e-value: 1.7E-288
score: 960.1
NoneNo IPR availableGENE3DG3DSA:3.30.470.130coord: 33..499
e-value: 1.4E-192
score: 642.2
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 992..1038
e-value: 1.7E-288
score: 960.1
NoneNo IPR availableGENE3DG3DSA:3.10.600.10coord: 503..1101
e-value: 1.7E-288
score: 960.1
NoneNo IPR availablePANTHERPTHR43778FAMILY NOT NAMEDcoord: 36..1188
NoneNo IPR availableCDDcd07937DRE_TIM_PC_TC_5Scoord: 575..858
e-value: 2.18898E-164
score: 486.168
NoneNo IPR availableCDDcd06850biotinyl_domaincoord: 1122..1187
e-value: 2.06909E-26
score: 100.954
NoneNo IPR availableSUPERFAMILYSSF89000post-HMGL domain-likecoord: 876..1052
NoneNo IPR availableSUPERFAMILYSSF51569Aldolasecoord: 570..879
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 127..398
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPFAMPF02786CPSase_L_D2coord: 159..368
e-value: 2.1E-76
score: 256.1
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00867CPSASE_2coord: 331..338
IPR005930Pyruvate carboxylaseTIGRFAMTIGR01235TIGR01235coord: 47..1188
e-value: 0.0
score: 1843.1
IPR005930Pyruvate carboxylasePIRSFPIRSF001594PCBcoord: 40..1188
e-value: 0.0
score: 1785.5
IPR003379Carboxylase, conserved domainPFAMPF02436PYC_OADAcoord: 871..1071
e-value: 9.2E-67
score: 224.6
IPR000089Biotin/lipoyl attachmentPFAMPF00364Biotin_lipoylcoord: 1122..1187
e-value: 7.8E-17
score: 60.9
IPR000089Biotin/lipoyl attachmentPROSITEPS50968BIOTINYL_LIPOYLcoord: 1113..1188
score: 26.546
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 537..858
e-value: 1.7E-288
score: 960.1
IPR000891Pyruvate carboxyltransferasePFAMPF00682HMGL-likecoord: 575..846
e-value: 4.7E-27
score: 95.2
IPR000891Pyruvate carboxyltransferasePROSITEPS50991PYR_CTcoord: 573..842
score: 37.871
IPR001882Biotin-binding sitePROSITEPS00188BIOTINcoord: 1144..1161
IPR011764Biotin carboxylation domainPROSITEPS50979BCcoord: 44..495
score: 53.129
IPR011761ATP-grasp foldPROSITEPS50975ATP_GRASPcoord: 166..362
score: 42.415
IPR016185Pre-ATP-grasp domain superfamilySUPERFAMILYSSF52440PreATP-grasp domaincoord: 35..157
IPR011054Rudiment single hybrid motifSUPERFAMILYSSF51246Rudiment single hybrid motifcoord: 380..498
IPR011053Single hybrid motifSUPERFAMILYSSF51230Single hybrid motifcoord: 1111..1188